


| Basic Information | |
|---|---|
| Family ID | F008587 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 331 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MPSVPAPADPGRDEDPAWLDRDPMTAAEREAWLDRLCAQDDDP |
| Number of Associated Samples | 217 |
| Number of Associated Scaffolds | 331 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 67.53 % |
| % of genes near scaffold ends (potentially truncated) | 92.75 % |
| % of genes from short scaffolds (< 2000 bps) | 87.31 % |
| Associated GOLD sequencing projects | 203 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.37 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (59.215 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (31.118 % of family members) |
| Environment Ontology (ENVO) | Unclassified (28.399 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (38.973 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 25.35% β-sheet: 0.00% Coil/Unstructured: 74.65% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 331 Family Scaffolds |
|---|---|---|
| PF01042 | Ribonuc_L-PSP | 4.23 |
| PF00248 | Aldo_ket_red | 3.93 |
| PF13377 | Peripla_BP_3 | 2.72 |
| PF13302 | Acetyltransf_3 | 2.11 |
| PF12802 | MarR_2 | 1.81 |
| PF13556 | HTH_30 | 1.51 |
| PF04286 | DUF445 | 1.51 |
| PF09656 | PGPGW | 1.51 |
| PF13671 | AAA_33 | 1.51 |
| PF13738 | Pyr_redox_3 | 1.51 |
| PF13450 | NAD_binding_8 | 1.51 |
| PF00881 | Nitroreductase | 1.51 |
| PF12833 | HTH_18 | 1.51 |
| PF02627 | CMD | 1.21 |
| PF13649 | Methyltransf_25 | 0.91 |
| PF12697 | Abhydrolase_6 | 0.91 |
| PF00274 | Glycolytic | 0.91 |
| PF00561 | Abhydrolase_1 | 0.91 |
| PF13561 | adh_short_C2 | 0.60 |
| PF00293 | NUDIX | 0.60 |
| PF12680 | SnoaL_2 | 0.60 |
| PF01243 | Putative_PNPOx | 0.60 |
| PF00486 | Trans_reg_C | 0.60 |
| PF13463 | HTH_27 | 0.60 |
| PF03704 | BTAD | 0.60 |
| PF14200 | RicinB_lectin_2 | 0.60 |
| PF04149 | DUF397 | 0.30 |
| PF02909 | TetR_C_1 | 0.30 |
| PF03551 | PadR | 0.30 |
| PF00583 | Acetyltransf_1 | 0.30 |
| PF00571 | CBS | 0.30 |
| PF00903 | Glyoxalase | 0.30 |
| PF01636 | APH | 0.30 |
| PF14246 | TetR_C_7 | 0.30 |
| PF13180 | PDZ_2 | 0.30 |
| PF08922 | DUF1905 | 0.30 |
| PF02720 | DUF222 | 0.30 |
| PF13466 | STAS_2 | 0.30 |
| PF00392 | GntR | 0.30 |
| PF01832 | Glucosaminidase | 0.30 |
| PF08327 | AHSA1 | 0.30 |
| PF03176 | MMPL | 0.30 |
| PF12727 | PBP_like | 0.30 |
| PF13419 | HAD_2 | 0.30 |
| PF01850 | PIN | 0.30 |
| PF00652 | Ricin_B_lectin | 0.30 |
| PF00067 | p450 | 0.30 |
| PF13551 | HTH_29 | 0.30 |
| PF13546 | DDE_5 | 0.30 |
| PF03631 | Virul_fac_BrkB | 0.30 |
| PF01053 | Cys_Met_Meta_PP | 0.30 |
| PF14534 | DUF4440 | 0.30 |
| PF11716 | MDMPI_N | 0.30 |
| PF02687 | FtsX | 0.30 |
| PF00202 | Aminotran_3 | 0.30 |
| PF08386 | Abhydrolase_4 | 0.30 |
| PF00165 | HTH_AraC | 0.30 |
| PF02467 | Whib | 0.30 |
| PF01047 | MarR | 0.30 |
| PF01370 | Epimerase | 0.30 |
| PF13492 | GAF_3 | 0.30 |
| PF07366 | SnoaL | 0.30 |
| COG ID | Name | Functional Category | % Frequency in 331 Family Scaffolds |
|---|---|---|---|
| COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 4.23 |
| COG2733 | Uncharacterized membrane-anchored protein YjiN, DUF445 family | Function unknown [S] | 1.51 |
| COG4399 | Uncharacterized membrane protein YheB, UPF0754 family | Function unknown [S] | 1.51 |
| COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 1.21 |
| COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 1.21 |
| COG3588 | Fructose-bisphosphate aldolase class 1 | Carbohydrate transport and metabolism [G] | 0.91 |
| COG3629 | DNA-binding transcriptional regulator DnrI/AfsR/EmbR, SARP family, contains BTAD domain | Transcription [K] | 0.60 |
| COG3947 | Two-component response regulator, SAPR family, consists of REC, wHTH and BTAD domains | Transcription [K] | 0.60 |
| COG0075 | Archaeal aspartate aminotransferase or a related aminotransferase, includes purine catabolism protein PucG | Amino acid transport and metabolism [E] | 0.30 |
| COG0156 | 7-keto-8-aminopelargonate synthetase or related enzyme | Coenzyme transport and metabolism [H] | 0.30 |
| COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 0.30 |
| COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 0.30 |
| COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 0.30 |
| COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 0.30 |
| COG1033 | Predicted exporter protein, RND superfamily | General function prediction only [R] | 0.30 |
| COG1295 | Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase) | Function unknown [S] | 0.30 |
| COG1309 | DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmA | Transcription [K] | 0.30 |
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.30 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.30 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.30 |
| COG1921 | Seryl-tRNA(Sec) selenium transferase | Translation, ribosomal structure and biogenesis [J] | 0.30 |
| COG1982 | Arginine/lysine/ornithine decarboxylase | Amino acid transport and metabolism [E] | 0.30 |
| COG2008 | Threonine aldolase | Amino acid transport and metabolism [E] | 0.30 |
| COG2124 | Cytochrome P450 | Defense mechanisms [V] | 0.30 |
| COG2409 | Predicted lipid transporter YdfJ, MMPL/SSD domain, RND superfamily | General function prediction only [R] | 0.30 |
| COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 0.30 |
| COG4100 | Cystathionine beta-lyase family protein involved in aluminum resistance | Inorganic ion transport and metabolism [P] | 0.30 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 59.21 % |
| Unclassified | root | N/A | 40.79 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459012|GOYVCMS01DV8EQ | Not Available | 507 | Open in IMG/M |
| 3300001867|JGI12627J18819_10065502 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1512 | Open in IMG/M |
| 3300004479|Ga0062595_100933148 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 736 | Open in IMG/M |
| 3300005329|Ga0070683_101088705 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
| 3300005334|Ga0068869_101057744 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 709 | Open in IMG/M |
| 3300005337|Ga0070682_101636376 | Not Available | 558 | Open in IMG/M |
| 3300005337|Ga0070682_101940875 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura madurae | 516 | Open in IMG/M |
| 3300005339|Ga0070660_100775870 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura madurae | 805 | Open in IMG/M |
| 3300005434|Ga0070709_11407606 | Not Available | 564 | Open in IMG/M |
| 3300005435|Ga0070714_101567192 | Not Available | 643 | Open in IMG/M |
| 3300005435|Ga0070714_101763967 | Not Available | 604 | Open in IMG/M |
| 3300005435|Ga0070714_102306671 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → unclassified Amycolatopsis → Amycolatopsis sp. ATCC 39116 | 523 | Open in IMG/M |
| 3300005435|Ga0070714_102478603 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 503 | Open in IMG/M |
| 3300005436|Ga0070713_101810600 | Not Available | 592 | Open in IMG/M |
| 3300005436|Ga0070713_102130210 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 543 | Open in IMG/M |
| 3300005437|Ga0070710_10953084 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Actinophytocola → unclassified Actinophytocola → Actinophytocola sp. | 622 | Open in IMG/M |
| 3300005437|Ga0070710_11055388 | Not Available | 594 | Open in IMG/M |
| 3300005439|Ga0070711_100267571 | All Organisms → cellular organisms → Bacteria | 1347 | Open in IMG/M |
| 3300005439|Ga0070711_100603946 | All Organisms → cellular organisms → Bacteria | 915 | Open in IMG/M |
| 3300005439|Ga0070711_100724910 | Not Available | 839 | Open in IMG/M |
| 3300005439|Ga0070711_100942392 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 738 | Open in IMG/M |
| 3300005439|Ga0070711_101819378 | Not Available | 534 | Open in IMG/M |
| 3300005440|Ga0070705_100843235 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
| 3300005457|Ga0070662_100332829 | All Organisms → cellular organisms → Bacteria | 1241 | Open in IMG/M |
| 3300005548|Ga0070665_101559228 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300005555|Ga0066692_10411910 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Streptosporangium → unclassified Streptosporangium → Streptosporangium sp. 'caverna' | 858 | Open in IMG/M |
| 3300005563|Ga0068855_101146668 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 811 | Open in IMG/M |
| 3300005578|Ga0068854_101623916 | Not Available | 589 | Open in IMG/M |
| 3300005610|Ga0070763_10623282 | Not Available | 627 | Open in IMG/M |
| 3300005614|Ga0068856_100818930 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces olivoverticillatus | 950 | Open in IMG/M |
| 3300005614|Ga0068856_101135385 | All Organisms → cellular organisms → Bacteria | 798 | Open in IMG/M |
| 3300005614|Ga0068856_101628006 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 658 | Open in IMG/M |
| 3300005719|Ga0068861_101419597 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
| 3300005843|Ga0068860_101854740 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 625 | Open in IMG/M |
| 3300006028|Ga0070717_11309589 | Not Available | 659 | Open in IMG/M |
| 3300006028|Ga0070717_11655030 | Not Available | 579 | Open in IMG/M |
| 3300006052|Ga0075029_100200481 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1246 | Open in IMG/M |
| 3300006163|Ga0070715_10168851 | Not Available | 1088 | Open in IMG/M |
| 3300006163|Ga0070715_10259012 | Not Available | 913 | Open in IMG/M |
| 3300006175|Ga0070712_100925182 | All Organisms → cellular organisms → Bacteria | 752 | Open in IMG/M |
| 3300006175|Ga0070712_101143491 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 676 | Open in IMG/M |
| 3300006175|Ga0070712_101325099 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 628 | Open in IMG/M |
| 3300006175|Ga0070712_101398522 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Actinophytocola → unclassified Actinophytocola → Actinophytocola sp. | 610 | Open in IMG/M |
| 3300006175|Ga0070712_101717078 | Not Available | 549 | Open in IMG/M |
| 3300006175|Ga0070712_102053836 | Not Available | 500 | Open in IMG/M |
| 3300006176|Ga0070765_100997361 | All Organisms → cellular organisms → Bacteria | 792 | Open in IMG/M |
| 3300006237|Ga0097621_101944359 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae | 561 | Open in IMG/M |
| 3300006575|Ga0074053_10005249 | Not Available | 607 | Open in IMG/M |
| 3300006755|Ga0079222_11283608 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 665 | Open in IMG/M |
| 3300006804|Ga0079221_10918074 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 645 | Open in IMG/M |
| 3300006804|Ga0079221_11480780 | Not Available | 544 | Open in IMG/M |
| 3300006806|Ga0079220_11532047 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 574 | Open in IMG/M |
| 3300006854|Ga0075425_100599596 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1267 | Open in IMG/M |
| 3300006904|Ga0075424_100407193 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1451 | Open in IMG/M |
| 3300006904|Ga0075424_100786435 | Not Available | 1015 | Open in IMG/M |
| 3300006914|Ga0075436_101428848 | Not Available | 525 | Open in IMG/M |
| 3300006954|Ga0079219_10414646 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 900 | Open in IMG/M |
| 3300006954|Ga0079219_10664453 | Not Available | 782 | Open in IMG/M |
| 3300007076|Ga0075435_101325425 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Streptosporangium → Streptosporangium amethystogenes | 631 | Open in IMG/M |
| 3300007788|Ga0099795_10139702 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 984 | Open in IMG/M |
| 3300009012|Ga0066710_103334122 | Not Available | 612 | Open in IMG/M |
| 3300009093|Ga0105240_10889937 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 958 | Open in IMG/M |
| 3300009093|Ga0105240_12059692 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora corrugata | 593 | Open in IMG/M |
| 3300009098|Ga0105245_11185735 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 811 | Open in IMG/M |
| 3300009098|Ga0105245_13223465 | Not Available | 506 | Open in IMG/M |
| 3300009101|Ga0105247_10720502 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 753 | Open in IMG/M |
| 3300009101|Ga0105247_11112697 | Not Available | 624 | Open in IMG/M |
| 3300009101|Ga0105247_11386771 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 568 | Open in IMG/M |
| 3300009162|Ga0075423_10301545 | Not Available | 1679 | Open in IMG/M |
| 3300010046|Ga0126384_10503286 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1045 | Open in IMG/M |
| 3300010048|Ga0126373_12817508 | Not Available | 543 | Open in IMG/M |
| 3300010301|Ga0134070_10449557 | Not Available | 515 | Open in IMG/M |
| 3300010303|Ga0134082_10290966 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 683 | Open in IMG/M |
| 3300010323|Ga0134086_10392970 | Not Available | 556 | Open in IMG/M |
| 3300010333|Ga0134080_10688083 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 506 | Open in IMG/M |
| 3300010358|Ga0126370_12148142 | Not Available | 549 | Open in IMG/M |
| 3300010366|Ga0126379_13805607 | Not Available | 506 | Open in IMG/M |
| 3300010371|Ga0134125_10220330 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 2110 | Open in IMG/M |
| 3300010371|Ga0134125_10593224 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1225 | Open in IMG/M |
| 3300010371|Ga0134125_11774589 | Not Available | 671 | Open in IMG/M |
| 3300010371|Ga0134125_12769933 | Not Available | 533 | Open in IMG/M |
| 3300010373|Ga0134128_11703894 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 694 | Open in IMG/M |
| 3300010375|Ga0105239_11614209 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 750 | Open in IMG/M |
| 3300010375|Ga0105239_12443019 | Not Available | 609 | Open in IMG/M |
| 3300010376|Ga0126381_101350634 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium AB60 | 1030 | Open in IMG/M |
| 3300010396|Ga0134126_11208553 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura madurae | 840 | Open in IMG/M |
| 3300010401|Ga0134121_11007676 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 818 | Open in IMG/M |
| 3300010403|Ga0134123_10264190 | All Organisms → cellular organisms → Bacteria | 1505 | Open in IMG/M |
| 3300010403|Ga0134123_11850711 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura madurae | 658 | Open in IMG/M |
| 3300011119|Ga0105246_11240685 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
| 3300012200|Ga0137382_10237893 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia kujensis | 1259 | Open in IMG/M |
| 3300012201|Ga0137365_10416399 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 991 | Open in IMG/M |
| 3300012204|Ga0137374_10408638 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 1077 | Open in IMG/M |
| 3300012206|Ga0137380_11149332 | Not Available | 660 | Open in IMG/M |
| 3300012209|Ga0137379_11699038 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 528 | Open in IMG/M |
| 3300012350|Ga0137372_10552479 | All Organisms → cellular organisms → Bacteria | 850 | Open in IMG/M |
| 3300012351|Ga0137386_10582711 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Streptosporangium → unclassified Streptosporangium → Streptosporangium sp. 'caverna' | 805 | Open in IMG/M |
| 3300012354|Ga0137366_10846289 | Not Available | 648 | Open in IMG/M |
| 3300012357|Ga0137384_10179260 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1774 | Open in IMG/M |
| 3300012476|Ga0157344_1033146 | Not Available | 505 | Open in IMG/M |
| 3300012685|Ga0137397_10771428 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae | 713 | Open in IMG/M |
| 3300012685|Ga0137397_11147233 | Not Available | 563 | Open in IMG/M |
| 3300012944|Ga0137410_11459011 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300012955|Ga0164298_10856924 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 656 | Open in IMG/M |
| 3300012961|Ga0164302_10164034 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1325 | Open in IMG/M |
| 3300012985|Ga0164308_10097994 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2052 | Open in IMG/M |
| 3300012985|Ga0164308_10158923 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Oryzihumus → Oryzihumus leptocrescens | 1679 | Open in IMG/M |
| 3300012985|Ga0164308_11833962 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura madurae | 565 | Open in IMG/M |
| 3300012989|Ga0164305_10714753 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura madurae | 821 | Open in IMG/M |
| 3300013100|Ga0157373_10230025 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1309 | Open in IMG/M |
| 3300013104|Ga0157370_10964955 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 772 | Open in IMG/M |
| 3300013105|Ga0157369_10991330 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 860 | Open in IMG/M |
| 3300013105|Ga0157369_12351449 | Not Available | 540 | Open in IMG/M |
| 3300013105|Ga0157369_12700344 | Not Available | 500 | Open in IMG/M |
| 3300013296|Ga0157374_11349905 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 735 | Open in IMG/M |
| 3300013306|Ga0163162_12186152 | Not Available | 635 | Open in IMG/M |
| 3300013307|Ga0157372_11056119 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 940 | Open in IMG/M |
| 3300013307|Ga0157372_12526577 | Not Available | 590 | Open in IMG/M |
| 3300014325|Ga0163163_11613897 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 709 | Open in IMG/M |
| 3300014745|Ga0157377_11112760 | Not Available | 606 | Open in IMG/M |
| 3300015372|Ga0132256_102829593 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 583 | Open in IMG/M |
| 3300015372|Ga0132256_102846374 | Not Available | 582 | Open in IMG/M |
| 3300015374|Ga0132255_106158079 | Not Available | 508 | Open in IMG/M |
| 3300016371|Ga0182034_10060807 | Not Available | 2544 | Open in IMG/M |
| 3300016387|Ga0182040_10033990 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 3018 | Open in IMG/M |
| 3300016404|Ga0182037_11854527 | Not Available | 539 | Open in IMG/M |
| 3300017959|Ga0187779_10615925 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
| 3300017966|Ga0187776_10584999 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 775 | Open in IMG/M |
| 3300017972|Ga0187781_10514081 | Not Available | 860 | Open in IMG/M |
| 3300018433|Ga0066667_10274344 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1294 | Open in IMG/M |
| 3300018468|Ga0066662_12008256 | Not Available | 605 | Open in IMG/M |
| 3300019361|Ga0173482_10618420 | Not Available | 547 | Open in IMG/M |
| 3300020581|Ga0210399_10318109 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1299 | Open in IMG/M |
| 3300020581|Ga0210399_10638868 | Not Available | 878 | Open in IMG/M |
| 3300020582|Ga0210395_10403995 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1028 | Open in IMG/M |
| 3300021088|Ga0210404_10171364 | Not Available | 1149 | Open in IMG/M |
| 3300021088|Ga0210404_10638655 | Not Available | 606 | Open in IMG/M |
| 3300021170|Ga0210400_10683474 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 844 | Open in IMG/M |
| 3300021178|Ga0210408_10081415 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2538 | Open in IMG/M |
| 3300021178|Ga0210408_10592108 | Not Available | 878 | Open in IMG/M |
| 3300021178|Ga0210408_10899010 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300021403|Ga0210397_10053794 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 2590 | Open in IMG/M |
| 3300021403|Ga0210397_11115862 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300021404|Ga0210389_10617536 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 851 | Open in IMG/M |
| 3300021405|Ga0210387_11652438 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 544 | Open in IMG/M |
| 3300021420|Ga0210394_11098497 | Not Available | 686 | Open in IMG/M |
| 3300021432|Ga0210384_10229071 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1672 | Open in IMG/M |
| 3300021432|Ga0210384_10333660 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1366 | Open in IMG/M |
| 3300021432|Ga0210384_10546658 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae | 1042 | Open in IMG/M |
| 3300021432|Ga0210384_10906460 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 782 | Open in IMG/M |
| 3300021478|Ga0210402_10326289 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1422 | Open in IMG/M |
| 3300021478|Ga0210402_10653093 | All Organisms → cellular organisms → Bacteria | 973 | Open in IMG/M |
| 3300021478|Ga0210402_10675146 | Not Available | 955 | Open in IMG/M |
| 3300021478|Ga0210402_11522370 | Not Available | 596 | Open in IMG/M |
| 3300021478|Ga0210402_11552120 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 589 | Open in IMG/M |
| 3300021478|Ga0210402_11746471 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 548 | Open in IMG/M |
| 3300021560|Ga0126371_11010610 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 973 | Open in IMG/M |
| 3300021560|Ga0126371_11217413 | Not Available | 889 | Open in IMG/M |
| 3300021560|Ga0126371_11322864 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 853 | Open in IMG/M |
| 3300021560|Ga0126371_13054278 | Not Available | 566 | Open in IMG/M |
| 3300024181|Ga0247693_1022996 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 838 | Open in IMG/M |
| 3300024181|Ga0247693_1040012 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Streptosporangium → Streptosporangium amethystogenes | 664 | Open in IMG/M |
| 3300024222|Ga0247691_1063311 | Not Available | 559 | Open in IMG/M |
| 3300024288|Ga0179589_10085049 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1266 | Open in IMG/M |
| 3300024288|Ga0179589_10252927 | Not Available | 783 | Open in IMG/M |
| 3300024310|Ga0247681_1075704 | Not Available | 535 | Open in IMG/M |
| 3300024323|Ga0247666_1060042 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 764 | Open in IMG/M |
| 3300025898|Ga0207692_10412447 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 844 | Open in IMG/M |
| 3300025898|Ga0207692_10970930 | Not Available | 560 | Open in IMG/M |
| 3300025898|Ga0207692_11007083 | Not Available | 550 | Open in IMG/M |
| 3300025906|Ga0207699_10960456 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 631 | Open in IMG/M |
| 3300025915|Ga0207693_11016470 | Not Available | 632 | Open in IMG/M |
| 3300025916|Ga0207663_10064881 | Not Available | 2332 | Open in IMG/M |
| 3300025916|Ga0207663_10950280 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
| 3300025917|Ga0207660_10039197 | All Organisms → cellular organisms → Bacteria | 3311 | Open in IMG/M |
| 3300025920|Ga0207649_10638036 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 822 | Open in IMG/M |
| 3300025924|Ga0207694_10648890 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 889 | Open in IMG/M |
| 3300025924|Ga0207694_10677700 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 869 | Open in IMG/M |
| 3300025928|Ga0207700_11486464 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 601 | Open in IMG/M |
| 3300025929|Ga0207664_10299514 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1414 | Open in IMG/M |
| 3300025929|Ga0207664_10735404 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 887 | Open in IMG/M |
| 3300025929|Ga0207664_11017800 | All Organisms → cellular organisms → Bacteria | 742 | Open in IMG/M |
| 3300025929|Ga0207664_11606608 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Actinophytocola → unclassified Actinophytocola → Actinophytocola sp. | 572 | Open in IMG/M |
| 3300025931|Ga0207644_10878816 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 751 | Open in IMG/M |
| 3300025932|Ga0207690_10636395 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 873 | Open in IMG/M |
| 3300025935|Ga0207709_11678111 | Not Available | 528 | Open in IMG/M |
| 3300025939|Ga0207665_10148045 | All Organisms → cellular organisms → Bacteria | 1679 | Open in IMG/M |
| 3300025939|Ga0207665_10966072 | Not Available | 677 | Open in IMG/M |
| 3300025944|Ga0207661_10913123 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 809 | Open in IMG/M |
| 3300025945|Ga0207679_10334776 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1315 | Open in IMG/M |
| 3300025945|Ga0207679_11603084 | Not Available | 596 | Open in IMG/M |
| 3300025949|Ga0207667_10519007 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1207 | Open in IMG/M |
| 3300025949|Ga0207667_11761469 | Not Available | 584 | Open in IMG/M |
| 3300026075|Ga0207708_10211396 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1551 | Open in IMG/M |
| 3300026088|Ga0207641_11872138 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 601 | Open in IMG/M |
| 3300026116|Ga0207674_10887709 | Not Available | 859 | Open in IMG/M |
| 3300026118|Ga0207675_101598233 | Not Available | 672 | Open in IMG/M |
| 3300026121|Ga0207683_10175602 | All Organisms → cellular organisms → Bacteria | 1941 | Open in IMG/M |
| 3300026142|Ga0207698_11316918 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura madurae | 737 | Open in IMG/M |
| 3300026142|Ga0207698_12661657 | Not Available | 509 | Open in IMG/M |
| 3300026552|Ga0209577_10304323 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1188 | Open in IMG/M |
| 3300026899|Ga0209326_1003266 | Not Available | 1258 | Open in IMG/M |
| 3300026920|Ga0208575_1027345 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Streptosporangium → Streptosporangium amethystogenes | 509 | Open in IMG/M |
| 3300027521|Ga0209524_1020016 | Not Available | 1380 | Open in IMG/M |
| 3300027775|Ga0209177_10262720 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 643 | Open in IMG/M |
| 3300027903|Ga0209488_10458499 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Streptosporangium → unclassified Streptosporangium → Streptosporangium sp. 'caverna' | 938 | Open in IMG/M |
| 3300027903|Ga0209488_10576248 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Actinophytocola → unclassified Actinophytocola → Actinophytocola sp. | 819 | Open in IMG/M |
| 3300028047|Ga0209526_10539605 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Streptosporangium → unclassified Streptosporangium → Streptosporangium sp. 'caverna' | 755 | Open in IMG/M |
| 3300028047|Ga0209526_10576739 | Not Available | 723 | Open in IMG/M |
| 3300028047|Ga0209526_10738488 | Not Available | 616 | Open in IMG/M |
| 3300028072|Ga0247675_1016792 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1044 | Open in IMG/M |
| 3300028379|Ga0268266_10896128 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 858 | Open in IMG/M |
| 3300028379|Ga0268266_11285524 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 707 | Open in IMG/M |
| 3300028379|Ga0268266_12350636 | Not Available | 504 | Open in IMG/M |
| 3300028380|Ga0268265_10791357 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 924 | Open in IMG/M |
| 3300028381|Ga0268264_10953575 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 863 | Open in IMG/M |
| 3300028536|Ga0137415_10764915 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 777 | Open in IMG/M |
| 3300028799|Ga0307284_10323515 | Not Available | 622 | Open in IMG/M |
| 3300028807|Ga0307305_10337037 | Not Available | 684 | Open in IMG/M |
| 3300028884|Ga0307308_10375637 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura madurae | 681 | Open in IMG/M |
| 3300031543|Ga0318516_10384865 | All Organisms → cellular organisms → Bacteria | 809 | Open in IMG/M |
| 3300031544|Ga0318534_10285125 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 952 | Open in IMG/M |
| 3300031544|Ga0318534_10791526 | Not Available | 533 | Open in IMG/M |
| 3300031546|Ga0318538_10787666 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300031573|Ga0310915_10806578 | Not Available | 660 | Open in IMG/M |
| 3300031680|Ga0318574_10856652 | Not Available | 532 | Open in IMG/M |
| 3300031680|Ga0318574_10856783 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300031681|Ga0318572_10022910 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 3162 | Open in IMG/M |
| 3300031681|Ga0318572_10353302 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 872 | Open in IMG/M |
| 3300031681|Ga0318572_10415332 | Not Available | 800 | Open in IMG/M |
| 3300031713|Ga0318496_10246861 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 984 | Open in IMG/M |
| 3300031713|Ga0318496_10541604 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 643 | Open in IMG/M |
| 3300031719|Ga0306917_11594236 | Not Available | 501 | Open in IMG/M |
| 3300031723|Ga0318493_10335585 | Not Available | 820 | Open in IMG/M |
| 3300031724|Ga0318500_10552662 | Not Available | 581 | Open in IMG/M |
| 3300031748|Ga0318492_10411133 | Not Available | 712 | Open in IMG/M |
| 3300031751|Ga0318494_10072946 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1852 | Open in IMG/M |
| 3300031751|Ga0318494_10125713 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1431 | Open in IMG/M |
| 3300031751|Ga0318494_10771506 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 563 | Open in IMG/M |
| 3300031751|Ga0318494_10821496 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300031765|Ga0318554_10231155 | Not Available | 1053 | Open in IMG/M |
| 3300031769|Ga0318526_10139061 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 985 | Open in IMG/M |
| 3300031770|Ga0318521_10739175 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 598 | Open in IMG/M |
| 3300031770|Ga0318521_10833199 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 563 | Open in IMG/M |
| 3300031771|Ga0318546_10183024 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 1425 | Open in IMG/M |
| 3300031771|Ga0318546_10755628 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
| 3300031778|Ga0318498_10039799 | All Organisms → cellular organisms → Bacteria | 2065 | Open in IMG/M |
| 3300031778|Ga0318498_10130507 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1143 | Open in IMG/M |
| 3300031779|Ga0318566_10382718 | Not Available | 693 | Open in IMG/M |
| 3300031779|Ga0318566_10437336 | Not Available | 642 | Open in IMG/M |
| 3300031781|Ga0318547_10514827 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
| 3300031798|Ga0318523_10296227 | All Organisms → cellular organisms → Bacteria | 807 | Open in IMG/M |
| 3300031798|Ga0318523_10411159 | Not Available | 672 | Open in IMG/M |
| 3300031805|Ga0318497_10437614 | Not Available | 732 | Open in IMG/M |
| 3300031821|Ga0318567_10345493 | All Organisms → cellular organisms → Bacteria | 841 | Open in IMG/M |
| 3300031821|Ga0318567_10474540 | Not Available | 710 | Open in IMG/M |
| 3300031832|Ga0318499_10285924 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 638 | Open in IMG/M |
| 3300031845|Ga0318511_10261744 | All Organisms → cellular organisms → Bacteria | 777 | Open in IMG/M |
| 3300031846|Ga0318512_10001300 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 7578 | Open in IMG/M |
| 3300031846|Ga0318512_10667857 | Not Available | 532 | Open in IMG/M |
| 3300031859|Ga0318527_10441744 | Not Available | 555 | Open in IMG/M |
| 3300031860|Ga0318495_10128695 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia → Candidatus Frankia californiensis | 1141 | Open in IMG/M |
| 3300031890|Ga0306925_11919602 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300031893|Ga0318536_10673002 | Not Available | 516 | Open in IMG/M |
| 3300031910|Ga0306923_11168106 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 825 | Open in IMG/M |
| 3300031912|Ga0306921_10224740 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2200 | Open in IMG/M |
| 3300031912|Ga0306921_12014499 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 614 | Open in IMG/M |
| 3300031941|Ga0310912_10783543 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
| 3300031942|Ga0310916_11122899 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 652 | Open in IMG/M |
| 3300031942|Ga0310916_11450174 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300031947|Ga0310909_10109385 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Oryzihumus → Oryzihumus leptocrescens | 2232 | Open in IMG/M |
| 3300032001|Ga0306922_10817484 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 973 | Open in IMG/M |
| 3300032001|Ga0306922_12287085 | Not Available | 519 | Open in IMG/M |
| 3300032008|Ga0318562_10563219 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 659 | Open in IMG/M |
| 3300032008|Ga0318562_10825078 | Not Available | 530 | Open in IMG/M |
| 3300032039|Ga0318559_10268563 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 790 | Open in IMG/M |
| 3300032044|Ga0318558_10542684 | Not Available | 581 | Open in IMG/M |
| 3300032066|Ga0318514_10158236 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1177 | Open in IMG/M |
| 3300032067|Ga0318524_10079668 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1602 | Open in IMG/M |
| 3300032068|Ga0318553_10462478 | Not Available | 665 | Open in IMG/M |
| 3300032076|Ga0306924_10567307 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Actinopolymorphaceae → Actinopolymorpha | 1287 | Open in IMG/M |
| 3300032089|Ga0318525_10283013 | All Organisms → cellular organisms → Bacteria | 852 | Open in IMG/M |
| 3300032089|Ga0318525_10382062 | Not Available | 722 | Open in IMG/M |
| 3300032090|Ga0318518_10661056 | Not Available | 532 | Open in IMG/M |
| 3300032091|Ga0318577_10162866 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1063 | Open in IMG/M |
| 3300032174|Ga0307470_10251294 | Not Available | 1168 | Open in IMG/M |
| 3300032180|Ga0307471_100714662 | Not Available | 1167 | Open in IMG/M |
| 3300032261|Ga0306920_100411750 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes → Actinoplanes rishiriensis | 2010 | Open in IMG/M |
| 3300032770|Ga0335085_10073805 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4504 | Open in IMG/M |
| 3300032770|Ga0335085_10343176 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1753 | Open in IMG/M |
| 3300032783|Ga0335079_10022793 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 7168 | Open in IMG/M |
| 3300032783|Ga0335079_11532063 | Not Available | 657 | Open in IMG/M |
| 3300032805|Ga0335078_10929839 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1040 | Open in IMG/M |
| 3300032805|Ga0335078_12053299 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 609 | Open in IMG/M |
| 3300032828|Ga0335080_10070396 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3878 | Open in IMG/M |
| 3300032829|Ga0335070_10222932 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1864 | Open in IMG/M |
| 3300032829|Ga0335070_11831708 | Not Available | 548 | Open in IMG/M |
| 3300032892|Ga0335081_11840691 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium AB60 | 653 | Open in IMG/M |
| 3300032892|Ga0335081_12042302 | Not Available | 610 | Open in IMG/M |
| 3300032892|Ga0335081_12586531 | Not Available | 521 | Open in IMG/M |
| 3300032954|Ga0335083_10046869 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4619 | Open in IMG/M |
| 3300032954|Ga0335083_10980418 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 666 | Open in IMG/M |
| 3300032954|Ga0335083_11266014 | Not Available | 569 | Open in IMG/M |
| 3300032955|Ga0335076_10463795 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1150 | Open in IMG/M |
| 3300033134|Ga0335073_10277307 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2025 | Open in IMG/M |
| 3300033134|Ga0335073_11794142 | Not Available | 573 | Open in IMG/M |
| 3300033158|Ga0335077_10761043 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes | 990 | Open in IMG/M |
| 3300033290|Ga0318519_10508399 | Not Available | 726 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 31.12% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 9.97% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 6.04% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.74% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.63% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.32% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.02% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 3.02% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 2.42% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.11% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.11% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.72% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.81% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.81% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.81% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.81% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.81% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.51% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.51% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.51% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.21% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.21% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.91% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.60% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.60% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.60% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.60% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.60% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.30% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.30% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.30% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.30% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.30% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.30% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.30% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.30% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.30% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.30% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459012 | Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO1O1 lysis Rhizosphere grass | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006572 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006575 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012476 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 | Host-Associated | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300024181 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK34 | Environmental | Open in IMG/M |
| 3300024222 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK32 | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300024310 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK22 | Environmental | Open in IMG/M |
| 3300024323 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK07 | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300026899 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300026920 | Forest soil microbial communities from Willamette National Forest, Oregon, USA, amended with Nitrogen - NN397 (SPAdes) | Environmental | Open in IMG/M |
| 3300027521 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028072 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK16 | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031832 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
| 3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| N56_06849690 | 2170459012 | Grass Soil | MPSVPAPADPGWDEDPARPDPARPDRDPETAAEREAWLDRLCAQDDDPFDAPQEYW |
| JGI12627J18819_100655021 | 3300001867 | Forest Soil | MPAEPVPADPGPEGDLAWLDRDPMTAGERQASLDRLCEQDE |
| Ga0062595_1009331482 | 3300004479 | Soil | MAAPSVPADPGWGEDPAWLDRDPMSAAEREAWLDRLCQADDDPADAPQEYW |
| Ga0070683_1010887052 | 3300005329 | Corn Rhizosphere | MPSVPAPADPGRDEDPAWPDRDPMTAAEREAWLDRLCAQD |
| Ga0068869_1010577441 | 3300005334 | Miscanthus Rhizosphere | MPSVPAPADPGRDEDPAWLDRDPMTAAEREAWLDRLCAQDDDP |
| Ga0070682_1016363763 | 3300005337 | Corn Rhizosphere | MPASPAPADPGRDDDLAWLDRDPMTAAEREASLDRLCEQDEGHLQEEDEY |
| Ga0070682_1019408751 | 3300005337 | Corn Rhizosphere | MPSVPAPADPGRDEDPAWLDRDPMTAAEREAWLDRLCAQDDDPSDAPQ |
| Ga0070660_1007758702 | 3300005339 | Corn Rhizosphere | MWSMPSVPAPADPGRDEDPAWLDRDPMTAAEREAWLDRLCAQ |
| Ga0070709_114076062 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MPASPAPADNGRDDDLAWLDRDPMTAAEREASLDRLCEQDEGH |
| Ga0070714_1015671921 | 3300005435 | Agricultural Soil | MWSMPSVPAPADPGRDEDPAWLDRDPMTAGEREAWLDRLCAQ |
| Ga0070714_1017639671 | 3300005435 | Agricultural Soil | MPSVPAPADPGRDDDPAWLDRDPMTAAEREAWLDRLCAQDD |
| Ga0070714_1023066711 | 3300005435 | Agricultural Soil | MSASPASADPGRDDDLAWLDRDPMTAAEREASLDRLCEQDEGHLQEEDE |
| Ga0070714_1024786031 | 3300005435 | Agricultural Soil | MPAPPAPADPGWDDDLAWLDRDPMTAAERQASLDRLCEQDEGYRVDEDEY |
| Ga0070713_1018106002 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MLPSPVPADPGWDEDLAWLDRDPMTAAEFEASLDRLCELDEGPGED |
| Ga0070713_1021302101 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MLPSPVPADPGWDEDLTWLDRDPMTAAEFEASLDRLCELDEG |
| Ga0070710_109530841 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MPPESVSVDPEWDEDLAWLDRDPVTAAEFEASLDRLCERDEGP |
| Ga0070710_110553881 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MPSVPAPADPGRDGDPAWPDRDPMTAAEREAWLDRLCAQDD |
| Ga0070711_1002675713 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MSPSPAPADPGWDEDLAWLDRDPVTAAEFEASLDRLCELDEGPGEDEDEDYYPPLT |
| Ga0070711_1006039461 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MWLMPSVPAPADPGWDEDPAWLDRDPMTAAEREAWLDRLCAQDDDPS |
| Ga0070711_1007249101 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MWFMPSVPAPADPGWDEDPAWPDRDPMTAAEREAWLDRLCEQDDDPFDA |
| Ga0070711_1009423922 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MLPSPAPADPGRDEDLTWLDRDPVTAAEFEASLDRLCELDEGPGEDEDEDYYPPLT |
| Ga0070711_1018193781 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MPASPAPADPGRDDDLAWLDRDPMTAAEREASLDRLCEQD |
| Ga0070705_1008432352 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MWLMPSVPAPADPGWDEDPAWLDRDPMSPAEREAWLDRLCQA |
| Ga0070662_1003328293 | 3300005457 | Corn Rhizosphere | MSASPGPADPGRDDDLAWLDSDPMTAAEREASLDRLCEQD |
| Ga0070665_1015592282 | 3300005548 | Switchgrass Rhizosphere | MWSMPSVPAPADPGRDGDPAWLDRDPMTAAEREAWLDRLCAQDDD |
| Ga0066692_104119102 | 3300005555 | Soil | MPPEPVPADPGWDGDLAWLDRDPMTAAEREAWLDRLCAMDDDPSD |
| Ga0068855_1011466683 | 3300005563 | Corn Rhizosphere | MPSVPAPADPGRDGDPAWLDRDPMTAGEREAWLDRLCAQD |
| Ga0068854_1016239161 | 3300005578 | Corn Rhizosphere | MSASPASADPGRDDDLAWLDRDPMTAAEREASLDRLCEQ |
| Ga0070763_106232821 | 3300005610 | Soil | MLPSPVPADPGWDEDLAWLDRDPVTAAEFEASLDRLCERDEGPGE |
| Ga0068856_1008189302 | 3300005614 | Corn Rhizosphere | MPSVPGPADPGRDGDPAWLDRDPMTAAEREAWLDRLCQ |
| Ga0068856_1011353852 | 3300005614 | Corn Rhizosphere | MPSVPAPADPGRDDDPAWLDRDPMTAAEREAWLDRLCQLDDDPADAPGE |
| Ga0068856_1016280062 | 3300005614 | Corn Rhizosphere | MSASPAPADPGRDDDLAWLDRDPMTAAEREASLDRLCEQDE |
| Ga0068861_1014195971 | 3300005719 | Switchgrass Rhizosphere | MPSVPAPADPGRDDDPAWLDRDPMTAAEREAWLDRLC |
| Ga0068860_1018547402 | 3300005843 | Switchgrass Rhizosphere | MSASPGPADPGRDDDLAWLDSDPMTAAEREASLDRLCE |
| Ga0070717_113095891 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MWPMPSVPAPADPGRDEDPAWLDRDPMTAAEREAWLDRLCAQDDDPSDAPQEY |
| Ga0070717_116550301 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MPSVPAPADPGRDDDPAWLDRDPMTAAEREAWLDRLCAQDDDPVND |
| Ga0075029_1002004814 | 3300006052 | Watersheds | MPSVPAPGDPGRDEDPAWPDRDPMTAGEREAWLDRLC |
| Ga0070715_101688511 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MAAPSVPADPGWGEDPAWLDRDPMSAAEREAWLDRLC |
| Ga0070715_102590121 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MWLMPSVPAPADPGWDEDPAGPDRDPMSPAEREAWLDRLCQLDDDPSDA |
| Ga0070712_1009251821 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MPPEPAPADPGWDEDPAWPDRDPMTGAEREAWLDRLCALDDDPCDA |
| Ga0070712_1011434911 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MPPSPVPADPGWDEDLAWLDRDPMTAAEFEASLDRLCERDEGPGEDED |
| Ga0070712_1013250991 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MLPSPVPADPGWDEDLAWLDRDPVTAAEFEASLDRL |
| Ga0070712_1013985221 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MPPESVSVDPEWDEDLAWLDRDPVTAAEFEASLDRLCERDEGPG |
| Ga0070712_1017170781 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MPSVPAPADPGRDDDPAWLDRDPMTAAEREAWLDRLCAQDDDPSDE |
| Ga0070712_1020538362 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MWSMPSVPAPADPGRDEDPAWLDRDPMTAAEREAWLDRLCAQDDDPSD |
| Ga0070765_1009973611 | 3300006176 | Soil | MPSVPAPADPGWDEDPAWLDRDPMSPAEREAWLDRLCQLDDDPSD |
| Ga0097621_1019443592 | 3300006237 | Miscanthus Rhizosphere | MWFMPSVPAPADPGWDGDPAWLDRDPMTAAEREAWL |
| Ga0074051_100053592 | 3300006572 | Soil | MPSVPVPADPGWDDDLAWLDRDPMTPAELEAQLDRLCELDEPDPGDEDEYCRS* |
| Ga0074053_100052491 | 3300006575 | Soil | MPSVPAPADPGWDGDPAWLDRDPMTAAEREAWLDRLCAQ |
| Ga0079222_112836081 | 3300006755 | Agricultural Soil | MPASPAPADPGWDDDLAWLDRDPMAAAEREASLDRLCEQDEGYREDE |
| Ga0079221_109180742 | 3300006804 | Agricultural Soil | MPAPSAPADPGRDDDLAWLDRDPMTAAEREASLDR |
| Ga0079221_114807802 | 3300006804 | Agricultural Soil | MWFMPAEPVPAAPGRDDDLAWLDRDPMTAAERAEWLDRVCEHDEPPEE |
| Ga0079220_115320471 | 3300006806 | Agricultural Soil | MPSVPAPADPGRDGDPAWLDRDPMTAGEREAWLDRLCQLDDDPSDAPG |
| Ga0075425_1005995962 | 3300006854 | Populus Rhizosphere | MPSVPTPADPGWGEGPAWLDRDPMSAAEREAWLDRLCQADDDPCDGPQEYWD |
| Ga0075424_1004071934 | 3300006904 | Populus Rhizosphere | MPSVPAPADPGRDGEPAWPGRDPVSAAEREAWLDRLCARDDDPSD |
| Ga0075424_1007864351 | 3300006904 | Populus Rhizosphere | MPASPAPADPGWDDDLAWLDRDPMTAAEREASLDRLCEQ |
| Ga0075436_1014288481 | 3300006914 | Populus Rhizosphere | MWFMPPSPVPADPGWGEDPAWLDRDPMSAAEREAWLDRLCARDDDPSD |
| Ga0079219_104146461 | 3300006954 | Agricultural Soil | MPSVQPPRTPGGTRIPPGLDRDPMTAAEREAWLDRLCAQDDDPSD |
| Ga0079219_106644531 | 3300006954 | Agricultural Soil | MPSVPAPADPGRDGDPAWLDRDPVTAAEREAWLDRLCAQDDDPLDDPQEYW |
| Ga0075435_1013254252 | 3300007076 | Populus Rhizosphere | MPASPASADPGWDDDLAWLDRDPMTAAEREASLDRLCEQ |
| Ga0099795_101397021 | 3300007788 | Vadose Zone Soil | MAAPSVPAGPGWDEDLAWPDRDPVSPAEREAWLDRLCQLDDDPAD |
| Ga0066710_1033341222 | 3300009012 | Grasslands Soil | MPPSPVPADPGWGEDPAWLDRDPVSAAEREAWLDRLCQ |
| Ga0105240_108899373 | 3300009093 | Corn Rhizosphere | MWSMPSVPAPADPGRDDDPAWLDRDPMTAAEREAWLDRLCAQDDDPA |
| Ga0105240_120596922 | 3300009093 | Corn Rhizosphere | MWSMPSVPAPADPGRDEDPAWVDRDPMTAAEREAWL |
| Ga0105245_111857351 | 3300009098 | Miscanthus Rhizosphere | MPASPAPADPGRDDDLAWLDRDPMTAAEREASLDRLCEQDEGYLQDEDEYG |
| Ga0105245_132234651 | 3300009098 | Miscanthus Rhizosphere | MPSVPAPADPGRDEDPAWLDRDPMTAAEREAWLDRLCAQDDDPADG |
| Ga0105247_107205021 | 3300009101 | Switchgrass Rhizosphere | MWLMPSVPAPADPGWDEDPAWLDRDPMTAAEREAWLDRLCALDDDPCDAP |
| Ga0105247_111126972 | 3300009101 | Switchgrass Rhizosphere | MPASPAPADPGRDDDLAWLDRDPMTTAEREASLDRLCEQDEGYLQDED |
| Ga0105247_113867712 | 3300009101 | Switchgrass Rhizosphere | MPPEPVPADPGWDEDLAWLDRDPVTAAEFEASLDRLCERDEGPGEDEDE |
| Ga0075423_103015451 | 3300009162 | Populus Rhizosphere | MPPESASVDPGWDEDLAWLDRDPMTAEEFEASLDRLCELDEGPGEDEEENYLPP |
| Ga0126384_105032861 | 3300010046 | Tropical Forest Soil | MPSVPASADPGRDEDPAWLDRDPMTAAEREAWLDRLCAQDDDPAD |
| Ga0126373_128175081 | 3300010048 | Tropical Forest Soil | MPSIPAPADPGRDEGPARPGRDPVRPEDREAWLDRLYEHDEPPEP |
| Ga0134070_104495571 | 3300010301 | Grasslands Soil | MPPSPVPADPGWDEDLTWLDRDPVTAAEFEASLDRLCERDEG |
| Ga0134082_102909661 | 3300010303 | Grasslands Soil | MPASSVPADPGWDEDLAWLDRDPMTAEEREASLDRLCEQDEPP |
| Ga0134109_102882042 | 3300010320 | Grasslands Soil | MPPEPVSADPGWDDDPAWSRPDPMTAAEREAWLDRLCEQD |
| Ga0134086_103929701 | 3300010323 | Grasslands Soil | MPPSPVPAGPGWDEDLAWLDRDPMTAAEFEASLDRLCELDEGPGE |
| Ga0134080_106880831 | 3300010333 | Grasslands Soil | MSPSPVPAGPGWDEDLAWLDRDPMTAAEFEASLDRLCELDE |
| Ga0126370_121481422 | 3300010358 | Tropical Forest Soil | MWSMPSVPASEDPGRDEDPAWLDRDPMTAAEREAWLDRLCQLDDDP |
| Ga0126379_138056071 | 3300010366 | Tropical Forest Soil | MCFMSSMPAHGDPGRDEDPAWLDRDPMTAAEREAWLDRLCAQDDD |
| Ga0134125_102203302 | 3300010371 | Terrestrial Soil | MSLPPVPADPGWDEDLTWLDRDPMTAAEFEASLDRLCELDEGPGE |
| Ga0134125_105932243 | 3300010371 | Terrestrial Soil | MSAMAAMPDSADPGWDDDLAWLDRDPATPEELEAALDRLC |
| Ga0134125_117745891 | 3300010371 | Terrestrial Soil | MWLMPPEPAPADPGWDEDPAGLDRDPMSPAEREAWLDRLCAQDDDPCDAPQE |
| Ga0134125_127699331 | 3300010371 | Terrestrial Soil | MPSVPASPDPGRDEDPAWLDRDPMTAAEREAWLDRLCAQDDDP |
| Ga0134128_117038942 | 3300010373 | Terrestrial Soil | MWSMPSVPAPADPGRDGDPAWLDRDPMTAAEREAWLDRLCAQD |
| Ga0105239_116142091 | 3300010375 | Corn Rhizosphere | MWSMPSVPGPADPGRDGDPAWLDRDPMTAAEREAWLDR |
| Ga0105239_124430191 | 3300010375 | Corn Rhizosphere | MSASPGPADPGRDDDLAWLDRDPMTAAEREASLDRLCEQDEGH |
| Ga0126381_1013506343 | 3300010376 | Tropical Forest Soil | MWFMPSVPAPADPGWDEDPAWPDRDPVSPEDREAWLDRLCEQD |
| Ga0126381_1024075131 | 3300010376 | Tropical Forest Soil | MPDPASPGWDEDLAWLDQDPMSAEEREVWLDRLCELDEP |
| Ga0134126_112085532 | 3300010396 | Terrestrial Soil | MPSVPAPADPGRDEDPAWLDRDPMTAAEREAWLDRLCAQDDD |
| Ga0134121_110076762 | 3300010401 | Terrestrial Soil | MPSVPAPADPGRDDDPAWLDRDPMTAAEREAWLDRLCAQDDDPADG |
| Ga0134123_102641904 | 3300010403 | Terrestrial Soil | MPSVPAPADPGRDEDPAWPDRDPMTAAEREAWLDRLCAQDDDPSDAP |
| Ga0134123_118507112 | 3300010403 | Terrestrial Soil | MWSMPSVPAPADPGRDDDPAWLDRDPMTAAEREAWLDRLCAQDDDPSDAP |
| Ga0105246_112406852 | 3300011119 | Miscanthus Rhizosphere | MWSMPSVPAPADPGRDEDPAWLDRDPMTAAEREAWLDRLCAQDD |
| Ga0137383_103514441 | 3300012199 | Vadose Zone Soil | MPPSPVPADPGWDEDLGWLDRDPMTAAEREELMDRICEQDEPPGEEEYEDYVP |
| Ga0137382_102378931 | 3300012200 | Vadose Zone Soil | MPPESVSADPGWDEDLAWLDRDPMTAAEFEASLDRLCERDEGPGEDE |
| Ga0137365_104163992 | 3300012201 | Vadose Zone Soil | MPPSPVPADPGWDEDLAWLDRDPMTAAEFEASLDRLCELDEGYSEEELRERRAVHG* |
| Ga0137374_104086383 | 3300012204 | Vadose Zone Soil | MPASPAPADPGRDDDLAWPDRDPMTAAERQASLDRLCEQDEGYREDEADEY |
| Ga0137380_111493321 | 3300012206 | Vadose Zone Soil | MWFMPSVPAPADPGWDEDPAWLDRDPMTAAEREAWLDRLC |
| Ga0137379_116990381 | 3300012209 | Vadose Zone Soil | MASMAAMPDPADPGWDDDLAWLDRDPVTPAEREASLDRLCELDDPDPEEEEEYWD |
| Ga0137372_105524792 | 3300012350 | Vadose Zone Soil | MPAEPVPADPGRDGDPAWLDQDPMTAAEREAWLDRLCAQDDDPSDAPQ |
| Ga0137386_105827111 | 3300012351 | Vadose Zone Soil | MPPEPVPADPGWDGDLAWLDRDPMTAAEREAWLDRLCAQDDDP |
| Ga0137366_108462892 | 3300012354 | Vadose Zone Soil | MPSVPAPADPGWDEDPAWLDRDPVTAEEREAWLDRLCEQDDPFDD |
| Ga0137384_101792604 | 3300012357 | Vadose Zone Soil | MPPEPVPADPGWDEDLAWLDRDPMTAAEREAWLDRLAEADEPPDLEE |
| Ga0157344_10331461 | 3300012476 | Arabidopsis Rhizosphere | MPSVPAPADPGRDDDPAWLDRDPMTAAEREAWLDRLCAQDDDPADA |
| Ga0137397_107714282 | 3300012685 | Vadose Zone Soil | MPPEPVPAGPGRDEDLTWLDRDPMTAAEREAWLDR |
| Ga0137397_111472332 | 3300012685 | Vadose Zone Soil | MWFMPSVPAPADPGRGEDPAWPDRDPMTAAEREARL |
| Ga0137410_114590111 | 3300012944 | Vadose Zone Soil | MPPDPVPADPGRDGDLAWLDRDPMTAEEREAALDRL |
| Ga0164298_108569241 | 3300012955 | Soil | MLPSPVPADPGWDEDLAWLDCDPVTAAEFEASLDRLCERDEGP |
| Ga0164301_105213462 | 3300012960 | Soil | MSAEPVPDDSGREDDLAWLDQDPMTAADREAWLDHLCQL |
| Ga0164302_101640341 | 3300012961 | Soil | MPSVPAPADPGRDEDPARLDRDPMTAGEREAWLDRLCAQDDDPSDK |
| Ga0164308_100979943 | 3300012985 | Soil | MPAPPAPADPGRDDDLAWLDGDPMTAAERQASLDRLCEQDEGYREE |
| Ga0164308_101589232 | 3300012985 | Soil | MPASPAPADPGWDDDLAWLDGDPMTAAERQASLDRLCEQDEGYREE |
| Ga0164308_118339621 | 3300012985 | Soil | MPSVPAPADPGRDGDPAWLDRDPVTAGEREAWLDRLCAQDDDPADAPQEYRDP |
| Ga0164305_107147532 | 3300012989 | Soil | MWSMPSVPAPADPGRDGDPAWLDRDPMTAAEREAWLDRLCQLD |
| Ga0157373_102300251 | 3300013100 | Corn Rhizosphere | MPSVPAPADPGRDDDPAGLDRDPMTAAEREAWLDR |
| Ga0157370_109649552 | 3300013104 | Corn Rhizosphere | MPASPAPADPGRDDDLAWLDRDPMTAAEREASLDRLCEQDEGHLQ |
| Ga0157369_109913301 | 3300013105 | Corn Rhizosphere | MWSMPSVPAPADPGRDEDPAWLDRDPMTAAEREAWLDRLC |
| Ga0157369_123514492 | 3300013105 | Corn Rhizosphere | MWSMPSVPAPADPGRDEDPAWPDRDPMTAAEREAWLDRLCAQDDDPADA |
| Ga0157369_127003441 | 3300013105 | Corn Rhizosphere | MSASPAPADPGRDDDLAWLDRDPMTAAEREASLDRLCEQD |
| Ga0157374_113499053 | 3300013296 | Miscanthus Rhizosphere | MPSVPAPADPGRDGDPAWLDRDPMTAAEREAWLDRLCA |
| Ga0163162_121861521 | 3300013306 | Switchgrass Rhizosphere | MPASPAPADPGRDDDLAWLDRDPMTAAEREASLDRLCEQDEGHLQEEDEYGN |
| Ga0157372_110561191 | 3300013307 | Corn Rhizosphere | MSLPPVPADPGWDEDLTWLDRDPMTAAEFEASLDRLC |
| Ga0157372_125265771 | 3300013307 | Corn Rhizosphere | MPASPAPADPGRDDDLAWLDRDPMAAAEREASLDRLCEQDE |
| Ga0163163_116138972 | 3300014325 | Switchgrass Rhizosphere | MWSMPSVPAPADPGRDDDPAWLDRDPMTAAEREAWLD |
| Ga0157377_111127602 | 3300014745 | Miscanthus Rhizosphere | MWSMPSVPAPADPGRDEDPAWLDRDPMTAAEREAWLDRLCAQDDDPADAPQE |
| Ga0132256_1028295931 | 3300015372 | Arabidopsis Rhizosphere | MWFMPSVPAPPDPGRDEDPAWLDRDPMTAAEREAWLDRLC |
| Ga0132256_1028463741 | 3300015372 | Arabidopsis Rhizosphere | MWSMPSVPAPADPGRDDDPAWLDRDPMTAAEREAWLDRLCAQDDDPSDD |
| Ga0132255_1061580792 | 3300015374 | Arabidopsis Rhizosphere | MPSVPAPADPGRDDDPARLDRDPMTAAEREAWLDRLCAQ |
| Ga0182034_100608073 | 3300016371 | Soil | MPSVPAHGDPGRDEDPAWLDRDPMTAAEREAWLDRLCAQDDD |
| Ga0182040_100339901 | 3300016387 | Soil | MWFMSSVPVHGDPGRDEDPAWLDRDPMTAAEREAWLDRLCAQDDD |
| Ga0182037_118545271 | 3300016404 | Soil | MSSVPAPADPGWDEDPARPGRDPASPEEQEAWLDRLCERDDDPFYDPQEYW |
| Ga0187779_106159252 | 3300017959 | Tropical Peatland | MWFMSSVPAPADPRWDEDPARPGRDPDSPEDQDAWLDRLCELDGDPFYGP |
| Ga0187776_105849993 | 3300017966 | Tropical Peatland | MWFMPSVPASADPGWDEDPAWLDRDPMTAEERAAWLD |
| Ga0187781_105140811 | 3300017972 | Tropical Peatland | MPSVPAPADPGWDEDPAWLDRDPVSPEDREAWLDR |
| Ga0187777_112323172 | 3300017974 | Tropical Peatland | MPPDPVPAVPGWDDHPAWSRPDPMTAEELEASLDRLCELDEPPGEEE |
| Ga0066667_102743442 | 3300018433 | Grasslands Soil | MPASPVPADPGWDEDLTWLDRDPMTAAERQASLDRLCELDEGYREE |
| Ga0066662_120082561 | 3300018468 | Grasslands Soil | MPPSPVPADPGWDEDLAWLDRDPMTAAEREELLDRICEQDGPP |
| Ga0173482_106184202 | 3300019361 | Soil | MPSVPAPADPGQDDDPAWLDRDPMTAAEREAWLDRLC |
| Ga0210399_103181091 | 3300020581 | Soil | MLPSPVPADPGWDEDLTWLDRDPMTAAEFEASLDRLCERDE |
| Ga0210399_106388681 | 3300020581 | Soil | MPPEPVPAGLGWDEDLAWLDRDPMTAAEFEASLDRLCERDEGPGEDEDHEY |
| Ga0210395_104039951 | 3300020582 | Soil | MPPSPVPADPGWDEDLAWLDRDPMTAAEFEASLDRLCERDEGPGEDEDHE |
| Ga0210404_101713641 | 3300021088 | Soil | MLPSPVPADPGWDEDLAWLDRDPVTAAEFEASLDRLC |
| Ga0210404_106386551 | 3300021088 | Soil | MPPSPVPADPGWDEDLAWLDRDPVTAAEFEASLDRLCERDEGPGEDEDY |
| Ga0210400_106834742 | 3300021170 | Soil | MPPESVSVDPGWDEDLAWLDRDPVTAAEFEASLDRLCERDEG |
| Ga0210408_100814154 | 3300021178 | Soil | MPPSPVPADPGWDEDLAWLDRDPMTAAEFEASLDRLCELD |
| Ga0210408_105921081 | 3300021178 | Soil | MPPEPVPAGPGWDEDLAWLDRDPMTAAEFEASLDRLCERDEGPGEDEDHEY |
| Ga0210408_108990101 | 3300021178 | Soil | MPSVPAPADPGWDEDPAWLDRDPMTAAEREAWLDRLCQQ |
| Ga0210397_100537941 | 3300021403 | Soil | MAASPAQEPSGWEEDPAWLDRDPMTAAEREAWLDRLCAQDDDPSHAPQEYWD |
| Ga0210397_111158621 | 3300021403 | Soil | MWLMPSVPAPADPGWGEDLAWLDRDPVSPAEREAWLDRLCQLDDDPCDAAEE |
| Ga0210389_105364341 | 3300021404 | Soil | MAAMPDSANPGWDDDLAWLDRDPATPEELEAALDRLCELDEPDPEYEEEY |
| Ga0210389_106175361 | 3300021404 | Soil | MLPSPVPADPGWDEDLTWLDRDPVTAAEFEASLDRLCELDEGPGEDEDDGNL |
| Ga0210387_116524382 | 3300021405 | Soil | MSSVPAPADPGWDGDPAWGDRDPVSPEKQRAWLDWLCEQDEDPRDDPQDDWDPES |
| Ga0210394_110984973 | 3300021420 | Soil | MPPEPVPAGPGWDEDLAWLDRDPMTAAEFEASLDRLCERDEGPGEDEDHEYFEP |
| Ga0210384_102290713 | 3300021432 | Soil | MPPEPVPAGPGWDEDLAWLDRDPMTAAEFEASLDRLC |
| Ga0210384_103336602 | 3300021432 | Soil | MLPSPVPADPGWDEDLAWLDRDPVTAAEFEASLDRLCERDEGPG |
| Ga0210384_105466581 | 3300021432 | Soil | MPSVPAPADPGWDEDPAWLDRDPMTAAEREAWLDRLC |
| Ga0210384_109064601 | 3300021432 | Soil | MLPSPVPADPGWDEDLTWLDRDPVTAAEFEASLDRLCER |
| Ga0210402_103262891 | 3300021478 | Soil | MLPSPVPAGPGWDEDLAWLDRDPMTAQEREELLDRICEQDG |
| Ga0210402_106530931 | 3300021478 | Soil | MSSVPAPADPGRGGDPAWGDRDPVSPQKQRAWLDWLCAQED |
| Ga0210402_106751461 | 3300021478 | Soil | MPPEPVPAGPGWDEDLAWLDRDPMTAAEFEASLDRLCERDE |
| Ga0210402_115223701 | 3300021478 | Soil | MPASSVPADPGPDEDLAWLDRDPMTAEELEAGLDWVCEH |
| Ga0210402_115521201 | 3300021478 | Soil | MRPSPVSADPGWDEDLAWLDRDPMTAQEREELLDRICEQDGP |
| Ga0210402_117464711 | 3300021478 | Soil | MLPSPVPADPGWDEDLAWLDRDPVTAAEFEASLDRLCARDEGA |
| Ga0126371_110106101 | 3300021560 | Tropical Forest Soil | MSSESVPADPGRGEDPAWPDRDPMTAAEREAWLDRLCAQDD |
| Ga0126371_112174132 | 3300021560 | Tropical Forest Soil | MPSVPAPADPGWDEDPAGPDRDPMTAGEREAWLDRLCEQDDDPFDDPQEYWDPG |
| Ga0126371_113228641 | 3300021560 | Tropical Forest Soil | MPSVPAPADPGRDDDPARPGRDPVRPGDREAWLDRLCELDDDPFDDPQEY |
| Ga0126371_130542781 | 3300021560 | Tropical Forest Soil | MSSEPVPADPGWDDGPAWPDRDPMSAADREAWLDHLAASDDPPEDEEEDER |
| Ga0247693_10229961 | 3300024181 | Soil | MPASPAPADPGRDDDLAWPDRDPMTAAEREASLDRLCE |
| Ga0247693_10400122 | 3300024181 | Soil | MPASPAPADPGWDDDLAWLDRDPMTAAEREASLDRLCEQD |
| Ga0247691_10633112 | 3300024222 | Soil | MPSVPAPADPGRDEDPAWLDRDPMTAAEREAWLDRLCAQDDDPA |
| Ga0179589_100850492 | 3300024288 | Vadose Zone Soil | MLSSPVPADPGWDEDLTWLDRDPMTAAEFEASLNRLCELDEGPGEDQA |
| Ga0179589_102529271 | 3300024288 | Vadose Zone Soil | MLPSPVPADPGWDEDLAWLDRDPVTAAEFEASLDRLCERDEGYCEDADED |
| Ga0247681_10757041 | 3300024310 | Soil | MPASPAPADPGWDDDLAWLDRDPMTAEEREASLDRLCEQDEGYREEEYG |
| Ga0247666_10600421 | 3300024323 | Soil | MPASPAPADPGRDDDLAWLDRDPMTAAERGASLDRLCEQDE |
| Ga0207692_104124471 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MPPEPVSADPGWDEDLAWLDRDPMTAAEFEASLDRLCERDEGPGEDEDENY |
| Ga0207692_109709302 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MWSMPSVPAPADPGRDEDPAWLDRDPMTAGEREAWLDRLCAQDDDPSDE |
| Ga0207692_110070831 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MPASPAPADPGRDDDLAWLDRDPMTTAEREASLDRLCEQDEGYRED |
| Ga0207699_109604562 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MFPSPVPADPGWDEDLAWLDRDPMTAQEREELLDRICEQDGPPEP |
| Ga0207693_110164701 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MSASPAPADPGRDDDLAWLDRDPMTAAEREASLDRLCEQDEG |
| Ga0207663_100648812 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MPPEPVPADPGWDEDLAWLDRDPMTPAEREAWLDWVCE |
| Ga0207663_109502802 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MPSVPAPADPGWDEDPAWLDRDPMSAAEREAWLDRLCQADDDPCDE |
| Ga0207660_100391975 | 3300025917 | Corn Rhizosphere | MPASPAPADPGRDDDLAWLDRDPMTAAEREASLDRLCEQDEGHREDEADRY |
| Ga0207649_106380361 | 3300025920 | Corn Rhizosphere | MPSVPGPADPGRDGDPAWLDRDPMTAAEREAWLDRLCQLDDDPSDAP |
| Ga0207694_106488901 | 3300025924 | Corn Rhizosphere | MPSVPAPADPGRDDDPAWLDRDPMTAGEREAWLDRLCAQDDDPSDGPQEYWD |
| Ga0207694_106777001 | 3300025924 | Corn Rhizosphere | MPASPAPADPGRDDDLAWLDRDPMTAAEREASLDRLCE |
| Ga0207700_114864641 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MPSVPAPADPGRDGDPAWLDRDPMTAAEREAWLDRLCQLDDDPSD |
| Ga0207664_102995141 | 3300025929 | Agricultural Soil | MPSVPAPADPGRDEDPAWLDRDPMTAGEREAWLDRLCAQDDDP |
| Ga0207664_107354042 | 3300025929 | Agricultural Soil | MAAPSVPADPGWGEDPAWLDRDPMSAAEREAWLDRLCQADDDP |
| Ga0207664_110178001 | 3300025929 | Agricultural Soil | MWFMPSVPAPADPGWDGDPAWLDRDPMTAAEREAWLDRLCAQDDDPAD |
| Ga0207664_116066082 | 3300025929 | Agricultural Soil | MPPESVSVDPGWDEDLAWLDRDPVTAAEFEASLDRLCERDE |
| Ga0207644_108788161 | 3300025931 | Switchgrass Rhizosphere | MPASPAPADPGRDDDLAWLDRDPMTAAEREASLDRLCEQDEGYLQDE |
| Ga0207690_106363952 | 3300025932 | Corn Rhizosphere | MPASPAPADPGRDDDLAWLDRDPMTAAEREASLDRLCEQDE |
| Ga0207709_116781112 | 3300025935 | Miscanthus Rhizosphere | MPPESVSADLGWDEDLAWLDRDPMTAEEFEASLDRLCELDEGPGEDEDENYLAPLT |
| Ga0207665_101480453 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MSASPAPADPGRDDDLAWLDRDPMTAAEREASLDRLCEQDEGHRE |
| Ga0207665_109660722 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MPSVPAPADPGWGEDLAWLDRDPMSAAEREAWLDRLCQ |
| Ga0207665_109999462 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MSAEPVPDDSGREDDLAWLDQDPMTAADREAWLDHLCQLGDPPEEDDDEQ |
| Ga0207661_109131231 | 3300025944 | Corn Rhizosphere | MPSVPAPADPGRDDDPAWLDRDPMTAAEREAWLDRLCAQDDDPAD |
| Ga0207679_103347761 | 3300025945 | Corn Rhizosphere | MPSVPAPADPGRDDDPAWLDRDPMTAAEREAWLDRLCQ |
| Ga0207679_116030841 | 3300025945 | Corn Rhizosphere | MPASPAPADPGRDDDLAWLDRDPMTAAEREASLDRLCEQDEGH |
| Ga0207667_105190073 | 3300025949 | Corn Rhizosphere | MPSVPAPADPGRDEDPAWPDRDPMTAAEREAWLDRLCAQDDDPADA |
| Ga0207667_117614692 | 3300025949 | Corn Rhizosphere | MSASPGPADPGRDDDLAWLDRDPMTAAEREASLDRLCEQDEGHLEDEDEYG |
| Ga0207708_102113963 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MPSVPAPADPGRDEDPAWLDRDPMTAAEREAWLDRLC |
| Ga0207641_118721381 | 3300026088 | Switchgrass Rhizosphere | MPSVPGPADPGRDGDPAWLDRDPMTAAEREAWLDRLCAQDDDPAD |
| Ga0207674_108877091 | 3300026116 | Corn Rhizosphere | MPSVPAPADPGRDDDPAWLDRDPMTAAEREAWLDRLCAQDDDP |
| Ga0207675_1015982332 | 3300026118 | Switchgrass Rhizosphere | MPSVPAPADPGRDDDPAWLDRDPMTAAEREAWLDRLCAQDDDPADGP |
| Ga0207683_101756021 | 3300026121 | Miscanthus Rhizosphere | MSASPASADPGRDDDLAWLDRDPMTAAEREASLDRLCEQD |
| Ga0207698_113169181 | 3300026142 | Corn Rhizosphere | MWSMPSVPAPADPGRDEDPAWPDRDPMTAAEREAWLDRLC |
| Ga0207698_126616571 | 3300026142 | Corn Rhizosphere | MSASPASADPGRDDDLAWLDRDPMTAAEREASLDRLCEQDEGHLQE |
| Ga0209577_103043232 | 3300026552 | Soil | MPPELVPADPGWDEDLTWLDRDPMTAAERQASLDRLCELGEGYREE |
| Ga0209326_10032661 | 3300026899 | Forest Soil | MPASPAPADPGWDDDLAWLDRDPMTAAEREASLDRLCE |
| Ga0208575_10273452 | 3300026920 | Soil | MPASPVPADPGRDDDLAWLDRDPMTAAEREEWLDR |
| Ga0209524_10200161 | 3300027521 | Forest Soil | MPPSPAPADPGWDEDPAWLDRDPMTPAEREAWLDRLCQLDDD |
| Ga0209177_102627202 | 3300027775 | Agricultural Soil | MAALPNSADPGWDDDLAWLDRDPVTPEELDAALDRLCELDEPD |
| Ga0209488_104584991 | 3300027903 | Vadose Zone Soil | MPPEPVPAGPGWDEDLTWLDRDPMTAAEREAWLDRLCQLDDDPADAPQ |
| Ga0209488_105762481 | 3300027903 | Vadose Zone Soil | MPSVPAPADPGWGEDPAWPDRDPMTAAEREARLDRLCEQDDDPFDAP |
| Ga0209526_105396053 | 3300028047 | Forest Soil | MPPEPVPADPGWDEDLAWLDRDPMTAAEREAWLDRLCQL |
| Ga0209526_105767392 | 3300028047 | Forest Soil | MPPEPVPVEPWWGEDLAWLDRDPMTAAEFEASLDRLCERDEGPGEDEDYEYFE |
| Ga0209526_107384882 | 3300028047 | Forest Soil | MPPSPAPADPGWDEDPAWLDRDPMTPAEREAWLDRLC |
| Ga0247675_10167921 | 3300028072 | Soil | MPASPAPADPGRDDDLAWLDRDPMTTAEREASLDRLCEQDE |
| Ga0268266_108961281 | 3300028379 | Switchgrass Rhizosphere | MPSVPAPADPGRDDDPAWLDRDPMTAAEREAWLDRLCAQDDDPVN |
| Ga0268266_112855242 | 3300028379 | Switchgrass Rhizosphere | MPASPAPADPGRDDDLAWLDRDPMTAAEREASLDRLCEQDEG |
| Ga0268266_123506362 | 3300028379 | Switchgrass Rhizosphere | MSASPGPADPGRDDDLAWLDRDPMTAAEREASLDR |
| Ga0268265_107913571 | 3300028380 | Switchgrass Rhizosphere | MWSMPSVPAPADPGRDEDPAWLDRDPMTAAEREAWLDRLCAQDDDPADAPQ |
| Ga0268264_109535752 | 3300028381 | Switchgrass Rhizosphere | MPASPAPADPGRDDDLAWLDRDPMTAAEREASLDRLCEQDEGY |
| Ga0137415_107649152 | 3300028536 | Vadose Zone Soil | MPPSPVPADPGRDEDLAWLDRDPVTAAEFEASLDRLCELDEGPGEDEDEDY |
| Ga0307284_103235151 | 3300028799 | Soil | MWSMPSVPAPADPGRDEDPAWLDRDPMTAAEREAW |
| Ga0307305_103370371 | 3300028807 | Soil | MPSVPASADPGREEDPAWLDRDPMTAAEREAWLDRLCAQDDD |
| Ga0307308_103756372 | 3300028884 | Soil | MPSVPAPADPGRDEDPAWLDRDPMTAAEREAWLDRLCAQDDDPFDDPQEY |
| Ga0318516_103848652 | 3300031543 | Soil | MPAEPVPADPGRDDDLAWLDRDPMTAGEREAWLDWACEHDE |
| Ga0318534_102851252 | 3300031544 | Soil | MSSVPAPADPGWDEDPARLDRDPAGPEDQEAWLDRLCERDDDPFYDP |
| Ga0318534_107915261 | 3300031544 | Soil | MPSVPAPADPGWDEDPAWLDRDPVSPEDQEAWLDRLCELDDDPFY |
| Ga0318541_108120312 | 3300031545 | Soil | MPAEPVPADPGREDDLAWLDRDPVTAAEREEWLDRVCEQDEPPEP |
| Ga0318538_107876661 | 3300031546 | Soil | MWFMPSEPAPADPGRDDDPARPDRDPVSPADREAWLDRLCEQDDDPFDD |
| Ga0318573_101882061 | 3300031564 | Soil | MSSVPAAADPGWDDDPAWSRPDPVTAEEREAWLDRLCAQD |
| Ga0318573_103265481 | 3300031564 | Soil | MPAEPVPADPGPEDDLAWLDRDPATPAERTEWLDRV |
| Ga0318573_103721701 | 3300031564 | Soil | MPPESVPADPGRDDDLAWLDRDPMTAGEREASLDRLCQQDEPPGDDEEY |
| Ga0310915_108065782 | 3300031573 | Soil | MPSEPAPADRGRDEDPARPDRDPMTAADRQAWLDRLCEQDDDPFDDPPEY |
| Ga0318574_105171513 | 3300031680 | Soil | MSSVPAAADPGWDDDPAWSRPDPVTAEEREAWLDRLCAQDDDPADAPQ |
| Ga0318574_108566521 | 3300031680 | Soil | MWFMPSVPVPADPGWDEDPARPDRDPMTAGDREAWLDRLCALDDDPFDDPQE |
| Ga0318574_108567832 | 3300031680 | Soil | MWFMPSVPAPADPGWDEDPAGPDRDPMTAGEREAWLDRLCARDDDPFDDPQEYW |
| Ga0318572_100229101 | 3300031681 | Soil | MPAEPVPADPGREDDLAWLDRDPMTAAEREEWLDRICDQDD |
| Ga0318572_103533021 | 3300031681 | Soil | MPQQPDPADPGRDEDLAWLDRDPMTAEEREAWLDWACEHDVPPG |
| Ga0318572_104153322 | 3300031681 | Soil | MPSEPAPADPGRDDDPARPDRDPVSPADREAWLDRLCEQDDDPFDDPQEYWD |
| Ga0318560_103366552 | 3300031682 | Soil | MPQQPVPADPGPGEDLAWLDRDPMTAPEREALLDRICEEGE |
| Ga0318496_101834591 | 3300031713 | Soil | MPPEPAPADPGWDDDPAWSRPDPMTAEELEASLDRLCELDEPPQEE |
| Ga0318496_102468611 | 3300031713 | Soil | MPSEPVPADPGRDEDPAGLDRDPMSPAEREAWLDRLCQLDDDPSDQ |
| Ga0318496_102969291 | 3300031713 | Soil | MPPEPVPADPGWDDDPAWSRPDPMTAEELEASLDRLCELDEPPE |
| Ga0318496_105416041 | 3300031713 | Soil | MWFMPSVPAPADPGWDEDPAGPDRDPMTAGEREAWLDRLCALDDDPFDDPQEY |
| Ga0306917_115942361 | 3300031719 | Soil | MPSVPAPADPGWDEDPAWLDRDPVSPGKQEAWLDWLCEQDD |
| Ga0318493_103355851 | 3300031723 | Soil | MPSEPAPADPGRDDDPARPDRDPVSPADREAWLDRLCEQDDDPFDDPQEY |
| Ga0318500_105526621 | 3300031724 | Soil | MPSVPAPADPGWDEDPAWLGRDPMTAEEREAWLDRLCEQDD |
| Ga0318492_104111331 | 3300031748 | Soil | MSSVPASADPGRDEDPAWLDRDPMTAAEREAWLDRLCAQDDD |
| Ga0318494_100729466 | 3300031751 | Soil | MPSVPAPADPGWDEDPAWLDRDPMTAAEREAWLDRLCAQDDDPFDQPEEYWD |
| Ga0318494_101257133 | 3300031751 | Soil | MPSEPAPADRGRDEDPARPDRDPMTAADRQAWLDRLCEQDDDPFDDPPEYW |
| Ga0318494_107715061 | 3300031751 | Soil | MSSVPAPADPGWDEDPARPGRDPASPEEQEAWMDRLCERDDD |
| Ga0318494_108214961 | 3300031751 | Soil | MWFMPSVPAPADPGWDEDPAGPDRDPMTAGEREAWLDRLCALDDDPFDDPQE |
| Ga0318535_102966972 | 3300031764 | Soil | MPPESVPADPGRDDDLAWLDRDPMTAGEREASLDRLCQQDEPPGDDEEYEDFA |
| Ga0318554_102311551 | 3300031765 | Soil | MPSVPAPADPGWDEDPAWLDRDPMTAAEREAWLDRLCAQDD |
| Ga0318526_101390613 | 3300031769 | Soil | MPSVPAPADPGWDEDPARPDRDPMTAGEREAWLDRLCERDDDPFDDPQ |
| Ga0318521_107391751 | 3300031770 | Soil | MLQQPVPADPGPGEDLAWLDRDPMTAQEREALLDRI |
| Ga0318521_108331991 | 3300031770 | Soil | MPSEPVPADPGRDDDLAWLDRDPMTAEEREASLERLCEQDGPSGGYGTW |
| Ga0318546_101830241 | 3300031771 | Soil | MPSVPAPEDPGWDEDPDRPDRDPESPEEQQAWLDWVCERDGDPFYGPQEY |
| Ga0318546_107556281 | 3300031771 | Soil | MPAEPVPADPGRDDDLAWLDRDPMTAGEREAWLDWACEHDEPPGELLRS |
| Ga0318498_100397991 | 3300031778 | Soil | MPSEPAPADRGRDEDPARPDRDPMTAADRQAWLDRLCEQDDDPFDDPP |
| Ga0318498_101305074 | 3300031778 | Soil | MPSVPAPADPGWDEDPAWLDRDPMTAEEREAWLDRLCEQDDD |
| Ga0318566_103827182 | 3300031779 | Soil | MPQQPVPADPGPGEDLAWLDRDPMTAPEREALLDRIC |
| Ga0318566_104373361 | 3300031779 | Soil | MWFMPSEPAPADPGRDDDPARPDRDPVSPADREAWL |
| Ga0318547_105148271 | 3300031781 | Soil | MSSVPAHGDPGRDEDPAWLDRDPMTAAEREAWLDRLCAQDDDPRDDPQESW |
| Ga0318557_101569202 | 3300031795 | Soil | MPAEPVPADPGPEDDLAWLDRDPATSAERTEWLDRVAK |
| Ga0318523_102962271 | 3300031798 | Soil | MPPESVPADPGRDDDLAWLDRDPMTAGEREASLDRLCQQDE |
| Ga0318523_104111591 | 3300031798 | Soil | MWFMSSVPAPADPGWDEDPARLDRDPAGPEDQEAWLVAGELVH |
| Ga0318497_101404802 | 3300031805 | Soil | MPPEPVPADPGWDDDPAWSRPDPMTAEELEASLDRLCELDESPDEEDWE |
| Ga0318497_104376141 | 3300031805 | Soil | MPSMPAPADPGWDEDPAWLDRDPVSPEDQEAWLDRLCELDDDPFYDPQ |
| Ga0318567_103454931 | 3300031821 | Soil | MPPESVPADPGRDDDLAWLDRDPMTAGEREASLDRLCQQDEPPGDDEEYED |
| Ga0318567_104745401 | 3300031821 | Soil | MPSVPAPADPGWDEDPAWLDRDPMTAAEREAWLDRLCAQDDDPFDQPEEYW |
| Ga0318499_102859241 | 3300031832 | Soil | MPSESVPGDPGRDDDLAWLDRDPMTAEEREASLDRLCEQDEPPGEDGEY |
| Ga0318511_102617441 | 3300031845 | Soil | MPAEPVPADPGRDDDLAWLDRDPMTAGEREAWLDWACEHDEPPGEEED |
| Ga0318512_100013006 | 3300031846 | Soil | MPPESVPADPGCDDDPAWPDRDPMSPEDREAWLDWL |
| Ga0318512_104936621 | 3300031846 | Soil | MPAKPVPADPGPEDDLAWLDRDPMTAAERAAWLDRVCEQDEPPE |
| Ga0318512_106678572 | 3300031846 | Soil | MSSVPVPAGPGWGEDLAWLDRDPVAPADREAWLDHLCELDDPFD |
| Ga0318527_104417441 | 3300031859 | Soil | MWFMPSVPTHADAGWDEDPAWLDRDPVAAEEREAWLDRL |
| Ga0318495_101286953 | 3300031860 | Soil | MPSEPAPADPGRDDDPARPDRDPVSPADREAWLDR |
| Ga0306925_119196022 | 3300031890 | Soil | MPAEPVPADPGRDDDLAWLDRDPMTAGEREAWLDWACEHDEPPGE |
| Ga0318536_106730022 | 3300031893 | Soil | MPSVPAPEDPGWDEDPDRPDRDPESPEEQQAWLDW |
| Ga0306923_111681062 | 3300031910 | Soil | MPQQPDPADPGRDEDLAWLDRDPMTAEEREASLDRLCEEDAPPGE |
| Ga0306921_102247401 | 3300031912 | Soil | MPSVPAPADPGWDEDPARPDRDPMTAGEREAWLDRLCERDDDPFD |
| Ga0306921_120144991 | 3300031912 | Soil | MPSESVPGDPGRDDDLAWLDRDPMTAEEREASLERLCEQDGPSGGYGTWRLRTPG |
| Ga0310912_107835432 | 3300031941 | Soil | MPSEPAPADPGRDEDPARPDRDPMTAADREAWLDRLCEQDDDPFDDPPEYW |
| Ga0310916_111228992 | 3300031942 | Soil | MPSVPAPADPGWDEDPARPDRDPMTAGEREAWLDRLCERDDDPFDDPQEY |
| Ga0310916_114501742 | 3300031942 | Soil | MPAEPVPADPGRDDDLAWLDRDPMTAGEREAWLDWA |
| Ga0310909_101093853 | 3300031947 | Soil | MPAKPVPADPGPEDDLAWLDRDPMTAAERAAWLDR |
| Ga0306922_108174842 | 3300032001 | Soil | MPSEPAPADRGRDEDPARPDRDPMTAADREAWLDR |
| Ga0306922_122870851 | 3300032001 | Soil | MPQQPVPADPWPGEDLAWLDRDPMTAQEREALLDRICEE |
| Ga0318562_105632192 | 3300032008 | Soil | MPQQPDPADPGRDDDLAWLDRDPMTAAEREAYLDR |
| Ga0318562_108250781 | 3300032008 | Soil | MPSVPAPADPGWDEDPAWPDRDPMTAAEREAWLDWLCEQDDDPSDAPQEY |
| Ga0318559_102685632 | 3300032039 | Soil | MSSVPVHGDPGRDEDPAWLDRDPMTAAEREAWLDRLCAQD |
| Ga0318558_105426841 | 3300032044 | Soil | MPSVPAPADPGWDGDPAWPDRDPMTAAEREAWLDRL |
| Ga0318514_100441511 | 3300032066 | Soil | MPAEPVPADPGPEDDLAWLDRDPATSAERTEWLDRVA |
| Ga0318514_101582361 | 3300032066 | Soil | MPSVPAPADPGWDEDPARPDRDPMTAGEREAWLDRLCERDDDPFDDPQEYWD |
| Ga0318524_100796681 | 3300032067 | Soil | MPQQPVPADPGPGEDLAWLDRDPMTAPEREALLDRICEE |
| Ga0318524_102648691 | 3300032067 | Soil | MPAEPVPADPGPEDDLAWLDRDPMTAAERAAWLDRVCEQDEPPEE |
| Ga0318553_104624781 | 3300032068 | Soil | MPQQPVPADPGPGEDLAWLDRDPMTAQEREALLDRICEEDEPP |
| Ga0306924_105673073 | 3300032076 | Soil | MPSVPAPADPGWDEDPAWLDRDPMTAEEREAWLDRLCEQDDDPF |
| Ga0318525_102830132 | 3300032089 | Soil | MPSEPAPADPGRDEDPARPDRDPMTAADRQAWLDRLCEQDDD |
| Ga0318525_103820623 | 3300032089 | Soil | MPSVPAPAGPGRDEDPARPGRDPDSPEDQEAWLDRLCERDDDPFY |
| Ga0318518_106610561 | 3300032090 | Soil | MSSVPAPADPGWDEDPARLDRDPAGPEDQEAWLDRLCERDDDPFYDPQEY |
| Ga0318577_101628662 | 3300032091 | Soil | MPSEPAPADRGRDEDPARPDRDPMTAADRQAWLDRLCEQDDD |
| Ga0307470_102512942 | 3300032174 | Hardwood Forest Soil | MAAPSVPADPGWGEDPAWLDRDPMSAAEREAWLDRLCALDDDPS |
| Ga0307471_1007146621 | 3300032180 | Hardwood Forest Soil | MPPSPVPADPGWDEDLAWLDRDPMTAAEREELLDR |
| Ga0306920_1004117501 | 3300032261 | Soil | MPSVPAPADPGRDEDPAWLGRDPMTAEEREAWLDRLCEQDDDPFDAPQEYWDP |
| Ga0335085_100738056 | 3300032770 | Soil | MPSVPAPADPGRDGDPAWLDRDPMTAAEREAWLDRLCAQDDDPADAPLEYRDPEA |
| Ga0335085_103431761 | 3300032770 | Soil | MPPEPVPADPGWDDDPAWTRPDPMTAEEFEASLDRLCELD |
| Ga0335079_100227931 | 3300032783 | Soil | MPSVPAGADPGRDEDPAWPDRDPMTAAEREAWLERL |
| Ga0335079_108892252 | 3300032783 | Soil | MPPEPVPANPGRDDDLAWLDRDPMTAEDREAWLDWLCAQDDDP |
| Ga0335079_115320631 | 3300032783 | Soil | MPSVPASADPGWDDDPAWLDRDPMTAAEREAWLDRLCAQ |
| Ga0335078_109298392 | 3300032805 | Soil | MPSVPASADPGWDDDPAWLDRDPMTAAEREAWLDRLCAQDDDPFDAAE |
| Ga0335078_120532991 | 3300032805 | Soil | MPQQPDPADPGRDEDLARLDRDPMTAEEVEASLDRLCELDEPPEDEECADVE |
| Ga0335080_100703967 | 3300032828 | Soil | MSSVPAHGDPGRDEDPAWLDRDPMTAAEREAWLDRLCAQDDDPRD |
| Ga0335070_102229321 | 3300032829 | Soil | MSSVPAHGDPGRDEDPAWLDRDPMTAAEREAWLDRLCAQ |
| Ga0335070_118317081 | 3300032829 | Soil | MPPEPVPADPGRDDDLAWLDRDPMTAEEREASLDRICE |
| Ga0335081_118406911 | 3300032892 | Soil | MPSVPAPAHPGRDGDPARLDGDPVSPGGRDAWLDR |
| Ga0335081_120423021 | 3300032892 | Soil | MWLMPSVPAPADPGWDEDPARPGRDPAGPEEQEAWLDRV |
| Ga0335081_125865311 | 3300032892 | Soil | MPSVPAPADPGWDQDPARVDGGPVTAAEQEAWLDRLCERDGDPFYA |
| Ga0335083_100468691 | 3300032954 | Soil | MPSVPAPADPGRDGDPAWPDRDPMTAAEREAWLDRLCAQDDD |
| Ga0335083_109804181 | 3300032954 | Soil | MPSMPAHGDPGRDEDPAWLDRDPMTAAEREAWLDRLCAQDDDP |
| Ga0335083_112660141 | 3300032954 | Soil | MWLMPSVPAPADPGRDDDPARPDRDPVRPGDREAWL |
| Ga0335076_104637952 | 3300032955 | Soil | MSPVPAPADPGWGEDPAWPGRDPVRPGDREAWLDRLCAQ |
| Ga0335073_102773071 | 3300033134 | Soil | MASVPVPADPGWDEDPARVDGGPVTAVEQEAWLDRLCERDGDPFYA |
| Ga0335073_117941421 | 3300033134 | Soil | MASVPAPADPGWDEDPARVDGGPVTAVEQEAWLDRLCER |
| Ga0335077_107610431 | 3300033158 | Soil | MPSMPAHGDPGRDEDPAWLDRDPMTAAEREAWLDRLCAQDDDPRD |
| Ga0318519_105083991 | 3300033290 | Soil | MSSVPASADPGRDEDPAWLDRDPMTAAEREAWLDRLCAQ |
| ⦗Top⦘ |