


| Basic Information | |
|---|---|
| Family ID | F007710 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 346 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MTTRSRLRVFHFADYESTTISKKTLCQLQDREAQERGARDLQKPAP |
| Number of Associated Samples | 244 |
| Number of Associated Scaffolds | 346 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 54.91 % |
| % of genes from short scaffolds (< 2000 bps) | 69.65 % |
| Associated GOLD sequencing projects | 222 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.35 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (94.509 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (20.809 % of family members) |
| Environment Ontology (ENVO) | Unclassified (35.549 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (52.890 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 51.35% β-sheet: 0.00% Coil/Unstructured: 48.65% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.35 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 346 Family Scaffolds |
|---|---|---|
| PF00416 | Ribosomal_S13 | 42.20 |
| PF01176 | eIF-1a | 16.18 |
| PF00557 | Peptidase_M24 | 13.58 |
| PF00411 | Ribosomal_S11 | 8.67 |
| PF01479 | S4 | 4.05 |
| PF00406 | ADK | 2.89 |
| PF00344 | SecY | 2.60 |
| PF00163 | Ribosomal_S4 | 2.02 |
| PF04020 | Phage_holin_4_2 | 1.16 |
| PF00828 | Ribosomal_L27A | 1.16 |
| PF11154 | DUF2934 | 0.58 |
| PF00861 | Ribosomal_L18p | 0.29 |
| PF00673 | Ribosomal_L5_C | 0.29 |
| PF04055 | Radical_SAM | 0.29 |
| PF08281 | Sigma70_r4_2 | 0.29 |
| PF02621 | VitK2_biosynth | 0.29 |
| PF00410 | Ribosomal_S8 | 0.29 |
| PF07650 | KH_2 | 0.29 |
| PF03719 | Ribosomal_S5_C | 0.29 |
| PF00238 | Ribosomal_L14 | 0.29 |
| PF00436 | SSB | 0.29 |
| PF13508 | Acetyltransf_7 | 0.29 |
| PF02617 | ClpS | 0.29 |
| PF10042 | DUF2278 | 0.29 |
| PF07366 | SnoaL | 0.29 |
| PF04613 | LpxD | 0.29 |
| COG ID | Name | Functional Category | % Frequency in 346 Family Scaffolds |
|---|---|---|---|
| COG0099 | Ribosomal protein S13 | Translation, ribosomal structure and biogenesis [J] | 42.20 |
| COG0361 | Translation initiation factor IF-1 | Translation, ribosomal structure and biogenesis [J] | 16.18 |
| COG0100 | Ribosomal protein S11 | Translation, ribosomal structure and biogenesis [J] | 8.67 |
| COG0563 | Adenylate kinase or related kinase | Nucleotide transport and metabolism [F] | 2.89 |
| COG0201 | Preprotein translocase subunit SecY | Intracellular trafficking, secretion, and vesicular transport [U] | 2.60 |
| COG0522 | Ribosomal protein S4 or related protein | Translation, ribosomal structure and biogenesis [J] | 2.02 |
| COG1727 | Ribosomal protein L18E | Translation, ribosomal structure and biogenesis [J] | 1.16 |
| COG1950 | Uncharacterized membrane protein YvlD, DUF360 family | Function unknown [S] | 1.16 |
| COG0093 | Ribosomal protein L14 | Translation, ribosomal structure and biogenesis [J] | 0.29 |
| COG0094 | Ribosomal protein L5 | Translation, ribosomal structure and biogenesis [J] | 0.29 |
| COG0096 | Ribosomal protein S8 | Translation, ribosomal structure and biogenesis [J] | 0.29 |
| COG0098 | Ribosomal protein S5 | Translation, ribosomal structure and biogenesis [J] | 0.29 |
| COG0256 | Ribosomal protein L18 | Translation, ribosomal structure and biogenesis [J] | 0.29 |
| COG0629 | Single-stranded DNA-binding protein | Replication, recombination and repair [L] | 0.29 |
| COG1044 | UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase | Cell wall/membrane/envelope biogenesis [M] | 0.29 |
| COG1427 | Chorismate dehydratase (menaquinone biosynthesis, futalosine pathway) | Coenzyme transport and metabolism [H] | 0.29 |
| COG2127 | ATP-dependent Clp protease adapter protein ClpS | Posttranslational modification, protein turnover, chaperones [O] | 0.29 |
| COG2965 | Primosomal replication protein N | Replication, recombination and repair [L] | 0.29 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 94.80 % |
| Unclassified | root | N/A | 5.20 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2166559005|cont_contig89228 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 2170459002|FZY7DQ102HEXMH | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → Chthoniobacter flavus | 500 | Open in IMG/M |
| 2170459003|FZ032L002GDGW3 | Not Available | 516 | Open in IMG/M |
| 2170459005|F1BAP7Q02G6QEQ | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → Chthoniobacter flavus | 526 | Open in IMG/M |
| 2170459005|F1BAP7Q02JTGWC | Not Available | 509 | Open in IMG/M |
| 2170459006|GBPF9FW02JAY7P | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → unclassified Candidatus Udaeobacter → Candidatus Udaeobacter sp. | 519 | Open in IMG/M |
| 2170459007|GJ61VE201B9IPM | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 524 | Open in IMG/M |
| 2170459009|GA8DASG02HCHV2 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 503 | Open in IMG/M |
| 2170459011|GI3SL7401ENKG8 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 503 | Open in IMG/M |
| 2170459015|G14TP7Y01C4WSB | Not Available | 675 | Open in IMG/M |
| 3300000043|ARcpr5yngRDRAFT_c011598 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
| 3300000559|F14TC_101466073 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300000579|AP72_2010_repI_A01DRAFT_1073925 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300000596|KanNP_Total_noBrdU_T14TCDRAFT_1001448 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → Chthoniobacter flavus | 2826 | Open in IMG/M |
| 3300000596|KanNP_Total_noBrdU_T14TCDRAFT_1006717 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → Chthoniobacter flavus | 1305 | Open in IMG/M |
| 3300000709|KanNP_Total_F14TBDRAFT_1022314 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → Chthoniobacter flavus | 527 | Open in IMG/M |
| 3300000893|AP72_2010_repI_A001DRAFT_1035669 | Not Available | 781 | Open in IMG/M |
| 3300000893|AP72_2010_repI_A001DRAFT_1042761 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
| 3300002899|JGIcombinedJ43975_10001486 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → Chthoniobacter flavus | 3605 | Open in IMG/M |
| 3300002917|JGI25616J43925_10150575 | All Organisms → cellular organisms → Bacteria | 930 | Open in IMG/M |
| 3300005166|Ga0066674_10025210 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 2599 | Open in IMG/M |
| 3300005166|Ga0066674_10040834 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 2073 | Open in IMG/M |
| 3300005166|Ga0066674_10218236 | All Organisms → cellular organisms → Bacteria | 907 | Open in IMG/M |
| 3300005171|Ga0066677_10421903 | All Organisms → cellular organisms → Bacteria | 763 | Open in IMG/M |
| 3300005172|Ga0066683_10093265 | All Organisms → cellular organisms → Bacteria | 1821 | Open in IMG/M |
| 3300005172|Ga0066683_10748659 | Not Available | 574 | Open in IMG/M |
| 3300005174|Ga0066680_10034054 | All Organisms → cellular organisms → Bacteria | 2901 | Open in IMG/M |
| 3300005175|Ga0066673_10009836 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 4046 | Open in IMG/M |
| 3300005175|Ga0066673_10035030 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 2441 | Open in IMG/M |
| 3300005175|Ga0066673_10265147 | All Organisms → cellular organisms → Bacteria | 997 | Open in IMG/M |
| 3300005176|Ga0066679_10000517 | All Organisms → cellular organisms → Bacteria | 13215 | Open in IMG/M |
| 3300005178|Ga0066688_10070153 | All Organisms → cellular organisms → Bacteria | 2079 | Open in IMG/M |
| 3300005178|Ga0066688_10398442 | All Organisms → cellular organisms → Bacteria | 892 | Open in IMG/M |
| 3300005179|Ga0066684_10005759 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 5586 | Open in IMG/M |
| 3300005179|Ga0066684_10023298 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 3259 | Open in IMG/M |
| 3300005179|Ga0066684_10110465 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1698 | Open in IMG/M |
| 3300005186|Ga0066676_10165383 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1401 | Open in IMG/M |
| 3300005186|Ga0066676_10221536 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1224 | Open in IMG/M |
| 3300005186|Ga0066676_10269051 | All Organisms → cellular organisms → Bacteria | 1118 | Open in IMG/M |
| 3300005186|Ga0066676_10587783 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 754 | Open in IMG/M |
| 3300005187|Ga0066675_10369182 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1053 | Open in IMG/M |
| 3300005290|Ga0065712_10004601 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 3170 | Open in IMG/M |
| 3300005295|Ga0065707_10721924 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300005328|Ga0070676_10812207 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
| 3300005332|Ga0066388_100063019 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 3950 | Open in IMG/M |
| 3300005332|Ga0066388_103007008 | All Organisms → cellular organisms → Bacteria | 862 | Open in IMG/M |
| 3300005434|Ga0070709_11017685 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| 3300005444|Ga0070694_100969658 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
| 3300005445|Ga0070708_101743372 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300005446|Ga0066686_10037606 | All Organisms → cellular organisms → Bacteria | 2879 | Open in IMG/M |
| 3300005446|Ga0066686_10119297 | All Organisms → cellular organisms → Bacteria | 1718 | Open in IMG/M |
| 3300005446|Ga0066686_10350079 | All Organisms → cellular organisms → Bacteria | 1008 | Open in IMG/M |
| 3300005446|Ga0066686_10666486 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
| 3300005447|Ga0066689_10058010 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 2102 | Open in IMG/M |
| 3300005450|Ga0066682_10061508 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 2299 | Open in IMG/M |
| 3300005451|Ga0066681_10043078 | All Organisms → cellular organisms → Bacteria | 2436 | Open in IMG/M |
| 3300005451|Ga0066681_10758341 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300005451|Ga0066681_10858882 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300005454|Ga0066687_10108790 | All Organisms → cellular organisms → Bacteria | 1411 | Open in IMG/M |
| 3300005454|Ga0066687_10256805 | All Organisms → cellular organisms → Bacteria | 977 | Open in IMG/M |
| 3300005467|Ga0070706_100192075 | All Organisms → cellular organisms → Bacteria | 1908 | Open in IMG/M |
| 3300005467|Ga0070706_100501421 | All Organisms → cellular organisms → Bacteria | 1129 | Open in IMG/M |
| 3300005468|Ga0070707_100130026 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 2448 | Open in IMG/M |
| 3300005471|Ga0070698_102166059 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300005529|Ga0070741_10005660 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 27517 | Open in IMG/M |
| 3300005536|Ga0070697_100050516 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 3375 | Open in IMG/M |
| 3300005540|Ga0066697_10246904 | All Organisms → cellular organisms → Bacteria | 1057 | Open in IMG/M |
| 3300005544|Ga0070686_100908298 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
| 3300005547|Ga0070693_101194930 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300005555|Ga0066692_10182041 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1306 | Open in IMG/M |
| 3300005556|Ga0066707_10886409 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300005566|Ga0066693_10338735 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300005574|Ga0066694_10020319 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 2920 | Open in IMG/M |
| 3300005576|Ga0066708_10188913 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1286 | Open in IMG/M |
| 3300005576|Ga0066708_10204762 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1239 | Open in IMG/M |
| 3300005576|Ga0066708_10350772 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 947 | Open in IMG/M |
| 3300005598|Ga0066706_10047901 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 2869 | Open in IMG/M |
| 3300005764|Ga0066903_100011918 | All Organisms → cellular organisms → Bacteria | 8471 | Open in IMG/M |
| 3300005764|Ga0066903_100181623 | All Organisms → cellular organisms → Bacteria | 3103 | Open in IMG/M |
| 3300005764|Ga0066903_100206818 | All Organisms → cellular organisms → Bacteria | 2948 | Open in IMG/M |
| 3300005764|Ga0066903_107188098 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300005937|Ga0081455_10000328 | All Organisms → cellular organisms → Bacteria | 62204 | Open in IMG/M |
| 3300005937|Ga0081455_10001399 | All Organisms → cellular organisms → Bacteria | 29813 | Open in IMG/M |
| 3300005983|Ga0081540_1000036 | All Organisms → cellular organisms → Bacteria | 140805 | Open in IMG/M |
| 3300006028|Ga0070717_10125539 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales | 2203 | Open in IMG/M |
| 3300006031|Ga0066651_10438714 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria | 694 | Open in IMG/M |
| 3300006034|Ga0066656_10205695 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria | 1254 | Open in IMG/M |
| 3300006046|Ga0066652_100302079 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales | 1423 | Open in IMG/M |
| 3300006046|Ga0066652_101524509 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300006173|Ga0070716_100659063 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Herbaspirillum → unclassified Herbaspirillum → Herbaspirillum sp. | 795 | Open in IMG/M |
| 3300006800|Ga0066660_10090706 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales | 2134 | Open in IMG/M |
| 3300006806|Ga0079220_11645258 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Herbaspirillum → unclassified Herbaspirillum → Herbaspirillum sp. | 559 | Open in IMG/M |
| 3300007788|Ga0099795_10400099 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300009012|Ga0066710_100007380 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria | 10489 | Open in IMG/M |
| 3300009012|Ga0066710_100590786 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria | 1683 | Open in IMG/M |
| 3300009012|Ga0066710_101881008 | All Organisms → cellular organisms → Bacteria | 897 | Open in IMG/M |
| 3300009012|Ga0066710_102926391 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300009038|Ga0099829_10532513 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → Verrucomicrobium | 976 | Open in IMG/M |
| 3300009088|Ga0099830_10032706 | All Organisms → cellular organisms → Bacteria | 3531 | Open in IMG/M |
| 3300009088|Ga0099830_11302193 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300009089|Ga0099828_10061340 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales | 3155 | Open in IMG/M |
| 3300009100|Ga0075418_11439609 | Not Available | 748 | Open in IMG/M |
| 3300009100|Ga0075418_12687784 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300009137|Ga0066709_100013290 | All Organisms → cellular organisms → Bacteria | 7751 | Open in IMG/M |
| 3300009137|Ga0066709_100032024 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → Verrucomicrobium | 5597 | Open in IMG/M |
| 3300009137|Ga0066709_100131580 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 3153 | Open in IMG/M |
| 3300009137|Ga0066709_100215814 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae | 2535 | Open in IMG/M |
| 3300009137|Ga0066709_101624189 | All Organisms → cellular organisms → Bacteria | 923 | Open in IMG/M |
| 3300009137|Ga0066709_102796467 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300009137|Ga0066709_102896434 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300009162|Ga0075423_10622872 | All Organisms → cellular organisms → Bacteria | 1138 | Open in IMG/M |
| 3300010046|Ga0126384_12465673 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300010047|Ga0126382_10006971 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → Verrucomicrobium | 5203 | Open in IMG/M |
| 3300010139|Ga0127464_1046111 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 723 | Open in IMG/M |
| 3300010154|Ga0127503_11131735 | All Organisms → cellular organisms → Bacteria | 2437 | Open in IMG/M |
| 3300010303|Ga0134082_10225392 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
| 3300010321|Ga0134067_10501911 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300010322|Ga0134084_10027715 | All Organisms → cellular organisms → Bacteria | 1567 | Open in IMG/M |
| 3300010323|Ga0134086_10064156 | All Organisms → cellular organisms → Bacteria | 1261 | Open in IMG/M |
| 3300010325|Ga0134064_10007747 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 2801 | Open in IMG/M |
| 3300010326|Ga0134065_10295034 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300010326|Ga0134065_10399970 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300010329|Ga0134111_10480832 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300010333|Ga0134080_10001176 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 8752 | Open in IMG/M |
| 3300010336|Ga0134071_10058903 | All Organisms → cellular organisms → Bacteria | 1759 | Open in IMG/M |
| 3300010358|Ga0126370_11568757 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
| 3300010358|Ga0126370_12609668 | Not Available | 505 | Open in IMG/M |
| 3300010361|Ga0126378_11528039 | Not Available | 757 | Open in IMG/M |
| 3300010362|Ga0126377_10796795 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1003 | Open in IMG/M |
| 3300010398|Ga0126383_13436124 | Not Available | 517 | Open in IMG/M |
| 3300011003|Ga0138514_100054619 | All Organisms → cellular organisms → Bacteria | 813 | Open in IMG/M |
| 3300012011|Ga0120152_1020554 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 2494 | Open in IMG/M |
| 3300012096|Ga0137389_10110136 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 2202 | Open in IMG/M |
| 3300012198|Ga0137364_10223989 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 1384 | Open in IMG/M |
| 3300012198|Ga0137364_10232505 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 1358 | Open in IMG/M |
| 3300012198|Ga0137364_10736577 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
| 3300012199|Ga0137383_10133716 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 1812 | Open in IMG/M |
| 3300012199|Ga0137383_10155469 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 1674 | Open in IMG/M |
| 3300012199|Ga0137383_10203920 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 1449 | Open in IMG/M |
| 3300012199|Ga0137383_10314507 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter | 1147 | Open in IMG/M |
| 3300012200|Ga0137382_10019576 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 3851 | Open in IMG/M |
| 3300012200|Ga0137382_10326464 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter | 1074 | Open in IMG/M |
| 3300012201|Ga0137365_10001009 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 21027 | Open in IMG/M |
| 3300012201|Ga0137365_10005052 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 10589 | Open in IMG/M |
| 3300012201|Ga0137365_10028917 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 4269 | Open in IMG/M |
| 3300012201|Ga0137365_10423952 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter | 981 | Open in IMG/M |
| 3300012202|Ga0137363_10195728 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 1619 | Open in IMG/M |
| 3300012202|Ga0137363_11310720 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300012203|Ga0137399_11054509 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
| 3300012204|Ga0137374_10077512 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 3239 | Open in IMG/M |
| 3300012205|Ga0137362_10184369 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 1794 | Open in IMG/M |
| 3300012205|Ga0137362_10239383 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 1566 | Open in IMG/M |
| 3300012206|Ga0137380_11112903 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter | 673 | Open in IMG/M |
| 3300012207|Ga0137381_10803685 | All Organisms → cellular organisms → Bacteria | 815 | Open in IMG/M |
| 3300012208|Ga0137376_10090995 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 2572 | Open in IMG/M |
| 3300012209|Ga0137379_10376955 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter | 1328 | Open in IMG/M |
| 3300012209|Ga0137379_10476515 | All Organisms → cellular organisms → Bacteria | 1156 | Open in IMG/M |
| 3300012210|Ga0137378_10000317 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 35238 | Open in IMG/M |
| 3300012210|Ga0137378_10158792 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 2097 | Open in IMG/M |
| 3300012211|Ga0137377_10000852 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 19971 | Open in IMG/M |
| 3300012285|Ga0137370_10351059 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter | 887 | Open in IMG/M |
| 3300012285|Ga0137370_10963014 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter | 526 | Open in IMG/M |
| 3300012349|Ga0137387_10151807 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 1650 | Open in IMG/M |
| 3300012350|Ga0137372_10189901 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 1651 | Open in IMG/M |
| 3300012350|Ga0137372_10219710 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 1509 | Open in IMG/M |
| 3300012353|Ga0137367_10400751 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter | 973 | Open in IMG/M |
| 3300012353|Ga0137367_10530820 | All Organisms → cellular organisms → Bacteria | 827 | Open in IMG/M |
| 3300012354|Ga0137366_10011385 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 7006 | Open in IMG/M |
| 3300012354|Ga0137366_10194521 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 1517 | Open in IMG/M |
| 3300012357|Ga0137384_10010751 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 7415 | Open in IMG/M |
| 3300012357|Ga0137384_11450302 | Not Available | 535 | Open in IMG/M |
| 3300012359|Ga0137385_10058563 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 3435 | Open in IMG/M |
| 3300012359|Ga0137385_10338262 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter | 1290 | Open in IMG/M |
| 3300012359|Ga0137385_10449582 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter | 1094 | Open in IMG/M |
| 3300012359|Ga0137385_10821240 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter | 772 | Open in IMG/M |
| 3300012360|Ga0137375_10812700 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter | 751 | Open in IMG/M |
| 3300012361|Ga0137360_10961872 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
| 3300012363|Ga0137390_10116771 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 2642 | Open in IMG/M |
| 3300012378|Ga0134025_1035428 | All Organisms → cellular organisms → Bacteria | 815 | Open in IMG/M |
| 3300012404|Ga0134024_1184305 | Not Available | 635 | Open in IMG/M |
| 3300012469|Ga0150984_103191643 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter | 533 | Open in IMG/M |
| 3300012532|Ga0137373_10446860 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter | 996 | Open in IMG/M |
| 3300012582|Ga0137358_10412265 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter | 913 | Open in IMG/M |
| 3300012582|Ga0137358_10981677 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300012883|Ga0157281_1052124 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300012885|Ga0157287_1024270 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter | 816 | Open in IMG/M |
| 3300012918|Ga0137396_10079641 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 2304 | Open in IMG/M |
| 3300012918|Ga0137396_10260847 | All Organisms → Viruses → Predicted Viral | 1279 | Open in IMG/M |
| 3300012922|Ga0137394_11547044 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300012923|Ga0137359_10165965 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 1970 | Open in IMG/M |
| 3300012925|Ga0137419_10105276 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 1961 | Open in IMG/M |
| 3300012929|Ga0137404_10095319 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 2389 | Open in IMG/M |
| 3300012929|Ga0137404_12104708 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300012948|Ga0126375_10424413 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 969 | Open in IMG/M |
| 3300012971|Ga0126369_10454839 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 1330 | Open in IMG/M |
| 3300012971|Ga0126369_10993188 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 927 | Open in IMG/M |
| 3300012976|Ga0134076_10375531 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
| 3300014150|Ga0134081_10053423 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 1211 | Open in IMG/M |
| 3300014166|Ga0134079_10040331 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 1606 | Open in IMG/M |
| 3300015241|Ga0137418_10031241 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 4933 | Open in IMG/M |
| 3300015245|Ga0137409_10488668 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 1054 | Open in IMG/M |
| 3300015356|Ga0134073_10050434 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 1114 | Open in IMG/M |
| 3300015356|Ga0134073_10112161 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 820 | Open in IMG/M |
| 3300015371|Ga0132258_10704526 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 2542 | Open in IMG/M |
| 3300015371|Ga0132258_12177476 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 1392 | Open in IMG/M |
| 3300015371|Ga0132258_12993266 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 1171 | Open in IMG/M |
| 3300015374|Ga0132255_105726898 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300016294|Ga0182041_11595408 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300016357|Ga0182032_10691471 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 855 | Open in IMG/M |
| 3300016404|Ga0182037_10123744 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 1906 | Open in IMG/M |
| 3300017656|Ga0134112_10189230 | All Organisms → cellular organisms → Bacteria | 802 | Open in IMG/M |
| 3300017659|Ga0134083_10388003 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300017792|Ga0163161_12006780 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 515 | Open in IMG/M |
| 3300018027|Ga0184605_10222591 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 857 | Open in IMG/M |
| 3300018031|Ga0184634_10216033 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 875 | Open in IMG/M |
| 3300018051|Ga0184620_10338398 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300018054|Ga0184621_10007376 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 3079 | Open in IMG/M |
| 3300018076|Ga0184609_10070851 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 1526 | Open in IMG/M |
| 3300018431|Ga0066655_10002468 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 7003 | Open in IMG/M |
| 3300018431|Ga0066655_10042867 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 2287 | Open in IMG/M |
| 3300018431|Ga0066655_10331381 | All Organisms → cellular organisms → Bacteria | 996 | Open in IMG/M |
| 3300018431|Ga0066655_10610232 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 736 | Open in IMG/M |
| 3300018433|Ga0066667_10135680 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 1710 | Open in IMG/M |
| 3300018433|Ga0066667_10141293 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 1682 | Open in IMG/M |
| 3300018433|Ga0066667_10573099 | All Organisms → cellular organisms → Bacteria | 939 | Open in IMG/M |
| 3300018433|Ga0066667_10846162 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
| 3300018433|Ga0066667_10847317 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
| 3300018468|Ga0066662_11732102 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 654 | Open in IMG/M |
| 3300018482|Ga0066669_10058914 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 2474 | Open in IMG/M |
| 3300018482|Ga0066669_10366523 | All Organisms → cellular organisms → Bacteria | 1204 | Open in IMG/M |
| 3300018482|Ga0066669_10519298 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 1033 | Open in IMG/M |
| 3300018482|Ga0066669_11822210 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300019269|Ga0184644_1179247 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300019356|Ga0173481_10473562 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300019789|Ga0137408_1026726 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300019866|Ga0193756_1042885 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
| 3300019874|Ga0193744_1002593 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 3322 | Open in IMG/M |
| 3300019877|Ga0193722_1011416 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 2265 | Open in IMG/M |
| 3300019877|Ga0193722_1014531 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 2021 | Open in IMG/M |
| 3300019881|Ga0193707_1001330 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 8991 | Open in IMG/M |
| 3300019881|Ga0193707_1003416 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 5686 | Open in IMG/M |
| 3300019885|Ga0193747_1000408 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 14877 | Open in IMG/M |
| 3300019888|Ga0193751_1011076 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 4730 | Open in IMG/M |
| 3300019888|Ga0193751_1024724 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 2903 | Open in IMG/M |
| 3300019998|Ga0193710_1004870 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 1345 | Open in IMG/M |
| 3300020006|Ga0193735_1000215 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 18677 | Open in IMG/M |
| 3300020006|Ga0193735_1004617 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 4427 | Open in IMG/M |
| 3300020008|Ga0193757_1022085 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300020010|Ga0193749_1078718 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300020018|Ga0193721_1031332 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 1406 | Open in IMG/M |
| 3300020022|Ga0193733_1126263 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 704 | Open in IMG/M |
| 3300020059|Ga0193745_1016081 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 1625 | Open in IMG/M |
| 3300020170|Ga0179594_10338084 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300021080|Ga0210382_10221962 | All Organisms → cellular organisms → Bacteria | 824 | Open in IMG/M |
| 3300021086|Ga0179596_10446798 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 654 | Open in IMG/M |
| 3300021178|Ga0210408_10891710 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 693 | Open in IMG/M |
| 3300021344|Ga0193719_10000831 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 11951 | Open in IMG/M |
| 3300021344|Ga0193719_10006126 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 4954 | Open in IMG/M |
| 3300021411|Ga0193709_1100045 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300021560|Ga0126371_11663958 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 763 | Open in IMG/M |
| 3300021951|Ga0222624_1028638 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300022534|Ga0224452_1120536 | All Organisms → cellular organisms → Bacteria | 806 | Open in IMG/M |
| 3300022694|Ga0222623_10144489 | All Organisms → cellular organisms → Bacteria | 926 | Open in IMG/M |
| 3300022694|Ga0222623_10319959 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → Chthoniobacter flavus | 594 | Open in IMG/M |
| 3300022756|Ga0222622_10095742 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1813 | Open in IMG/M |
| 3300024254|Ga0247661_1063033 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → Chthoniobacter flavus | 686 | Open in IMG/M |
| 3300025900|Ga0207710_10777963 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300025906|Ga0207699_11424960 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → Chthoniobacter flavus | 512 | Open in IMG/M |
| 3300025910|Ga0207684_10161669 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1929 | Open in IMG/M |
| 3300025910|Ga0207684_10372587 | Not Available | 1228 | Open in IMG/M |
| 3300025910|Ga0207684_10819225 | All Organisms → cellular organisms → Bacteria | 786 | Open in IMG/M |
| 3300025910|Ga0207684_11073483 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → Chthoniobacter flavus | 671 | Open in IMG/M |
| 3300025922|Ga0207646_10117989 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → Chthoniobacter flavus | 2383 | Open in IMG/M |
| 3300025928|Ga0207700_10995486 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
| 3300025939|Ga0207665_10055084 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → Chthoniobacter flavus | 2683 | Open in IMG/M |
| 3300026023|Ga0207677_10147188 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1812 | Open in IMG/M |
| 3300026307|Ga0209469_1026295 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → Chthoniobacter flavus | 1995 | Open in IMG/M |
| 3300026308|Ga0209265_1218426 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300026309|Ga0209055_1040958 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 2047 | Open in IMG/M |
| 3300026314|Ga0209268_1054824 | All Organisms → cellular organisms → Bacteria | 1255 | Open in IMG/M |
| 3300026314|Ga0209268_1157735 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300026317|Ga0209154_1023085 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → Chthoniobacter flavus | 2907 | Open in IMG/M |
| 3300026323|Ga0209472_1012195 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → Chthoniobacter flavus | 4321 | Open in IMG/M |
| 3300026324|Ga0209470_1007725 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → Chthoniobacter flavus | 6687 | Open in IMG/M |
| 3300026324|Ga0209470_1022919 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → Chthoniobacter flavus | 3332 | Open in IMG/M |
| 3300026327|Ga0209266_1034247 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 2654 | Open in IMG/M |
| 3300026331|Ga0209267_1156418 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → Chthoniobacter flavus | 933 | Open in IMG/M |
| 3300026333|Ga0209158_1039916 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → Chthoniobacter flavus | 1979 | Open in IMG/M |
| 3300026334|Ga0209377_1309597 | Not Available | 527 | Open in IMG/M |
| 3300026343|Ga0209159_1004643 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → Chthoniobacter flavus | 8833 | Open in IMG/M |
| 3300026343|Ga0209159_1056752 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1884 | Open in IMG/M |
| 3300026343|Ga0209159_1096488 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1294 | Open in IMG/M |
| 3300026359|Ga0257163_1003179 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → Chthoniobacter flavus | 2223 | Open in IMG/M |
| 3300026377|Ga0257171_1070230 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300026480|Ga0257177_1080497 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → Chthoniobacter flavus | 528 | Open in IMG/M |
| 3300026523|Ga0209808_1034042 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → Chthoniobacter flavus | 2433 | Open in IMG/M |
| 3300026524|Ga0209690_1019161 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → Chthoniobacter flavus | 3482 | Open in IMG/M |
| 3300026530|Ga0209807_1055215 | All Organisms → cellular organisms → Bacteria | 1818 | Open in IMG/M |
| 3300026532|Ga0209160_1051764 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → Chthoniobacter flavus | 2367 | Open in IMG/M |
| 3300026537|Ga0209157_1081540 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1586 | Open in IMG/M |
| 3300026538|Ga0209056_10000781 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → Chthoniobacter flavus | 35202 | Open in IMG/M |
| 3300026540|Ga0209376_1257480 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
| 3300026548|Ga0209161_10025712 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → Chthoniobacter flavus | 4145 | Open in IMG/M |
| 3300026552|Ga0209577_10003197 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → Chthoniobacter flavus | 15447 | Open in IMG/M |
| 3300026773|Ga0207566_103479 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → Chthoniobacter flavus | 573 | Open in IMG/M |
| 3300026791|Ga0208072_100223 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → Chthoniobacter flavus | 2424 | Open in IMG/M |
| 3300027018|Ga0208475_1001140 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → Chthoniobacter flavus | 2395 | Open in IMG/M |
| 3300027645|Ga0209117_1141555 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300027684|Ga0209626_1222871 | Not Available | 500 | Open in IMG/M |
| 3300027748|Ga0209689_1356612 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → Chthoniobacter flavus | 559 | Open in IMG/M |
| 3300027846|Ga0209180_10073068 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → Chthoniobacter flavus | 1926 | Open in IMG/M |
| 3300027846|Ga0209180_10574176 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → Chthoniobacter flavus | 625 | Open in IMG/M |
| 3300027882|Ga0209590_10063867 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → Chthoniobacter flavus | 2097 | Open in IMG/M |
| 3300028536|Ga0137415_10012135 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → Chthoniobacter flavus | 8541 | Open in IMG/M |
| 3300028536|Ga0137415_10143643 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → Chthoniobacter flavus | 2225 | Open in IMG/M |
| 3300028717|Ga0307298_10119303 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → Chthoniobacter flavus | 756 | Open in IMG/M |
| 3300028793|Ga0307299_10160379 | All Organisms → cellular organisms → Bacteria | 847 | Open in IMG/M |
| 3300028819|Ga0307296_10729302 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → Chthoniobacter flavus | 541 | Open in IMG/M |
| 3300028828|Ga0307312_10037121 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → Chthoniobacter flavus | 2866 | Open in IMG/M |
| 3300028828|Ga0307312_10454178 | All Organisms → cellular organisms → Bacteria | 844 | Open in IMG/M |
| 3300028875|Ga0307289_10307252 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → Chthoniobacter flavus | 652 | Open in IMG/M |
| 3300028878|Ga0307278_10008665 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → Chthoniobacter flavus | 4798 | Open in IMG/M |
| 3300028885|Ga0307304_10580229 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300028889|Ga0247827_10066824 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → Chthoniobacter flavus | 1701 | Open in IMG/M |
| 3300030514|Ga0268253_10156417 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria | 711 | Open in IMG/M |
| 3300030939|Ga0138303_1038428 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria | 1451 | Open in IMG/M |
| 3300030972|Ga0075400_11905727 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → Chthoniobacter flavus | 574 | Open in IMG/M |
| 3300030974|Ga0075371_11785998 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria | 1403 | Open in IMG/M |
| 3300030979|Ga0068589_11684754 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria | 594 | Open in IMG/M |
| 3300031057|Ga0170834_100763000 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → unclassified Spartobacteria → Spartobacteria bacterium LR76 | 750 | Open in IMG/M |
| 3300031128|Ga0170823_14275644 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → Chthoniobacter flavus | 4053 | Open in IMG/M |
| 3300031231|Ga0170824_100163408 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → unclassified Spartobacteria → Spartobacteria bacterium LR76 | 2106 | Open in IMG/M |
| 3300031231|Ga0170824_105885416 | Not Available | 500 | Open in IMG/M |
| 3300031231|Ga0170824_105964084 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300031231|Ga0170824_115561142 | Not Available | 526 | Open in IMG/M |
| 3300031716|Ga0310813_10766402 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 866 | Open in IMG/M |
| 3300031719|Ga0306917_10965851 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → Chthoniobacter flavus | 666 | Open in IMG/M |
| 3300031720|Ga0307469_11382616 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
| 3300031946|Ga0310910_10529142 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 936 | Open in IMG/M |
| 3300032059|Ga0318533_11374603 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300032180|Ga0307471_100000130 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria | 36332 | Open in IMG/M |
| 3300033412|Ga0310810_10095574 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → Chthoniobacter flavus | 3550 | Open in IMG/M |
| 3300033412|Ga0310810_10601344 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → Chthoniobacter flavus | 1056 | Open in IMG/M |
| 3300033475|Ga0310811_10494590 | All Organisms → cellular organisms → Bacteria | 1284 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 20.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 19.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 10.12% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 7.80% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 5.78% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.49% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.18% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.18% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 2.89% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.60% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 2.31% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.73% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.45% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.45% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.16% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.16% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.87% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.87% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.87% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.58% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.58% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.29% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.29% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.29% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.29% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.29% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.29% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.29% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.29% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.29% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.29% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.29% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.29% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.29% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.29% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.29% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.29% |
| Agave | Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave | 0.29% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.29% |
| Simulated | Engineered → Modeled → Simulated Communities (Sequence Read Mixture) → Unclassified → Unclassified → Simulated | 0.29% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2166559005 | Simulated microbial communities from Lyon, France | Engineered | Open in IMG/M |
| 2170459002 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 direct MP BIO 1O1 lysis 0-21 cm | Environmental | Open in IMG/M |
| 2170459003 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect MP BIO 1O1 lysis 0-21cm | Environmental | Open in IMG/M |
| 2170459005 | Grass soil microbial communities from Rothamsted Park, UK - July 2009 direct MP BIO1O1 lysis 0-21cm | Environmental | Open in IMG/M |
| 2170459006 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect in plug lysis (for fosmid construction) 0-10cm | Environmental | Open in IMG/M |
| 2170459007 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect in plug lysis (for fosmid construction) 10-21cm | Environmental | Open in IMG/M |
| 2170459009 | Grass soil microbial communities from Rothamsted Park, UK - July 2009 indirect DNA Tissue lysis 0-10cm | Environmental | Open in IMG/M |
| 2170459011 | Grass soil microbial communities from Rothamsted Park, UK - July 2009 indirect Gram positive lysis 0-10cm | Environmental | Open in IMG/M |
| 2170459015 | Litter degradation PV4 | Engineered | Open in IMG/M |
| 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Host-Associated | Open in IMG/M |
| 3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
| 3300000579 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A01 | Environmental | Open in IMG/M |
| 3300000596 | Amended soil microbial communities from Kansas Great Prairies, USA - Total DNA no BrdU F1.4TC | Environmental | Open in IMG/M |
| 3300000709 | Amended soil microbial communities from Kansas Great Prairies, USA - Total DNA F1.4 TB amended with BrdU and acetate no abondance | Environmental | Open in IMG/M |
| 3300000893 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A001 | Environmental | Open in IMG/M |
| 3300002899 | Soil microbial communities from Manhattan, Kansas, USA - Combined assembly of Kansas soil 100-500um Nextera (ASSEMBLY_DATE=20140607) | Environmental | Open in IMG/M |
| 3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010139 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_2_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011003 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t9i015 | Environmental | Open in IMG/M |
| 3300012011 | Permafrost microbial communities from Nunavut, Canada - A30_65cm_6M | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012378 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012404 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012883 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 | Environmental | Open in IMG/M |
| 3300012885 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
| 3300018051 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1 | Environmental | Open in IMG/M |
| 3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019269 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019866 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1m1 | Environmental | Open in IMG/M |
| 3300019874 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1a1 | Environmental | Open in IMG/M |
| 3300019877 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m1 | Environmental | Open in IMG/M |
| 3300019881 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2 | Environmental | Open in IMG/M |
| 3300019885 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m2 | Environmental | Open in IMG/M |
| 3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
| 3300019998 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3m1 | Environmental | Open in IMG/M |
| 3300020006 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m2 | Environmental | Open in IMG/M |
| 3300020008 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1m2 | Environmental | Open in IMG/M |
| 3300020010 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1s2 | Environmental | Open in IMG/M |
| 3300020018 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s2 | Environmental | Open in IMG/M |
| 3300020022 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2 | Environmental | Open in IMG/M |
| 3300020059 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1a2 | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300021411 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3c2 | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300021951 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022534 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1 | Environmental | Open in IMG/M |
| 3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300024254 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK02 | Environmental | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026307 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 (SPAdes) | Environmental | Open in IMG/M |
| 3300026308 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 (SPAdes) | Environmental | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026314 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 (SPAdes) | Environmental | Open in IMG/M |
| 3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
| 3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
| 3300026327 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes) | Environmental | Open in IMG/M |
| 3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
| 3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
| 3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
| 3300026343 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes) | Environmental | Open in IMG/M |
| 3300026359 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-A | Environmental | Open in IMG/M |
| 3300026377 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-B | Environmental | Open in IMG/M |
| 3300026480 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-B | Environmental | Open in IMG/M |
| 3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
| 3300026524 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
| 3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300026773 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G05A5-11 (SPAdes) | Environmental | Open in IMG/M |
| 3300026791 | Grasslands soil microbial communities from Kansas, USA that are Nitrogen fertilized - NN591 (SPAdes) | Environmental | Open in IMG/M |
| 3300027018 | Grasslands soil microbial communities from Kansas, USA, that are Nitrogen fertilized - NN575 (SPAdes) | Environmental | Open in IMG/M |
| 3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027684 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028717 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158 | Environmental | Open in IMG/M |
| 3300028793 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159 | Environmental | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028875 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143 | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
| 3300028889 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2 | Environmental | Open in IMG/M |
| 3300030514 | Agave microbial communities from Guanajuato, Mexico - Mg.Ma.rz (v2) | Host-Associated | Open in IMG/M |
| 3300030939 | Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A9_MS_spring Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300030972 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FB4 SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030974 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA8 SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030979 | Forest soil microbial communities from France, for metatranscriptomics studies - Site 11 - Champenoux / Amance forest (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| cont_0228.00005360 | 2166559005 | Simulated | KVTTRRTLRVSHFADYESTTISKKTLCQLQDREAQERGARDLQKPAP |
| E1_09175750 | 2170459002 | Grass Soil | MTTRSRLRVFHFADYESTTISKKALCQLQDREAQERRAR |
| E4A_09551820 | 2170459003 | Grass Soil | MTTRSRLRVFHFADYESTTISKKALCQLQDREAQERRARDLQKPAP |
| E41_07903160 | 2170459005 | Grass Soil | MTTRRAAAVFEFANYESTTISKKTLCELQDCEAQERGARDLTKTR |
| E41_12043780 | 2170459005 | Grass Soil | VTTRRTLRVSHFADYESTTISKKTLCQLQDREAQERGARDLQEPXP |
| L01_05725450 | 2170459006 | Grass Soil | MTTRSRLRVFHFADYESTTISKKALCQLQDREAQERGARDLQKPAP |
| L02_01906700 | 2170459007 | Grass Soil | FHFADYESTTISKKALCQLQDREAQERRARDLQKPAP |
| F47_02502810 | 2170459009 | Grass Soil | KMTTRSWLRVFHFADYESTTISKKALCQLQDREAQERRARDLQKPAP |
| F64_02742350 | 2170459011 | Grass Soil | RVFHFADYESTTISKKALCQLQDREAQERRARDLQKPAP |
| 4PV_00313810 | 2170459015 | Switchgrass, Maize And Mischanthus Litter | MITRRAAAVLDFANYESTTISKKTLCQLQNCETQKRGARDLQKPAPQTKARVTFI |
| ARcpr5yngRDRAFT_0115982 | 3300000043 | Arabidopsis Rhizosphere | MTTRSRLRVFHFADYESTTISEKALCQLQDREAQERGARDLQKPAP* |
| F14TC_1014660732 | 3300000559 | Soil | TTRSRLRVFCLADYESTTISKKALCQLQDREAQKRGARDLQEPAP* |
| AP72_2010_repI_A01DRAFT_10739251 | 3300000579 | Forest Soil | SQLRVFRPADYESTTISKEALCQLQDREAQECGARDLQEPAP* |
| KanNP_Total_noBrdU_T14TCDRAFT_10014482 | 3300000596 | Soil | MTTRSRLRVVCLADYESTTISKKALCQLQDREAQKRGARDLQEPAP* |
| KanNP_Total_noBrdU_T14TCDRAFT_10067173 | 3300000596 | Soil | MTTRSRLRVFHFADYESTTISKKALCQLQDREAQECGSRDL* |
| KanNP_Total_F14TBDRAFT_10223141 | 3300000709 | Soil | VTTRRTLPVSHFADYESTTISKEALCELQDREEALCELQDREAQERGARDLQKPAP* |
| AP72_2010_repI_A001DRAFT_10356693 | 3300000893 | Forest Soil | MMTLRLPRVFHFADYESTTISKKALCQLQDREAQERGARDLQXPAP* |
| AP72_2010_repI_A001DRAFT_10427612 | 3300000893 | Forest Soil | MTTRSQLRVFHFADYESTTISEKALCQLPDREAQERGARDLQKPAP* |
| JGIcombinedJ43975_100014865 | 3300002899 | Soil | MTTRSRLRVFCLADYESTTISKKALCQLQDREAQKRGARDLQEPAP* |
| JGI25616J43925_101505752 | 3300002917 | Grasslands Soil | MTTRSRLRIFHFADYESKTISKKALCQLQDREAQKRGARDLQKPAP* |
| Ga0066674_100252103 | 3300005166 | Soil | MTAQRPCVFHFVDYESTTISKKTLCQLQDRQAQERCARDLQEPAP* |
| Ga0066674_100408342 | 3300005166 | Soil | MTTRRPLRVSYFADYESTTISKKTLCELQDREAQERRARDLQKPAP* |
| Ga0066674_102182363 | 3300005166 | Soil | MTTRSSLRVFHFADYESTTISEKALCQLQDREAQERGARDLQEPAP* |
| Ga0066677_104219032 | 3300005171 | Soil | MMTRRAAAVLDFANYESTTISKKTLCQLQDREAQKCAPRDLQKPAP* |
| Ga0066683_100932652 | 3300005172 | Soil | MTTRSSLRVFRFANYESTTIGKKALCELQDREAQERGARDLQKPAP* |
| Ga0066683_107486592 | 3300005172 | Soil | MTTWSRLRVVRFADYESTTIGKKTLCQLQDRKAQERGARGLQKPAP* |
| Ga0066680_100340545 | 3300005174 | Soil | MTARTCLRVFRFADYESTTISKKTLCQLQDCEAQKRGARDLQKPAPQTAPGMTTPRKIHI |
| Ga0066673_100098361 | 3300005175 | Soil | MMTRLPRVFHFADYESTTISKKTLCQLQDREAQERCARDLQEPAP* |
| Ga0066673_100350305 | 3300005175 | Soil | MTTRNQARVFHFADYESTTISKKTLCQLQDREAQERVARDLQKPAP* |
| Ga0066673_102651472 | 3300005175 | Soil | MTTRRRLRVFHFADYESTTISEKALCQLQDREAQERGARDLQEPAP* |
| Ga0066679_1000051719 | 3300005176 | Soil | MTARTCLRVFRFADYESTTISKKTLCQLQDCEAQKRGARDLQKPAPQTAPGMTTPRKIDI |
| Ga0066688_100701533 | 3300005178 | Soil | MMTRRAAAVLDFANYESTTISKKTLCQLQDREAQERRARDLQEPAP* |
| Ga0066688_103984422 | 3300005178 | Soil | MTTRRCLRVFHFADYESTTISEKALCQLQDREAQERGARDLQEPAP* |
| Ga0066684_100057591 | 3300005179 | Soil | ERANNLSPKMMTRLPRVFHFADYESTTISKKTLCQLQDREAQERCARDLQEPAP* |
| Ga0066684_100232985 | 3300005179 | Soil | MTTRSRFRVFSRACGTDYESTTISKKALCQLQDREAQECAARNLQKPAP* |
| Ga0066684_101104654 | 3300005179 | Soil | ERANNLSPKMMTRLPRVFHFADYESTTISKKTLCQLQDRETQERIARDLQKPAP* |
| Ga0066676_101653831 | 3300005186 | Soil | LCVSHFADYESTTISKKTLCELQDREAQERSARDLQKPAP* |
| Ga0066676_102215362 | 3300005186 | Soil | MTTRSRLRVFHFADYESTTISKKALCQLQDREAQERGAGDLQKPAP* |
| Ga0066676_102690513 | 3300005186 | Soil | MTTRRPLRVSHFADYESTTISKKTLCQLQDREAQERGARDLQKPTS* |
| Ga0066676_105877833 | 3300005186 | Soil | MTTRSRLRVFRLADYESTTISKKALCQLQDREAQERGARDLQEPA |
| Ga0066675_103691823 | 3300005187 | Soil | VPRFHFADYESTTISKKTLCQLQDRETQERIARDLQKPAP* |
| Ga0065712_100046013 | 3300005290 | Miscanthus Rhizosphere | MTTRSRLRVFHFADYESTTISXKXLCQLQDREAQERGARDLQKPAP* |
| Ga0065707_107219243 | 3300005295 | Switchgrass Rhizosphere | MTTRSRLRVFRLADYESTTISKKALCQLQDREAQERGARDLQ |
| Ga0070676_108122071 | 3300005328 | Miscanthus Rhizosphere | MTTRSRLRVFHFADYESTTISKKALCQLQDREAQERGARDLQ |
| Ga0066388_1000630192 | 3300005332 | Tropical Forest Soil | MTTRSWLRVFHFADYESTTISKTALCQLQDREAQERAARDLQEPAP* |
| Ga0066388_1030070082 | 3300005332 | Tropical Forest Soil | MTTRSQLRVFHFADYESTTISEKALCQLQDREAQERGARDLQEPAP* |
| Ga0070709_110176852 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MTTRSRLRVFRLADYESTTISKKALCQLQDREAQERGARDLQEPAP* |
| Ga0070694_1009696582 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MTTRSRLRVFHFADYESTTISKKTLCQLQDREAQERGARDLQKPAP* |
| Ga0070708_1017433721 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | SPKMTTRSRLRVFHFADYESTTISKKALCQLQDREAQERGARDLQEPAP* |
| Ga0066686_100376065 | 3300005446 | Soil | MTAQRPCVFHFVDYESTTISKKTLCELQDREAQERGARDLQEPAP* |
| Ga0066686_101192973 | 3300005446 | Soil | MITRRPPRVFNFADYESTTISKKTLCQLQDRETQERIARDLQKPAP* |
| Ga0066686_103500792 | 3300005446 | Soil | MTTRNQARVFHFADYESTTISKKTLCQLQDREAQERAARDLQKPAP* |
| Ga0066686_106664862 | 3300005446 | Soil | TTRRPLRVSHFADYESTTISKKTLCQLQDREAQERGARDLQKPTS* |
| Ga0066689_100580103 | 3300005447 | Soil | MTTRRPLRVSYFADYESTTISKKTLCELQDREAQERAARDLQKPAP* |
| Ga0066682_100615084 | 3300005450 | Soil | MTTRRHLRVFHFADYESTTISKKALCQLQDREAQERGARDLQKPAP* |
| Ga0066681_100430785 | 3300005451 | Soil | MTTRSSLRVLHFADYESTTISEKALCQLQDREAQERGARD |
| Ga0066681_107583412 | 3300005451 | Soil | MTTWSRLHVFRFADYESTTIGKKTLCQLQDRKAQERGARGLQKPAP* |
| Ga0066681_108588822 | 3300005451 | Soil | LRVSHFADYESTTISKKTLCELQDREAQERGARDLQKPPP* |
| Ga0066687_101087902 | 3300005454 | Soil | MTTRRCLRVFHFADYESTTISEKALCQLQDREAQERGARDLQKPAP* |
| Ga0066687_102568053 | 3300005454 | Soil | MTMPGRPSVFHFADNESTTISKKNLCQLQDREAQERGARDLQEPAP* |
| Ga0070706_1001920752 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MMTRLPRVFHFADYESTTISKKTLCELQDSEAQERCARDLQEPAP* |
| Ga0070706_1005014213 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MTTRTCLRVFRFADYESTTISQKTLCQLQDCEAQKRGARDLQKPAPQTAPGMTTPGKIDI |
| Ga0070707_1001300262 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MTTRRPLRVSYFADYESTTISKKTLCELQDREAQERGARDLQKPAP* |
| Ga0070698_1021660591 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | VTTRRTLRVSHFADYESTTISKKTLCQLQDREAQERGARDLQKPAP |
| Ga0070741_100056606 | 3300005529 | Surface Soil | MTTRRALQVSLDYESTTISKKALCQLQDRETQERGEGDLQEPAPQTAPGMNSI* |
| Ga0070697_1000505165 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MTTRSRVRVFRLADYESTTISKKALCQLQDREAQERSARDLQEPAP* |
| Ga0066697_102469043 | 3300005540 | Soil | MMTRLPRVFHFADYESTTISKKTLCQLQDREAQERCARDLQEP |
| Ga0070686_1009082983 | 3300005544 | Switchgrass Rhizosphere | MTTRLAAAVFDFANYESTTISKKTLCELQDCEAQERCARDLQQKPSP* |
| Ga0070693_1011949303 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | MTTRLAAAVFDFANYESTTISKKTLCELQDCEAQERGARDLQEPA |
| Ga0066692_101820411 | 3300005555 | Soil | HFADYESTTISKKTLCQLQDREAQERVARDLQKPAP* |
| Ga0066707_108864091 | 3300005556 | Soil | VFRLVDYESTTISKKTLCELQDCEAQKRGARDLQEPAP* |
| Ga0066693_103387352 | 3300005566 | Soil | RACGTDYESTTISKKALCQLQDREAQECAARNLQKPAP* |
| Ga0066694_100203195 | 3300005574 | Soil | MTRLPRVFHFADYESTTISKKTLCQLQDREAQERCARDLQEPAP* |
| Ga0066708_101889133 | 3300005576 | Soil | LADYESTTISKKALCQLQDREAQERGARDLQEPAP* |
| Ga0066708_102047621 | 3300005576 | Soil | PLRVFRLADYESTTISKKALCQLQDREAQECGARDLQEPAP* |
| Ga0066708_103507723 | 3300005576 | Soil | FSRACGTDYESTTISKKALCQLQDREAQECAARHLQKPAP* |
| Ga0066706_100479014 | 3300005598 | Soil | MMTRRAAAVLDFANYESTTISKKTLCQLQDRETQECGPRDLQKPAP* |
| Ga0066903_1000119187 | 3300005764 | Tropical Forest Soil | MTTRSRLRVFYFADYESTTISKEALCQLQNREAQKRVARDLQEPAPQTAPGLNYLIL* |
| Ga0066903_1001816235 | 3300005764 | Tropical Forest Soil | MMTLRLPRVLHFADYESTTISKKALCQLQDREAQERGARDLQKPA |
| Ga0066903_1002068181 | 3300005764 | Tropical Forest Soil | MMTRLPRVFHFADYESTTISKKTLCQLQDREAQERCARDLQKPA |
| Ga0066903_1071880982 | 3300005764 | Tropical Forest Soil | FHFADYESTTISEKALCQLQDREAQERGARDLQEPAP* |
| Ga0081455_1000032858 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MTTRRALRVSLDYESTTISKKALCQLQDREAQERGARDLQKPAP* |
| Ga0081455_1000139912 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MTTRSWLRVFSRECGTDYESTTISKKALCQLQDCEAQERGARDLQEPAP* |
| Ga0081540_100003650 | 3300005983 | Tabebuia Heterophylla Rhizosphere | MTTRSRLRVFHFADYESTTISKKALCQLQDRETQERVARDLQKPAP* |
| Ga0070717_101255394 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MTTRSRLRVFRFADYESTTISKKALCQLQDRQAQERGARDLQEPAP* |
| Ga0066651_104387143 | 3300006031 | Soil | MMTRLPRVFHFADYESTTISKKTLCQLQDREAQER |
| Ga0066656_102056951 | 3300006034 | Soil | LRVFRLADYESTTISKKALCQLQDREAQECGARDLQEPAP* |
| Ga0066652_1003020794 | 3300006046 | Soil | RVFHFADYESTTISKKTLCQLQDREAQERCARDLQEPAP* |
| Ga0066652_1015245091 | 3300006046 | Soil | TRTCLRVFHFADYESTTISKKTLCQLQDREAQERGARDLQKPAP* |
| Ga0070716_1006590631 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MTTRRAAAVFNFANYESTTISKKTLCELQDCEAQERCARDLQKPA |
| Ga0066660_100907063 | 3300006800 | Soil | MTARTCLRVSRFADYESTTISKKTLCQLQDCEAQKRGARDLQKPAPQTAPGMTTPRKIDI |
| Ga0079220_116452582 | 3300006806 | Agricultural Soil | MITRQPFGVCHFADYEGTTISKKSLCELQDCEAQERCARHLQEPAP* |
| Ga0099795_104000992 | 3300007788 | Vadose Zone Soil | LRVFHFADYESTTISKKTLCQLQDREAQERGARDLQKPAP* |
| Ga0066710_10000738013 | 3300009012 | Grasslands Soil | MTTRNQARVFHFADYESTTISKKTLCQLQDREAQERAARDLQKPAP |
| Ga0066710_1005907861 | 3300009012 | Grasslands Soil | LPRVFHFADYESTTISKKTLCELQDREAQERCARDLQEPAP |
| Ga0066710_1018810081 | 3300009012 | Grasslands Soil | SSLRVFRFANYESTTIGKKALCQLQDREAQECGARDLQKPAP |
| Ga0066710_1029263912 | 3300009012 | Grasslands Soil | EGANYLSPKMITRRPPRVFNFADYESTTISKKTLCQLQDRETQKRIARDLQKPAP |
| Ga0099829_105325133 | 3300009038 | Vadose Zone Soil | SPKVTTRTYLRVFHFADYESTTISKKTLCQLQDREAQERGARHLQKPAP* |
| Ga0099830_100327066 | 3300009088 | Vadose Zone Soil | MTARTCLRVFRFADYESTTISKKTLCQLQDCEAQKRGARDLQKPAPQTAPGMTTPR |
| Ga0099830_113021932 | 3300009088 | Vadose Zone Soil | RLLDYESTTISKKTLCKVQDREAQKRGAHHLQEPAP* |
| Ga0099828_100613403 | 3300009089 | Vadose Zone Soil | MTTPRPLRVSYFADYESTTISKKTLCELQDREAQERGARDLQKPAP* |
| Ga0075418_114396092 | 3300009100 | Populus Rhizosphere | MTTRRAAAVFGIANYESTTISKKALCELQDCEAQERRARYLQKPAA* |
| Ga0075418_126877841 | 3300009100 | Populus Rhizosphere | VFDFANYESTTISKKTLCELQDCEAQECGARDLQEPAP* |
| Ga0066709_1000132904 | 3300009137 | Grasslands Soil | MTTRNQARVFHFADYESTTISKKTLCQLQDREAQERAARNLQKPAP* |
| Ga0066709_1000320246 | 3300009137 | Grasslands Soil | MTTRSQLRVFSRACGTDYESTTISKKALCQLQDREAQECAARNLQKPAP* |
| Ga0066709_1001315805 | 3300009137 | Grasslands Soil | MTTRSRLRVFCLADYESTTISKKALCQLQDREAQERGARDLQEPAP* |
| Ga0066709_1002158145 | 3300009137 | Grasslands Soil | FADYESTTISKKTLCQLQDREAQERCARDLQEPAP* |
| Ga0066709_1016241893 | 3300009137 | Grasslands Soil | PKMMTRRAAAVLDFANYESTTISKKTLCQLQDRETQECGPRDLQKPAP* |
| Ga0066709_1027964671 | 3300009137 | Grasslands Soil | ADYESTTISKKTLCQLQDRETQERIARDLQKPAP* |
| Ga0066709_1028964341 | 3300009137 | Grasslands Soil | LVDYESTTISKKALCELQDREAQKCSARYLQEPAP* |
| Ga0075423_106228722 | 3300009162 | Populus Rhizosphere | MTTRSRLRVFHFADYESTTISEKAVCQLQDREAQERGARDLQKPAP* |
| Ga0126384_124656732 | 3300010046 | Tropical Forest Soil | SQLRVFHFADYESTTISKKTLCQLQDREAQERCARDLQKPAP* |
| Ga0126382_100069715 | 3300010047 | Tropical Forest Soil | MTTRSWVRVFSRACGTDYESTTISKKALCQLQDCKAQERGAGNLQEPAP* |
| Ga0127464_10461112 | 3300010139 | Grasslands Soil | ANYLSPKVTTRSQLRVFRLADYESTTISKKALCQLQDREAQERGARDLQEPAP* |
| Ga0127503_111317356 | 3300010154 | Soil | ADYESTTISKKALCQLQDREAQERGARDLQEPAP* |
| Ga0134082_102253923 | 3300010303 | Grasslands Soil | ADYESTTISKKTLCQLQDREAQERCARDLQEPAP* |
| Ga0134067_105019111 | 3300010321 | Grasslands Soil | ANYVSPKVTTRTCLRVFHFADYESTTISKKTLCQLQDREAQERGARHLQKPAP* |
| Ga0134084_100277154 | 3300010322 | Grasslands Soil | TTRTYLRVFYFADYESTTISKKTLCQLQDCEAQERVARDLQKPAPQTKARVISD* |
| Ga0134086_100641563 | 3300010323 | Grasslands Soil | HVFRFADYESTTIGKKTLCQLQDRKAQERGARGLQKPAP* |
| Ga0134064_100077471 | 3300010325 | Grasslands Soil | MTTRRPLRVSYFADYESTTISKKTLCELQDREAQERGARDL* |
| Ga0134065_102950341 | 3300010326 | Grasslands Soil | VTTRRTLHVSRFADYESTTISKKALCELQDREAQERGARGLQKPAP* |
| Ga0134065_103999701 | 3300010326 | Grasslands Soil | VSPKMTTRSSLRVLHFADYESTTISEKALCQLQDREAQERGPRDLQEPAP* |
| Ga0134111_104808321 | 3300010329 | Grasslands Soil | PAVVYFADYESTTISKKTLCELQDREAQERGARDLQEPAP* |
| Ga0134080_1000117612 | 3300010333 | Grasslands Soil | MTTWSSLRVFRFANYESTTIGKKALCELQDREAQERGARDLQKPAP* |
| Ga0134071_100589032 | 3300010336 | Grasslands Soil | MTTQRPCVFHVVDYEITTISKKTLCELQDREAQERRARDLQEPAP* |
| Ga0126370_115687571 | 3300010358 | Tropical Forest Soil | RANYLSPKMTTRSQLRVFRLADYESTTISKKTLCQLQDRQAQERGAGDLQEPAS* |
| Ga0126370_126096681 | 3300010358 | Tropical Forest Soil | MTTGRAATVFDFANYESTTISKKALCELQDCEAQKRGARDLQEPAP* |
| Ga0126378_115280391 | 3300010361 | Tropical Forest Soil | MMTRSCLRVFSSTCGTDYESTTISEKTLCQLQDREAQERGAR |
| Ga0126377_107967951 | 3300010362 | Tropical Forest Soil | MTTRSWVRVFSRACGTDYESTTISKKALCQLQDCEAQERGARNLQEPAPQTASGMSFV* |
| Ga0126383_134361241 | 3300010398 | Tropical Forest Soil | MMTRRAAAVFDFANYESTTISKKALCQLQDREAQKRRARDL |
| Ga0138514_1000546192 | 3300011003 | Soil | MTTRSQLRVFHFADYESTTISKKALCQLQNREAQECGARDLQEPAP* |
| Ga0120152_10205544 | 3300012011 | Permafrost | MTTRTWLRVFCFADYESTTISKKTLCKLQDCEAQKRGARDLQEPAPQTAPGMTTQRKIII |
| Ga0137389_101101363 | 3300012096 | Vadose Zone Soil | MTARTCLRVFRFADYESTTISKKTLCQLQDCEAQKRGACDLQKPAPQTAPGMTTPRKIDI |
| Ga0137364_102239894 | 3300012198 | Vadose Zone Soil | VFHFADYESTTISQETLCQLQDREAQERGAGDLQEPAP* |
| Ga0137364_102325052 | 3300012198 | Vadose Zone Soil | MTTRSQARVFQFADYESTTISKKTLCQLQDREAQERVARDLQKPAP* |
| Ga0137364_107365773 | 3300012198 | Vadose Zone Soil | HFADYESTTISKKTLCQLQDREAQERGARDLQKPPP* |
| Ga0137383_101337165 | 3300012199 | Vadose Zone Soil | MMTRLPRVFHFADYESTTISKKTLCELQDREAQERCARDLQEPAP* |
| Ga0137383_101554693 | 3300012199 | Vadose Zone Soil | MTTRTCLRVFRFADYESTTISKKTLCQLQDCEAQKRGARDLQKPAPQTAPGMTTPRKIDI |
| Ga0137383_102039201 | 3300012199 | Vadose Zone Soil | LSPKMMTRLPRVFHFADYESTTISKKTLCQLQDREAQERCARDLQEPAP* |
| Ga0137383_103145073 | 3300012199 | Vadose Zone Soil | DYVSPKMTTRRCLRVFHFADYESTTISEKALCQLQDREAQERGARDLQKPAP* |
| Ga0137382_100195768 | 3300012200 | Vadose Zone Soil | PRFHFADYESTTISKKTLCQLQDRETQERIARDLQKPAP* |
| Ga0137382_103264641 | 3300012200 | Vadose Zone Soil | KVTTRSPLRVFRLADYESTTISKKALCELQDCEAQERSARDLHEPAP* |
| Ga0137365_1000100932 | 3300012201 | Vadose Zone Soil | MTTRSWLRVFRLADYESTTISKKALCQLQDREAQERGARDLQEPAP* |
| Ga0137365_100050526 | 3300012201 | Vadose Zone Soil | MTTRTCLRVFRLVDYESTTISEKTLCQLQNCEAQKRGPCDLQKPAPQTAPGMTFHLAI* |
| Ga0137365_100289178 | 3300012201 | Vadose Zone Soil | RTCLRVFRFADYESTTISKKTLCQLQDCEAQKRGARDLQKPAPQTAPGMTTPRKIDI* |
| Ga0137365_104239521 | 3300012201 | Vadose Zone Soil | HFADYESTTISKKTLCQLQDREAQERGARDLQKPAP* |
| Ga0137363_101957284 | 3300012202 | Vadose Zone Soil | MTTRSPLRVFRLVNYESTTIGKKALCQLQNREAQERGTRDLQEPAS* |
| Ga0137363_113107201 | 3300012202 | Vadose Zone Soil | VSPKMTTRRCLRVFHFADYESTTISEKALCQLQDREAQERGARDLQKPAP* |
| Ga0137399_110545091 | 3300012203 | Vadose Zone Soil | HFADYESTTLSKKTLCKLQDREAQERGARDLQKPAP* |
| Ga0137374_100775122 | 3300012204 | Vadose Zone Soil | MTTRSRLRVFRFADYESTTISKKALCQLQDREAQERGARNLQEPAP* |
| Ga0137362_101843694 | 3300012205 | Vadose Zone Soil | VTTRRPLRVSHFADYESTTISKKTLCELQDREAQERGARDLQKP |
| Ga0137362_102393834 | 3300012205 | Vadose Zone Soil | LSPKVTTRSPLRVFRLADYESTTISKKALCQLQDREAQERGARDLQEPAP* |
| Ga0137380_111129031 | 3300012206 | Vadose Zone Soil | MTTRRCLRVFHFADYESTTISEKALCQLQDREAQERRARHLQEPAPQTAAGVEME* |
| Ga0137381_108036853 | 3300012207 | Vadose Zone Soil | MTARSCLRVFRFADYESTTISKKTLCQLQDCEAQKRGARDLQKPAPQTAPGMTTPRKIDI |
| Ga0137376_100909954 | 3300012208 | Vadose Zone Soil | MTTRSQARVFQFADYESTTISKKTLCQLQDREAQERAARNLQKPAP* |
| Ga0137376_102310294 | 3300012208 | Vadose Zone Soil | MTTRRCLRVFHFADYESTTISKKTLCQLQDREAQE |
| Ga0137379_103769553 | 3300012209 | Vadose Zone Soil | SHFADYESTTISKKTLCELQDREAQERGARDLQEPAP* |
| Ga0137379_104765152 | 3300012209 | Vadose Zone Soil | MTTRRCLRVFRFADYESTTISEKALCQLQDREAQERGARDL |
| Ga0137378_1000031735 | 3300012210 | Vadose Zone Soil | MTTRSQLRVFHFADYESTTISKKALCQLQDREAQERGARDLQKPAP* |
| Ga0137378_101587924 | 3300012210 | Vadose Zone Soil | RVSHLADYESKTISKKALGQLQEREAQERGSPELQKPAP* |
| Ga0137377_1000085223 | 3300012211 | Vadose Zone Soil | ADYESTTISKKALCQLQDREAQERGARDLQKPAP* |
| Ga0137370_103510591 | 3300012285 | Vadose Zone Soil | RVSHFADYESTTISKKTLCELQDREAQERSARDLQKPAP* |
| Ga0137370_109630143 | 3300012285 | Vadose Zone Soil | MMTRLPRVFHFADYESTTISKKTLCELQDREAQERCARD |
| Ga0137387_101518071 | 3300012349 | Vadose Zone Soil | KMTTRSSLRVFHFADYESTTISEKALCQLQDREAQECGARDLQEPAP* |
| Ga0137372_101899011 | 3300012350 | Vadose Zone Soil | LRVFHFADYESTTISKKTLCQLQDREAQERAARDLQKPAP* |
| Ga0137372_102197101 | 3300012350 | Vadose Zone Soil | RLADYESTTISKKALCQLQDREAQERGARDLQEPAP* |
| Ga0137367_104007513 | 3300012353 | Vadose Zone Soil | MTTRSRLRVFRFADYESTTISKKALCQLQDREAQERGAR |
| Ga0137367_105308203 | 3300012353 | Vadose Zone Soil | VFPFADYESTTISKKTLCQLQDCEAQKRGARDLQKPAPQTAPGMTTPRKIDI* |
| Ga0137366_1001138513 | 3300012354 | Vadose Zone Soil | MTTRSPLRVFRLADYESTTISKKALCQLQDREAQERGARDLQEPAP |
| Ga0137366_101945211 | 3300012354 | Vadose Zone Soil | RVFRLADYESTTISKKALCQLQDREAQERGARDLQEPAP* |
| Ga0137384_100107514 | 3300012357 | Vadose Zone Soil | MTTRSRLRVFHFADYESTTISKKALCQLQDREAQERGARDLQKPAP* |
| Ga0137384_114503021 | 3300012357 | Vadose Zone Soil | VFHFADYESTTISKKTLCELQDREAQERCARDLQEPAP* |
| Ga0137385_100585635 | 3300012359 | Vadose Zone Soil | MTTRSSLRVFHFADYESTTISEKALCQLQDREAQECGARDLQEPAP* |
| Ga0137385_103382623 | 3300012359 | Vadose Zone Soil | AAAVFDFADYESTTISKKTLCQLQDREAQERVARDLQKPAP* |
| Ga0137385_104495823 | 3300012359 | Vadose Zone Soil | FADYESTTISKKTLCELQDREAQERAARDLQKPAP* |
| Ga0137385_108212403 | 3300012359 | Vadose Zone Soil | VTTRRTLHVSRFADYESTTISKKTLCELQDREAQERGARDLQ |
| Ga0137375_108127001 | 3300012360 | Vadose Zone Soil | MTTRRPLRVFRFADYESTTISKKALCQLQDREAQECGACDLQEPA |
| Ga0137360_109618721 | 3300012361 | Vadose Zone Soil | RFHFADYESTTISKKTLCQLQDREAQKCAARDLQKPAP* |
| Ga0137390_101167714 | 3300012363 | Vadose Zone Soil | MTARICLRIFRFADYESTTISKKTLCQLQDCEAQKRGARDLQKPAPQTAPGMTTPRKIDI |
| Ga0134025_10354283 | 3300012378 | Grasslands Soil | ANYLSPKVTTRSQLRVFRLADYESTTISKKALCQLQDREAQECGARDLQEPAP* |
| Ga0134024_11843052 | 3300012404 | Grasslands Soil | RSRLRVFRLADYESTTISKKALCQLQDREAQERGARDLQEPAP* |
| Ga0150984_1031916433 | 3300012469 | Avena Fatua Rhizosphere | MMTGRAAAVFDFADYESTTISKKALCQLQDREAQERAARDLQEPS |
| Ga0137373_104468601 | 3300012532 | Vadose Zone Soil | RLADYESTTISKKALCQLQDREAQERGARNLQEPAP* |
| Ga0137358_104122653 | 3300012582 | Vadose Zone Soil | ADYESTTISEKALCQLQDREAQECGTRDLQKPAS* |
| Ga0137358_109816772 | 3300012582 | Vadose Zone Soil | VFHFADYESTTISKKTLCQLQDREAQERGARDLQKPAP* |
| Ga0157281_10521242 | 3300012883 | Soil | YVSPKMTTRSRLRVFHFADYESTTISEKALCELQDREAQERGARDLQKPAP* |
| Ga0157287_10242701 | 3300012885 | Soil | MTTRRAAAVFDFANYESTTISKKNLCELQDRETQERIAHDLQKPAP* |
| Ga0137396_100796413 | 3300012918 | Vadose Zone Soil | MTTRGPLRVFRLADYESTTIGKKALCQLQNREAQERGTRDLQEPAS* |
| Ga0137396_102608471 | 3300012918 | Vadose Zone Soil | EGANYLSPKMTTGRPVVVHFADYESTTISKKTLCELQDREAQERGARDLQESAP* |
| Ga0137394_115470441 | 3300012922 | Vadose Zone Soil | RVFHFADYESKTISKKALCQLQDREAQERGARDLQKPAP* |
| Ga0137359_101659653 | 3300012923 | Vadose Zone Soil | MTTRTCLRVFRFADYESTTISKKTLCQLQDREAQKRGARDLQEPAP* |
| Ga0137419_101052764 | 3300012925 | Vadose Zone Soil | RVFRLVDYESTTISKKTLCELQDCEAQKRGARDLQEPAP* |
| Ga0137404_100953196 | 3300012929 | Vadose Zone Soil | FHFADYESTTISKKTLCQLQDREAQERVARDLQKPAP* |
| Ga0137404_121047082 | 3300012929 | Vadose Zone Soil | FADYESTTISKKTLCQLQDREAQKRGARDLQEPAP* |
| Ga0126375_104244133 | 3300012948 | Tropical Forest Soil | TRSWLRVFHFADYESTTISKTALCQLQDREAQERAARDLQEPAP* |
| Ga0126369_104548393 | 3300012971 | Tropical Forest Soil | MTTRRAAAVFDFANYESTTISKKTLCELQDREAQERCARDLQKPAA* |
| Ga0126369_109931881 | 3300012971 | Tropical Forest Soil | MTTRSWLRVFHFADYESTTISKTALCQLQDREAQERGARDLQEP |
| Ga0134076_103755312 | 3300012976 | Grasslands Soil | GPLRVFRLVDYESTTISKKALCQLQDREAQECGARDLQEPAP* |
| Ga0134081_100534231 | 3300014150 | Grasslands Soil | SPKVTTRSQLRVFRLADYESTTISKKALCQLQDREAQECGARDLQEPAP* |
| Ga0134079_100403313 | 3300014166 | Grasslands Soil | MTTRRCLRVFHFADYESTTISQETLCQLQDREAQERGAGDLQEPAP* |
| Ga0137418_100312411 | 3300015241 | Vadose Zone Soil | FADYESTTISKKTLCQLQDREAQERVARDLQKPAP* |
| Ga0137409_104886682 | 3300015245 | Vadose Zone Soil | MTTRSRLRIFHFADYESKTISKKALCQLQDREAQERGARDLQKPAP* |
| Ga0134073_100504343 | 3300015356 | Grasslands Soil | MTTRKQARVFHFADYESTTISKKTLCELQDREAQERCARDLQEPAP* |
| Ga0134073_101121611 | 3300015356 | Grasslands Soil | QARVFHFADYESTTISKKTLCELQDCEAQERGARDLHEPAP* |
| Ga0132258_107045266 | 3300015371 | Arabidopsis Rhizosphere | HFADYESTTISEKALCQLQDREAQERGARDLQKPAP* |
| Ga0132258_121774764 | 3300015371 | Arabidopsis Rhizosphere | MTARSRLRVFHFADYESTTISEKALCQLQDREAQERGARDLQK |
| Ga0132258_129932664 | 3300015371 | Arabidopsis Rhizosphere | MTTRSRLRVFHFADYESTTISEKALCQLQDREAQERGARDLQK |
| Ga0132255_1057268982 | 3300015374 | Arabidopsis Rhizosphere | LSPKMTTRLAAAVFDFANYESTTISKKALCQLQDRETQERGARDLQEPAA* |
| Ga0182041_115954082 | 3300016294 | Soil | FDFANYESTTISKKTLCELQDREAQERCARDLQKPAA |
| Ga0182032_106914713 | 3300016357 | Soil | NYLSPKMTTRRAAAVFDFANYESTTISEKTLCELQDREAQERCARDLQKPAA |
| Ga0182037_101237441 | 3300016404 | Soil | VTTRRAAAVFDFANYESTTISKKTLCELQDCEAQERRARDLQKPA |
| Ga0134112_101892303 | 3300017656 | Grasslands Soil | TAQRPCVFHFVDYESTTISKKTLCQLQDRQAQERCARDLQEPAP |
| Ga0134083_103880031 | 3300017659 | Grasslands Soil | HFADYESTTISKKALCQLQDRETQERGAGDLQKPAP |
| Ga0163161_120067802 | 3300017792 | Switchgrass Rhizosphere | MTTRSRLRVFHFADYESTTISEKALCQLQDREAQERGARDLQKPAP |
| Ga0184605_102225912 | 3300018027 | Groundwater Sediment | MITRRLPRIFDFADYESTTISKKTLCQLQDREAQKRAARDLQKPAP |
| Ga0184634_102160333 | 3300018031 | Groundwater Sediment | MTTRRAAAVFDFANYESTTISKKTLCELQDCEAQERGARDLQKPAP |
| Ga0184620_103383981 | 3300018051 | Groundwater Sediment | RSRLRVFHFADYESTTISEKALCQLQDREAQERGARDLQKPAP |
| Ga0184621_100073763 | 3300018054 | Groundwater Sediment | MTTRRRLRVFHFADYESTTISKKTLCKLQDREAQERGARDLQKSAP |
| Ga0184609_100708513 | 3300018076 | Groundwater Sediment | MTTRNQARVFHFADYESTTISEKALCQLQDREAQERGARDLQKPAP |
| Ga0066655_100024684 | 3300018431 | Grasslands Soil | MTTWSRLRVFRFADYESTTIGKKTLCQLQDRKAQERGARGLQKPAP |
| Ga0066655_100428672 | 3300018431 | Grasslands Soil | MTTRSSLRVFRFANYESTTIGKKALCELQDREAQERGARDLQKPAP |
| Ga0066655_103313812 | 3300018431 | Grasslands Soil | MTTRSRLRVFRLADYESTTISKKALCQLQDREAQERGARDLQEPAP |
| Ga0066655_106102321 | 3300018431 | Grasslands Soil | SHFADYESTTISKKTLCQLQDREAQERVARDLQKPAP |
| Ga0066667_101356801 | 3300018433 | Grasslands Soil | LSPKMMTRLPRVFHFADYESTTISKKTLCQLQDREAQERCARDLQEPAP |
| Ga0066667_101412934 | 3300018433 | Grasslands Soil | MTTRRPLRVSYFADYESTTISKKTLCELQDREAQERAARDLQK |
| Ga0066667_105730993 | 3300018433 | Grasslands Soil | MMTRRAAAVLDFANYESTTISKKTLCQLQDREAQERRARDLQEPAP |
| Ga0066667_108461621 | 3300018433 | Grasslands Soil | RVSYFADYESTTISKKTLCELQDREAQERRARDLQKPAP |
| Ga0066667_108473171 | 3300018433 | Grasslands Soil | SRFRVFSRACGTDYESTTISKKALCQLQDREAQECAARNLQKPAP |
| Ga0066662_117321022 | 3300018468 | Grasslands Soil | MTAQRPCVFHFVDYESTTISKKTLCELQDREAQERGARDLQEPAP |
| Ga0066669_100589141 | 3300018482 | Grasslands Soil | MTTWSRLRVVRFADYESTTIGKKTLCQLQDRKAQERGARGLQKPAP |
| Ga0066669_103665232 | 3300018482 | Grasslands Soil | MMTRLPRVFHFADYESTTISKKTLCQLQDREAQERCARDLQEPAP |
| Ga0066669_105192983 | 3300018482 | Grasslands Soil | HFADYESTTISKKTLCQLQDRETQERIARDLQKPAP |
| Ga0066669_111217821 | 3300018482 | Grasslands Soil | MTTRNQARVFHFADYESTTISKKTLCQLQDREAQER |
| Ga0066669_118222101 | 3300018482 | Grasslands Soil | VPRFHFADYESTTISKKTLCQLQDRETQERIARDLQKPAP |
| Ga0184644_11792471 | 3300019269 | Groundwater Sediment | RLRVFHFADYESTTISEKALCQLQDREAQERGARDLQKPAP |
| Ga0173481_104735621 | 3300019356 | Soil | SPKMTTRSRLRVFHFADYESTTISEKALCQLQDREAQERGARDLQKPAP |
| Ga0137408_10267261 | 3300019789 | Vadose Zone Soil | FHFADYESTTISEKALCQLQDREAQERGARDLQKPAP |
| Ga0193756_10428852 | 3300019866 | Soil | FPLADYESTTISKKALCQLQDREAQERGARDLQKPAP |
| Ga0193744_10025936 | 3300019874 | Soil | MTTRSRLRVFHFADYESTTISEKALCQLQDREAQERGARDLQKPAA |
| Ga0193722_10114165 | 3300019877 | Soil | MTTRSRLRVFPLADYESTTISKKALCQLQDREAQERGARDLQEPAP |
| Ga0193722_10145311 | 3300019877 | Soil | MTTRNQARVFHFADYESTTISKKTLCQLQDREAQERVARDLQEPAP |
| Ga0193707_100133012 | 3300019881 | Soil | MTTRSRLRVFHFADYESKTISKKALCQLQDREAQERGARDLQKPAP |
| Ga0193707_10034164 | 3300019881 | Soil | MTTRSRLRVFRFADYESTTISKKALCQLQDREAQERGARDLQEPAP |
| Ga0193747_100040816 | 3300019885 | Soil | MTTRSRLRIFHFADYESKTISKKTLCQLQDREAQERGARDLQKPAP |
| Ga0193751_10110761 | 3300019888 | Soil | VFHFADYESTTISKKTLCQLQDREAQERGARDLQKPAP |
| Ga0193751_10247242 | 3300019888 | Soil | MTTRSRLRVFRFADYESTTISKKALCQLQDRQAQERGARDLQEPAP |
| Ga0193710_10048701 | 3300019998 | Soil | FADYESTPSSEKALCQLQDREAQERGARDLQKPAP |
| Ga0193735_100021519 | 3300020006 | Soil | MITRRPPRVLNFADYESTTISKKTLCQLQDREAQERIARDLQKPAP |
| Ga0193735_10046171 | 3300020006 | Soil | VLRVFRLVDYESTTISKKTLCKLQDREAQKRGARDLQEPAP |
| Ga0193757_10220851 | 3300020008 | Soil | KMTTRSRLRVFHFADYESTTISKKALCQLQDREAQERGARDLQKPAP |
| Ga0193749_10787182 | 3300020010 | Soil | FLFADYESTTISKKTLCQLQDRETQERIARDLQKPAP |
| Ga0193721_10313323 | 3300020018 | Soil | MTTRSRLRVFRFADYESTTISKKALCQLQDREAQERGARDLQESAP |
| Ga0193733_11262631 | 3300020022 | Soil | RDYYESTTISKKTLCQLQDRKAQECCARDLQEPAP |
| Ga0193745_10160811 | 3300020059 | Soil | FADYESTTISKKTLCQLQDREAQERGARDLQKPAP |
| Ga0179594_103380841 | 3300020170 | Vadose Zone Soil | TRTYLRVFHFADYESTTISKKTLCQLQDREAQERGARDLQKPAP |
| Ga0210382_102219621 | 3300021080 | Groundwater Sediment | RTYLRVFHFADYESTTISKKTLCQLQDREAQERGARDLQKPAP |
| Ga0179596_104467983 | 3300021086 | Vadose Zone Soil | MMTRLPRVFHFADYESTTISKKTLCELQDREAQERCARDLQEPAP |
| Ga0210408_108917101 | 3300021178 | Soil | MTTRSRLRVFYFADYESTTISKKALCQLQDREAQERGARDLQKPA |
| Ga0193719_1000083117 | 3300021344 | Soil | MTTRRYLRVFRFADYESTTISEKALCQLQDREAQERGARDLQEPAP |
| Ga0193719_100061265 | 3300021344 | Soil | MMTRSSLRVFSRTCGTDYESTTISKKTLCQLQNSEAQERCARDLQEPAP |
| Ga0193709_11000452 | 3300021411 | Soil | RLRVFPLADYESTTISKKALCQLQDREAQERGARDLQEPAP |
| Ga0126371_116639582 | 3300021560 | Tropical Forest Soil | MTTRRAAAVFDFANYESTTISKKTLCELQDREAQERCARDLQKPAA |
| Ga0222624_10286381 | 3300021951 | Groundwater Sediment | PKMTTRSRLRVFHFADYESTTISEKALCQLQDREAQERGARDLQKPAA |
| Ga0224452_11205361 | 3300022534 | Groundwater Sediment | RVFRLADYESTTISKKALCQLQDREAQERGARDLQEPAP |
| Ga0222623_101444891 | 3300022694 | Groundwater Sediment | PQVTTRRTLHVSHFADYESTTIGKKTLCELQDREAQERGARDLQKPAP |
| Ga0222623_103199593 | 3300022694 | Groundwater Sediment | VTTRRPLGVSHFADYESTTLSKKTLCELQDREAQERGARDLQEP |
| Ga0222622_100957424 | 3300022756 | Groundwater Sediment | TTRSRLRVFHFADYESTTISEKALCQLQDREAQERGARDLQKPAP |
| Ga0247661_10630333 | 3300024254 | Soil | MTTRRAAAVFNFANYESTTISKKTLCQLQDREAQERGARDLQEPAP |
| Ga0207710_107779631 | 3300025900 | Switchgrass Rhizosphere | ERANYVSPKMTTRSRLRVFHFADYESTTISKEALCQLQDREAQERGARDLQKPAP |
| Ga0207699_114249602 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MTTRSRLRVFHFADYESTTISKKALCQLQDREAQERGARDLQEPAP |
| Ga0207684_101616692 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MMTRLPRVFHFADYESTTISKKTLCELQDSEAQERCARDLQEPAP |
| Ga0207684_103725872 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MTTRPPRVFDFADYESTTISKKTLCQLQDREAQERCARDLQESAP |
| Ga0207684_108192253 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | RVFRFADYESTTISKKTLCQLQDCEAQKRGARDLQKPAPQTAPGMTTPRQIDI |
| Ga0207684_110734833 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MTTRTCLRVFRFADYESTTISQKTLCQLQDCEAQKRGARDLQKPAPQTAPGMTTPRQIDI |
| Ga0207646_101179894 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MTARTCLRVFRFADYESTTISKKTLCQLQDCEAQKRGARDLQKPAPQTAPGMTTPRQIDI |
| Ga0207700_109954861 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | LRVSHFADYESTTISKKTLCQLQDREAQERGARDLQEPAP |
| Ga0207665_100550843 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MTTRSRLRVFRLADYESTTISKKALCQLQDREAQERGARDLQKPAP |
| Ga0207677_101471884 | 3300026023 | Miscanthus Rhizosphere | LRVFHFADYESTTISEKALCQLQDREAQERGARDLQKPAP |
| Ga0209469_10262953 | 3300026307 | Soil | MTTRRPLRVSYFADYESTTISKKTLCELQDREAQERRARDLQKPAP |
| Ga0209265_12184262 | 3300026308 | Soil | RVVRFADYESTTIGKKTLCQLQDRKAQERGARGLQKPAP |
| Ga0209055_10409581 | 3300026309 | Soil | VSHFADYESTTISKKTLCQLQDREAQERVARDLQKPAP |
| Ga0209268_10548244 | 3300026314 | Soil | MTTRSSLRVLHFADYESTTISEKALCQLQDREAQE |
| Ga0209268_11577352 | 3300026314 | Soil | VHFADYESTTISKKTLCELQDREAQECRARDLQEPAP |
| Ga0209154_10230851 | 3300026317 | Soil | MTARTCLRVFRFADYESTTISKKTLCQLQDCEAQKRGARDLQKPAPQTAPGMTTPRKID |
| Ga0209472_10121955 | 3300026323 | Soil | MTTRSRFRVFFRACGTDYESTTISKKALCQLQDREAQECAARNLQKPAP |
| Ga0209470_10077252 | 3300026324 | Soil | MTTRSRLRVFHFADYESTTISKKALCQLQDRETQERGAGDLQKPAP |
| Ga0209470_10229195 | 3300026324 | Soil | MTAQRPCVFHFVDYESTTISKKTLCQLQDRQAQERCARDLQEPAP |
| Ga0209266_10342475 | 3300026327 | Soil | GDVPRFHFADYESTTISKKTLCQLQDRETQERIARDLQKPAP |
| Ga0209267_11564181 | 3300026331 | Soil | VTTRRPLGVSHFADYESTTLGKKTLCELQDREAQERGARDLQ |
| Ga0209158_10399164 | 3300026333 | Soil | MTARTCLRVFRFADYESTTLSKKTLCQLQDCEAQKRGARDLQKPAPQTAPGMTTPRKIDI |
| Ga0209377_13095971 | 3300026334 | Soil | MITRRPPRVFNFADYESTTISKKTLCQLQDRETQERIARDLQKPAP |
| Ga0209159_10046432 | 3300026343 | Soil | MTTRRPLRVSHFADYESTTISKKTLCQLQDREAQERGARDLQKPTS |
| Ga0209159_10567524 | 3300026343 | Soil | FHFADYESTTISKKTLCQLQDRETQERIARDLQKPAP |
| Ga0209159_10964881 | 3300026343 | Soil | VFHFADYESTTISKETLCQLQDREAQERGARDLQEPAP |
| Ga0257163_10031794 | 3300026359 | Soil | MTTRSRIRVFPLADYESTTISKKALCQLQDREAQERGARDLQEPAP |
| Ga0257171_10702301 | 3300026377 | Soil | TRRTLRVSHFADYESTTISKKTLCQLQDREAQERGARDLQKPAP |
| Ga0257177_10804972 | 3300026480 | Soil | VTTRRTLRVSHFADYESTTISKKTLCQLQDREAQERGARDLQKPAPQTAPGMTAPRKIDI |
| Ga0209808_10340424 | 3300026523 | Soil | MTTWSSLRVFRFANYESTTIGKKALCQLQDREAQECGARDLQKPAP |
| Ga0209690_10191611 | 3300026524 | Soil | GANYLSPKMTAQRPCVFHFVDYESTTISKKTLCQLQDRQAQERCARDLQEPAP |
| Ga0209807_10552152 | 3300026530 | Soil | MMTRSSLHVFSRTCGTDYESTTISKKTLCELQDREAQERFARDLQEPAP |
| Ga0209160_10517642 | 3300026532 | Soil | MTTRRPLRVSYFADYESTTISKKTLCELQDREAQERAARDLQKPAP |
| Ga0209157_10815401 | 3300026537 | Soil | VFPFADYESTTISKKTLCQLQDRETQERIARDLQKPAP |
| Ga0209056_100007817 | 3300026538 | Soil | MMTRRAAAVLDFANYESTTISKKTLCQLQDRETQECGPRDLQKPAP |
| Ga0209376_12574801 | 3300026540 | Soil | YLSPKMMTRLPRVFHFADYESTTISKKTLCQLQDCEAQERCARDLQEPAP |
| Ga0209161_100257127 | 3300026548 | Soil | MTTWSRLRVFRFADYESTTIGKKTMCQLQDRKAQERGARGLQKPAP |
| Ga0209577_1000319716 | 3300026552 | Soil | MTTRSRFRVFSRACGTDYESTTISKKALCQLQDREAQECAARHLQKPAP |
| Ga0207566_1034793 | 3300026773 | Soil | MTTQRAAAVFDFANYESTTISKKALCQLQDREAQERGARDLQKPAP |
| Ga0208072_1002235 | 3300026791 | Soil | MTTRSRLRVFHFADYESTTISEKALCQLQDREAQERGARDLQEPAP |
| Ga0208475_10011402 | 3300027018 | Soil | MTTRSRLRVFHFADYESTTISKKALCQLQDREAQECGSRDL |
| Ga0209117_11415552 | 3300027645 | Forest Soil | GAISWINYESTTIGKKTLCELQDRETQERRARDLQEPAP |
| Ga0209626_12228711 | 3300027684 | Forest Soil | MTTRSRLRVFRLADYESTTISKKTLCQLQNREAQERGARDLQEPAP |
| Ga0209689_13566121 | 3300027748 | Soil | MTARTCLRVFRFADYESTTISKKTLCQLQDCEAQKRGARDLQKPAPQTAPGMT |
| Ga0209180_100730684 | 3300027846 | Vadose Zone Soil | FADYESTTISKKTLCELQDREAQERGARDLQKPAP |
| Ga0209180_105741761 | 3300027846 | Vadose Zone Soil | MTTQRPCVFHFVDYESTTIGKKTLCELQDREAQERAARDLQKPAPQT |
| Ga0209590_100638674 | 3300027882 | Vadose Zone Soil | MTARTCLRVFRFADYESTTISKKTLCQLQDCEAQKRGARDLQKPAPQTAPGMTTPRKINI |
| Ga0137415_100121358 | 3300028536 | Vadose Zone Soil | MTTRSPLRVFRLVNYESTTIGKKALCQLQNREAQERGTRDLQEPAS |
| Ga0137415_101436434 | 3300028536 | Vadose Zone Soil | MTMRNQARVFHFADYESTTISKKTLCQLQDREAQERVARDLQKPAP |
| Ga0307298_101193031 | 3300028717 | Soil | MTTRRAATVFDFANYESTTISKKNLCQLQDCEAQERCARDLQKPA |
| Ga0307299_101603793 | 3300028793 | Soil | NQARVFHFADYESTTISKKTLCQLQDREAQERVARDLQEPAP |
| Ga0307296_107293021 | 3300028819 | Soil | MTTRNQARVFHFADYESTTISKKTLCQLQDREAQERVAR |
| Ga0307312_100371217 | 3300028828 | Soil | RSRLRVFRLADYESTTISKKNLCQLQDREAQERGARDLQEPAP |
| Ga0307312_104541783 | 3300028828 | Soil | TRSSLRVFHFADYESTTISKKTLCQLQDREAQERGARDLQKPAP |
| Ga0307289_103072521 | 3300028875 | Soil | MTTRRAAAVFCFANYESTTISKKNLCQLQDCKAQERCARDLQKP |
| Ga0307278_100086655 | 3300028878 | Soil | MTTRSRLRVFHFADYESTTISKKALCQLQDREAQECGACDLQEPPP |
| Ga0307304_105802291 | 3300028885 | Soil | RVFHFADYESTTISEKALCQLQDREAQERGARDLQKPAP |
| Ga0247827_100668242 | 3300028889 | Soil | MTTRRAAAVFDFANYESTTISKKTLCELQDREAQDRGARDLQKPAP |
| Ga0268253_101564173 | 3300030514 | Agave | VDFAVYESTTISKKALCQLQDREAQERGARDLQEPAP |
| Ga0138303_10384284 | 3300030939 | Soil | QGANYLSPKMTTRSRLRVFRLADYESTTISKKALCQLQDREAQERGARDLQEPAP |
| Ga0075400_119057273 | 3300030972 | Soil | MTTRRAAVVFDFANYESKTISEKNLCELQDCEAQERCARDLQKP |
| Ga0075371_117859982 | 3300030974 | Soil | MTRTCLRVFHFADYESKTISKKTLCQLQDREAQERGARDLQKPAP |
| Ga0068589_116847542 | 3300030979 | Soil | MTTRRAAAVFDFANYESTTISKKTLCELQDCETQERRARDLQEPAP |
| Ga0170834_1007630002 | 3300031057 | Forest Soil | MITRRLPRIFDFADYESTTISKKTLCQLQDREAQKRAARDLQKPAS |
| Ga0170823_142756443 | 3300031128 | Forest Soil | MTTRSRLRVFRLSDYESTTISKKALCQLQNREAQERGARDLQEPAP |
| Ga0170824_1001634083 | 3300031231 | Forest Soil | MITRSRLRVFRLADYESTTISKKALCQLQDREAQERGARDL |
| Ga0170824_1058854161 | 3300031231 | Forest Soil | MITRRPPRVFNFADYESTTISKKTLCQLQDREAQERGARYL |
| Ga0170824_1059640842 | 3300031231 | Forest Soil | FHFADYESTTISKKTLCQLQDRETQKRIARDLQKPAP |
| Ga0170824_1155611421 | 3300031231 | Forest Soil | YVSPKVTTRTCLRVFHFADYESKTISKKTLCQLQDRETQKRVARDLQKPAP |
| Ga0310813_107664021 | 3300031716 | Soil | RLRVFHFADYESTTISKKALCQLQDREAQERGARDLQKPAP |
| Ga0306917_109658511 | 3300031719 | Soil | MTTRRAAAVFDFANYESTTISEKTLCELQDREAQERCARDLQKPAA |
| Ga0307469_113826162 | 3300031720 | Hardwood Forest Soil | LRVFHFADYESTTISKKTLCQLQDREAQERGARDLQKPAP |
| Ga0310910_105291423 | 3300031946 | Soil | RANYLSPKMTTRRAAAVFDFANYESTTISKKTLCELQDREAQERCARDLQKPAA |
| Ga0318533_113746031 | 3300032059 | Soil | QRGDVPRFHFADYESTTISKKTLCQLQDRETQKRIARDLQKPAP |
| Ga0307471_1000001305 | 3300032180 | Hardwood Forest Soil | MTTRSRVRVFRLADYESTTISKKALCQLQDREAQERSARDLQEPAP |
| Ga0310810_100955745 | 3300033412 | Soil | MTTRSRLRVFHFADYESTTISKKTLCQLQDREAQECGSRDLQEPAS |
| Ga0310810_106013443 | 3300033412 | Soil | MTTRRAAAVFDFANYESTTISKETLCELQDCEAQERGARDLQKPA |
| Ga0310811_104945904 | 3300033475 | Soil | MTTRSRLRVFHFADYESTTISEKALCQLQDREAQERG |
| ⦗Top⦘ |