


| Basic Information | |
|---|---|
| Family ID | F007703 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 346 |
| Average Sequence Length | 39 residues |
| Representative Sequence | MKRRELMLLLGGAMTAARALRAQQKAMPVIGYLSG |
| Number of Associated Samples | 200 |
| Number of Associated Scaffolds | 346 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 90.48 % |
| % of genes near scaffold ends (potentially truncated) | 92.77 % |
| % of genes from short scaffolds (< 2000 bps) | 91.91 % |
| Associated GOLD sequencing projects | 182 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.38 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (69.075 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (41.330 % of family members) |
| Environment Ontology (ENVO) | Unclassified (48.844 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (45.665 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 44.44% β-sheet: 0.00% Coil/Unstructured: 55.56% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 346 Family Scaffolds |
|---|---|---|
| PF04392 | ABC_sub_bind | 50.87 |
| PF05016 | ParE_toxin | 1.45 |
| PF13561 | adh_short_C2 | 1.16 |
| PF00211 | Guanylate_cyc | 1.16 |
| PF00378 | ECH_1 | 1.16 |
| PF01850 | PIN | 1.16 |
| PF04365 | BrnT_toxin | 0.87 |
| PF02604 | PhdYeFM_antitox | 0.87 |
| PF07369 | DUF1488 | 0.87 |
| PF01402 | RHH_1 | 0.87 |
| PF14384 | BrnA_antitoxin | 0.87 |
| PF13470 | PIN_3 | 0.58 |
| PF13362 | Toprim_3 | 0.58 |
| PF01436 | NHL | 0.58 |
| PF02775 | TPP_enzyme_C | 0.58 |
| PF14497 | GST_C_3 | 0.58 |
| PF01381 | HTH_3 | 0.58 |
| PF00239 | Resolvase | 0.58 |
| PF04828 | GFA | 0.58 |
| PF07883 | Cupin_2 | 0.58 |
| PF04255 | DUF433 | 0.29 |
| PF13730 | HTH_36 | 0.29 |
| PF06186 | DUF992 | 0.29 |
| PF13847 | Methyltransf_31 | 0.29 |
| PF13379 | NMT1_2 | 0.29 |
| PF14373 | Imm_superinfect | 0.29 |
| PF00155 | Aminotran_1_2 | 0.29 |
| PF01738 | DLH | 0.29 |
| PF02900 | LigB | 0.29 |
| PF05168 | HEPN | 0.29 |
| PF13701 | DDE_Tnp_1_4 | 0.29 |
| PF01609 | DDE_Tnp_1 | 0.29 |
| PF02371 | Transposase_20 | 0.29 |
| PF05199 | GMC_oxred_C | 0.29 |
| PF13518 | HTH_28 | 0.29 |
| PF01909 | NTP_transf_2 | 0.29 |
| PF00005 | ABC_tran | 0.29 |
| PF01408 | GFO_IDH_MocA | 0.29 |
| PF00296 | Bac_luciferase | 0.29 |
| PF13560 | HTH_31 | 0.29 |
| PF13751 | DDE_Tnp_1_6 | 0.29 |
| PF06689 | zf-C4_ClpX | 0.29 |
| PF00881 | Nitroreductase | 0.29 |
| PF04014 | MazE_antitoxin | 0.29 |
| PF05292 | MCD | 0.29 |
| PF00009 | GTP_EFTU | 0.29 |
| PF03928 | HbpS-like | 0.29 |
| PF01370 | Epimerase | 0.29 |
| PF03358 | FMN_red | 0.29 |
| PF07519 | Tannase | 0.29 |
| PF13495 | Phage_int_SAM_4 | 0.29 |
| PF07798 | CCDC90-like | 0.29 |
| COG ID | Name | Functional Category | % Frequency in 346 Family Scaffolds |
|---|---|---|---|
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 50.87 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 1.16 |
| COG2161 | Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family | Defense mechanisms [V] | 0.87 |
| COG2929 | Ribonuclease BrnT, toxin component of the BrnT-BrnA toxin-antitoxin system | Defense mechanisms [V] | 0.87 |
| COG4118 | Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor | Defense mechanisms [V] | 0.87 |
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.58 |
| COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 0.58 |
| COG3791 | Uncharacterized conserved protein | Function unknown [S] | 0.58 |
| COG1895 | HEPN domain protein, predicted toxin of MNT-HEPN system | Defense mechanisms [V] | 0.29 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.29 |
| COG2250 | HEPN domain protein, predicted toxin of MNT-HEPN system | Defense mechanisms [V] | 0.29 |
| COG2303 | Choline dehydrogenase or related flavoprotein | Lipid transport and metabolism [I] | 0.29 |
| COG2442 | Predicted antitoxin component of a toxin-antitoxin system, DUF433 family | Defense mechanisms [V] | 0.29 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.29 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.29 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.29 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.29 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.29 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.29 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.29 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 69.08 % |
| Unclassified | root | N/A | 30.92 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459013|GO6OHWN02HACU8 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 514 | Open in IMG/M |
| 2170459016|G1P06HT02JIK0E | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300000956|JGI10216J12902_112864455 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Tv2a-2 | 595 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100914979 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Ec3.3 | 760 | Open in IMG/M |
| 3300004080|Ga0062385_10454309 | Not Available | 779 | Open in IMG/M |
| 3300004152|Ga0062386_100811852 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 771 | Open in IMG/M |
| 3300004635|Ga0062388_100021943 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3734 | Open in IMG/M |
| 3300005187|Ga0066675_10375860 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1044 | Open in IMG/M |
| 3300005332|Ga0066388_103728131 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
| 3300005332|Ga0066388_105180609 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 662 | Open in IMG/M |
| 3300005363|Ga0008090_15088022 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 913 | Open in IMG/M |
| 3300005363|Ga0008090_15494436 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 719 | Open in IMG/M |
| 3300005435|Ga0070714_100916943 | All Organisms → cellular organisms → Bacteria | 851 | Open in IMG/M |
| 3300005437|Ga0070710_10269050 | All Organisms → cellular organisms → Bacteria | 1101 | Open in IMG/M |
| 3300005535|Ga0070684_102045854 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 540 | Open in IMG/M |
| 3300005557|Ga0066704_10461162 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Chroococcales | 839 | Open in IMG/M |
| 3300005559|Ga0066700_10824596 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 623 | Open in IMG/M |
| 3300005574|Ga0066694_10336826 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 716 | Open in IMG/M |
| 3300005575|Ga0066702_10674182 | Not Available | 617 | Open in IMG/M |
| 3300005598|Ga0066706_10767434 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 763 | Open in IMG/M |
| 3300005764|Ga0066903_103942116 | All Organisms → cellular organisms → Bacteria | 796 | Open in IMG/M |
| 3300005764|Ga0066903_105025892 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 701 | Open in IMG/M |
| 3300005764|Ga0066903_107695808 | Not Available | 555 | Open in IMG/M |
| 3300005993|Ga0080027_10349832 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Tv2a-2 | 592 | Open in IMG/M |
| 3300006175|Ga0070712_100220091 | Not Available | 1502 | Open in IMG/M |
| 3300006954|Ga0079219_11017200 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 690 | Open in IMG/M |
| 3300007255|Ga0099791_10179696 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 994 | Open in IMG/M |
| 3300007265|Ga0099794_10594701 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 586 | Open in IMG/M |
| 3300009012|Ga0066710_102255760 | All Organisms → cellular organisms → Bacteria | 793 | Open in IMG/M |
| 3300009089|Ga0099828_11313872 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300009143|Ga0099792_10857583 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300009792|Ga0126374_10957284 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 668 | Open in IMG/M |
| 3300009792|Ga0126374_11645187 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 532 | Open in IMG/M |
| 3300010046|Ga0126384_11248944 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
| 3300010047|Ga0126382_10272901 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1253 | Open in IMG/M |
| 3300010048|Ga0126373_11376652 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 771 | Open in IMG/M |
| 3300010159|Ga0099796_10268439 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 714 | Open in IMG/M |
| 3300010337|Ga0134062_10375825 | Not Available | 690 | Open in IMG/M |
| 3300010360|Ga0126372_10941123 | Not Available | 870 | Open in IMG/M |
| 3300010360|Ga0126372_11991902 | Not Available | 627 | Open in IMG/M |
| 3300010361|Ga0126378_10379000 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1526 | Open in IMG/M |
| 3300010361|Ga0126378_10515585 | All Organisms → cellular organisms → Bacteria | 1311 | Open in IMG/M |
| 3300010361|Ga0126378_10578766 | All Organisms → cellular organisms → Bacteria | 1237 | Open in IMG/M |
| 3300010361|Ga0126378_11360953 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae | 803 | Open in IMG/M |
| 3300010361|Ga0126378_11655870 | Not Available | 727 | Open in IMG/M |
| 3300010366|Ga0126379_10500922 | All Organisms → cellular organisms → Bacteria | 1286 | Open in IMG/M |
| 3300010366|Ga0126379_11383227 | All Organisms → cellular organisms → Bacteria | 810 | Open in IMG/M |
| 3300010366|Ga0126379_12519624 | Not Available | 613 | Open in IMG/M |
| 3300010366|Ga0126379_13704710 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300010371|Ga0134125_11907865 | Not Available | 646 | Open in IMG/M |
| 3300010376|Ga0126381_101081417 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1158 | Open in IMG/M |
| 3300010376|Ga0126381_101942989 | All Organisms → cellular organisms → Bacteria | 848 | Open in IMG/M |
| 3300010376|Ga0126381_102662184 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
| 3300010376|Ga0126381_102723438 | Not Available | 706 | Open in IMG/M |
| 3300010376|Ga0126381_103803148 | Not Available | 590 | Open in IMG/M |
| 3300010398|Ga0126383_10421614 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1377 | Open in IMG/M |
| 3300010398|Ga0126383_13546816 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 510 | Open in IMG/M |
| 3300011269|Ga0137392_10736066 | Not Available | 816 | Open in IMG/M |
| 3300012189|Ga0137388_11269809 | Not Available | 675 | Open in IMG/M |
| 3300012189|Ga0137388_11357060 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 650 | Open in IMG/M |
| 3300012202|Ga0137363_10784921 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
| 3300012202|Ga0137363_11232349 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300012202|Ga0137363_11760546 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300012205|Ga0137362_11024548 | Not Available | 703 | Open in IMG/M |
| 3300012205|Ga0137362_11296029 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300012210|Ga0137378_10717792 | All Organisms → cellular organisms → Bacteria | 911 | Open in IMG/M |
| 3300012210|Ga0137378_10933274 | All Organisms → cellular organisms → Bacteria | 781 | Open in IMG/M |
| 3300012211|Ga0137377_11216818 | Not Available | 683 | Open in IMG/M |
| 3300012359|Ga0137385_10830862 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 766 | Open in IMG/M |
| 3300012361|Ga0137360_10230195 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1513 | Open in IMG/M |
| 3300012361|Ga0137360_11673791 | Not Available | 542 | Open in IMG/M |
| 3300012362|Ga0137361_10097019 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2556 | Open in IMG/M |
| 3300012362|Ga0137361_10473051 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1151 | Open in IMG/M |
| 3300012362|Ga0137361_10497803 | All Organisms → cellular organisms → Bacteria | 1119 | Open in IMG/M |
| 3300012362|Ga0137361_10871358 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 817 | Open in IMG/M |
| 3300012362|Ga0137361_11053534 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
| 3300012469|Ga0150984_120367839 | Not Available | 580 | Open in IMG/M |
| 3300012582|Ga0137358_10678641 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300012683|Ga0137398_10893228 | Not Available | 619 | Open in IMG/M |
| 3300012917|Ga0137395_10280777 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1176 | Open in IMG/M |
| 3300012918|Ga0137396_10528025 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 874 | Open in IMG/M |
| 3300012918|Ga0137396_10617046 | Not Available | 802 | Open in IMG/M |
| 3300012922|Ga0137394_10999901 | Not Available | 695 | Open in IMG/M |
| 3300012922|Ga0137394_11043745 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
| 3300012923|Ga0137359_11065367 | Not Available | 692 | Open in IMG/M |
| 3300012924|Ga0137413_11188139 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300012924|Ga0137413_11328285 | Not Available | 578 | Open in IMG/M |
| 3300012927|Ga0137416_11332097 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 649 | Open in IMG/M |
| 3300012930|Ga0137407_12305311 | Not Available | 515 | Open in IMG/M |
| 3300012944|Ga0137410_11305361 | Not Available | 628 | Open in IMG/M |
| 3300012948|Ga0126375_10705048 | All Organisms → cellular organisms → Bacteria | 786 | Open in IMG/M |
| 3300012955|Ga0164298_11525055 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 523 | Open in IMG/M |
| 3300012971|Ga0126369_11780160 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 705 | Open in IMG/M |
| 3300013308|Ga0157375_12583868 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300014166|Ga0134079_10734181 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300015242|Ga0137412_10958332 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 616 | Open in IMG/M |
| 3300015264|Ga0137403_10524678 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1054 | Open in IMG/M |
| 3300015264|Ga0137403_10901362 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
| 3300016270|Ga0182036_10092905 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2030 | Open in IMG/M |
| 3300016294|Ga0182041_10550394 | All Organisms → cellular organisms → Bacteria | 1007 | Open in IMG/M |
| 3300016294|Ga0182041_11027442 | Not Available | 746 | Open in IMG/M |
| 3300016294|Ga0182041_11158354 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
| 3300016294|Ga0182041_12150069 | Not Available | 521 | Open in IMG/M |
| 3300016319|Ga0182033_10270310 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1390 | Open in IMG/M |
| 3300016319|Ga0182033_11007809 | Not Available | 741 | Open in IMG/M |
| 3300016341|Ga0182035_10081520 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2311 | Open in IMG/M |
| 3300016341|Ga0182035_10844024 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 806 | Open in IMG/M |
| 3300016357|Ga0182032_10456026 | All Organisms → cellular organisms → Bacteria | 1044 | Open in IMG/M |
| 3300016357|Ga0182032_10645746 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 884 | Open in IMG/M |
| 3300016357|Ga0182032_11707799 | Not Available | 549 | Open in IMG/M |
| 3300016357|Ga0182032_11771139 | Not Available | 539 | Open in IMG/M |
| 3300016357|Ga0182032_12058403 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Sediminicoccus → Sediminicoccus rosea | 501 | Open in IMG/M |
| 3300016371|Ga0182034_10983349 | Not Available | 728 | Open in IMG/M |
| 3300016371|Ga0182034_10986332 | All Organisms → cellular organisms → Bacteria | 727 | Open in IMG/M |
| 3300016371|Ga0182034_11127455 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
| 3300016387|Ga0182040_10598568 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 892 | Open in IMG/M |
| 3300016387|Ga0182040_10825795 | Not Available | 765 | Open in IMG/M |
| 3300016387|Ga0182040_11192093 | Not Available | 640 | Open in IMG/M |
| 3300016387|Ga0182040_11463451 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300016387|Ga0182040_11743080 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300016404|Ga0182037_10409336 | Not Available | 1119 | Open in IMG/M |
| 3300016404|Ga0182037_11814702 | Not Available | 545 | Open in IMG/M |
| 3300016422|Ga0182039_10351805 | Not Available | 1237 | Open in IMG/M |
| 3300016422|Ga0182039_11231367 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
| 3300016422|Ga0182039_11778819 | Not Available | 565 | Open in IMG/M |
| 3300016422|Ga0182039_12013797 | Not Available | 531 | Open in IMG/M |
| 3300016445|Ga0182038_10078920 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2317 | Open in IMG/M |
| 3300016445|Ga0182038_10277759 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1360 | Open in IMG/M |
| 3300016445|Ga0182038_10336324 | All Organisms → cellular organisms → Bacteria | 1246 | Open in IMG/M |
| 3300016445|Ga0182038_10401023 | Not Available | 1150 | Open in IMG/M |
| 3300018433|Ga0066667_12201688 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300018482|Ga0066669_12268820 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300020579|Ga0210407_10320955 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1210 | Open in IMG/M |
| 3300020579|Ga0210407_10661199 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. L2C066B000 | 812 | Open in IMG/M |
| 3300020579|Ga0210407_11048090 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300020580|Ga0210403_10349137 | All Organisms → cellular organisms → Bacteria | 1210 | Open in IMG/M |
| 3300020580|Ga0210403_10590354 | All Organisms → cellular organisms → Bacteria | 898 | Open in IMG/M |
| 3300020580|Ga0210403_11089574 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium liaoningense | 621 | Open in IMG/M |
| 3300020581|Ga0210399_10287323 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1373 | Open in IMG/M |
| 3300020581|Ga0210399_10394957 | Not Available | 1153 | Open in IMG/M |
| 3300020581|Ga0210399_10955102 | Not Available | 693 | Open in IMG/M |
| 3300021088|Ga0210404_10645339 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300021168|Ga0210406_10453722 | All Organisms → cellular organisms → Bacteria | 1020 | Open in IMG/M |
| 3300021168|Ga0210406_10570007 | All Organisms → cellular organisms → Bacteria | 887 | Open in IMG/M |
| 3300021170|Ga0210400_10273293 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Ec3.3 | 1384 | Open in IMG/M |
| 3300021170|Ga0210400_11543818 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300021178|Ga0210408_10376174 | All Organisms → cellular organisms → Bacteria | 1132 | Open in IMG/M |
| 3300021178|Ga0210408_10401644 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1092 | Open in IMG/M |
| 3300021178|Ga0210408_11499899 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 505 | Open in IMG/M |
| 3300021401|Ga0210393_10513961 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 978 | Open in IMG/M |
| 3300021403|Ga0210397_10829525 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Tepidamorphaceae → Tepidamorphus → Tepidamorphus gemmatus | 714 | Open in IMG/M |
| 3300021405|Ga0210387_10145831 | All Organisms → cellular organisms → Bacteria | 2021 | Open in IMG/M |
| 3300021406|Ga0210386_11097875 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
| 3300021406|Ga0210386_11338459 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300021420|Ga0210394_10650717 | Not Available | 925 | Open in IMG/M |
| 3300021420|Ga0210394_10995939 | Not Available | 726 | Open in IMG/M |
| 3300021432|Ga0210384_10025524 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Ec3.3 | 5592 | Open in IMG/M |
| 3300021444|Ga0213878_10079019 | All Organisms → cellular organisms → Bacteria | 1317 | Open in IMG/M |
| 3300021476|Ga0187846_10247643 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
| 3300021476|Ga0187846_10387408 | Not Available | 575 | Open in IMG/M |
| 3300021479|Ga0210410_10370987 | All Organisms → cellular organisms → Bacteria | 1283 | Open in IMG/M |
| 3300021479|Ga0210410_11003517 | Not Available | 724 | Open in IMG/M |
| 3300021479|Ga0210410_11010634 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 721 | Open in IMG/M |
| 3300021479|Ga0210410_11689925 | Not Available | 527 | Open in IMG/M |
| 3300021560|Ga0126371_10126683 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2586 | Open in IMG/M |
| 3300021560|Ga0126371_11093459 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 937 | Open in IMG/M |
| 3300021560|Ga0126371_11185217 | All Organisms → cellular organisms → Bacteria | 901 | Open in IMG/M |
| 3300021560|Ga0126371_13556979 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300021560|Ga0126371_13808128 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300022533|Ga0242662_10012123 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1785 | Open in IMG/M |
| 3300022726|Ga0242654_10442761 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300024347|Ga0179591_1009120 | Not Available | 4608 | Open in IMG/M |
| 3300025898|Ga0207692_10151477 | All Organisms → cellular organisms → Bacteria | 1329 | Open in IMG/M |
| 3300025915|Ga0207693_11022062 | Not Available | 630 | Open in IMG/M |
| 3300025922|Ga0207646_11098490 | Not Available | 700 | Open in IMG/M |
| 3300025928|Ga0207700_10478232 | All Organisms → cellular organisms → Bacteria | 1100 | Open in IMG/M |
| 3300025939|Ga0207665_10177061 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1543 | Open in IMG/M |
| 3300026527|Ga0209059_1164981 | Not Available | 791 | Open in IMG/M |
| 3300026538|Ga0209056_10591656 | Not Available | 560 | Open in IMG/M |
| 3300026551|Ga0209648_10411460 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 877 | Open in IMG/M |
| 3300026557|Ga0179587_10918916 | Not Available | 577 | Open in IMG/M |
| 3300027109|Ga0208603_1054202 | Not Available | 607 | Open in IMG/M |
| 3300027605|Ga0209329_1095602 | Not Available | 649 | Open in IMG/M |
| 3300027635|Ga0209625_1037717 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1079 | Open in IMG/M |
| 3300027651|Ga0209217_1074320 | All Organisms → cellular organisms → Bacteria | 994 | Open in IMG/M |
| 3300027875|Ga0209283_10889824 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300027903|Ga0209488_11013654 | Not Available | 574 | Open in IMG/M |
| 3300027903|Ga0209488_11140178 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300029636|Ga0222749_10110506 | Not Available | 1302 | Open in IMG/M |
| 3300030969|Ga0075394_11737472 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Thalassobaculaceae → Oceanibaculum | 728 | Open in IMG/M |
| 3300031057|Ga0170834_110840220 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 787 | Open in IMG/M |
| 3300031057|Ga0170834_113920800 | Not Available | 631 | Open in IMG/M |
| 3300031128|Ga0170823_13312822 | All Organisms → cellular organisms → Bacteria | 731 | Open in IMG/M |
| 3300031231|Ga0170824_116249581 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
| 3300031421|Ga0308194_10041011 | Not Available | 1142 | Open in IMG/M |
| 3300031446|Ga0170820_12569934 | Not Available | 602 | Open in IMG/M |
| 3300031446|Ga0170820_13154746 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300031446|Ga0170820_13760044 | Not Available | 573 | Open in IMG/M |
| 3300031474|Ga0170818_109558571 | Not Available | 614 | Open in IMG/M |
| 3300031543|Ga0318516_10510700 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300031543|Ga0318516_10718289 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300031544|Ga0318534_10773156 | Not Available | 540 | Open in IMG/M |
| 3300031544|Ga0318534_10858065 | Not Available | 509 | Open in IMG/M |
| 3300031545|Ga0318541_10349381 | All Organisms → cellular organisms → Bacteria | 826 | Open in IMG/M |
| 3300031545|Ga0318541_10859934 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300031546|Ga0318538_10784129 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 517 | Open in IMG/M |
| 3300031549|Ga0318571_10221824 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
| 3300031549|Ga0318571_10295569 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300031549|Ga0318571_10453792 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300031561|Ga0318528_10585093 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300031572|Ga0318515_10315065 | All Organisms → cellular organisms → Bacteria | 839 | Open in IMG/M |
| 3300031572|Ga0318515_10380514 | Not Available | 756 | Open in IMG/M |
| 3300031572|Ga0318515_10554558 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300031573|Ga0310915_10150632 | Not Available | 1608 | Open in IMG/M |
| 3300031573|Ga0310915_10608834 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 774 | Open in IMG/M |
| 3300031573|Ga0310915_11163687 | Not Available | 534 | Open in IMG/M |
| 3300031668|Ga0318542_10575044 | Not Available | 587 | Open in IMG/M |
| 3300031679|Ga0318561_10348509 | All Organisms → cellular organisms → Bacteria | 812 | Open in IMG/M |
| 3300031679|Ga0318561_10597929 | Not Available | 607 | Open in IMG/M |
| 3300031679|Ga0318561_10828582 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300031680|Ga0318574_10249124 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1027 | Open in IMG/M |
| 3300031680|Ga0318574_10520424 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
| 3300031682|Ga0318560_10206676 | Not Available | 1050 | Open in IMG/M |
| 3300031719|Ga0306917_10642345 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 834 | Open in IMG/M |
| 3300031719|Ga0306917_10714424 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 787 | Open in IMG/M |
| 3300031719|Ga0306917_10806359 | Not Available | 736 | Open in IMG/M |
| 3300031719|Ga0306917_11477649 | Not Available | 523 | Open in IMG/M |
| 3300031724|Ga0318500_10484542 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Rhizobiales bacterium GAS113 | 621 | Open in IMG/M |
| 3300031736|Ga0318501_10439161 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
| 3300031744|Ga0306918_10758636 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
| 3300031747|Ga0318502_10466982 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 754 | Open in IMG/M |
| 3300031747|Ga0318502_10614327 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 655 | Open in IMG/M |
| 3300031748|Ga0318492_10569049 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300031751|Ga0318494_10095032 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1637 | Open in IMG/M |
| 3300031753|Ga0307477_10726539 | Not Available | 663 | Open in IMG/M |
| 3300031754|Ga0307475_10365363 | All Organisms → cellular organisms → Bacteria | 1160 | Open in IMG/M |
| 3300031763|Ga0318537_10066570 | All Organisms → cellular organisms → Bacteria | 1318 | Open in IMG/M |
| 3300031763|Ga0318537_10237539 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
| 3300031764|Ga0318535_10114862 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1186 | Open in IMG/M |
| 3300031765|Ga0318554_10366923 | All Organisms → cellular organisms → Bacteria | 818 | Open in IMG/M |
| 3300031765|Ga0318554_10572688 | Not Available | 637 | Open in IMG/M |
| 3300031771|Ga0318546_11257239 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300031778|Ga0318498_10553607 | Not Available | 504 | Open in IMG/M |
| 3300031780|Ga0318508_1032938 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1321 | Open in IMG/M |
| 3300031781|Ga0318547_10209648 | All Organisms → cellular organisms → Bacteria | 1166 | Open in IMG/M |
| 3300031782|Ga0318552_10187322 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae | 1045 | Open in IMG/M |
| 3300031782|Ga0318552_10511040 | Not Available | 613 | Open in IMG/M |
| 3300031794|Ga0318503_10090521 | All Organisms → cellular organisms → Bacteria | 966 | Open in IMG/M |
| 3300031795|Ga0318557_10226004 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Rhizobiales bacterium GAS188 | 856 | Open in IMG/M |
| 3300031796|Ga0318576_10070363 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1554 | Open in IMG/M |
| 3300031797|Ga0318550_10323502 | All Organisms → cellular organisms → Bacteria | 748 | Open in IMG/M |
| 3300031819|Ga0318568_10666302 | Not Available | 647 | Open in IMG/M |
| 3300031820|Ga0307473_11411490 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300031823|Ga0307478_10619517 | All Organisms → cellular organisms → Bacteria | 906 | Open in IMG/M |
| 3300031833|Ga0310917_10682927 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
| 3300031890|Ga0306925_10193860 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2190 | Open in IMG/M |
| 3300031890|Ga0306925_10366712 | All Organisms → cellular organisms → Bacteria | 1546 | Open in IMG/M |
| 3300031890|Ga0306925_10493637 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1305 | Open in IMG/M |
| 3300031890|Ga0306925_11366143 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
| 3300031890|Ga0306925_11411119 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
| 3300031893|Ga0318536_10148179 | All Organisms → cellular organisms → Bacteria | 1192 | Open in IMG/M |
| 3300031893|Ga0318536_10185688 | All Organisms → cellular organisms → Bacteria | 1059 | Open in IMG/M |
| 3300031893|Ga0318536_10532765 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300031894|Ga0318522_10080788 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1187 | Open in IMG/M |
| 3300031894|Ga0318522_10137417 | Not Available | 918 | Open in IMG/M |
| 3300031896|Ga0318551_10423577 | Not Available | 758 | Open in IMG/M |
| 3300031896|Ga0318551_10848876 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 532 | Open in IMG/M |
| 3300031897|Ga0318520_10136287 | Not Available | 1411 | Open in IMG/M |
| 3300031897|Ga0318520_10840205 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 577 | Open in IMG/M |
| 3300031910|Ga0306923_10090305 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Ec3.3 | 3446 | Open in IMG/M |
| 3300031910|Ga0306923_10418634 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1523 | Open in IMG/M |
| 3300031910|Ga0306923_12284400 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300031912|Ga0306921_10808103 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1070 | Open in IMG/M |
| 3300031912|Ga0306921_11065009 | All Organisms → cellular organisms → Bacteria | 908 | Open in IMG/M |
| 3300031912|Ga0306921_11783998 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 662 | Open in IMG/M |
| 3300031912|Ga0306921_12300513 | Not Available | 565 | Open in IMG/M |
| 3300031912|Ga0306921_12451863 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 543 | Open in IMG/M |
| 3300031941|Ga0310912_10002458 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 10523 | Open in IMG/M |
| 3300031941|Ga0310912_10927526 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae | 670 | Open in IMG/M |
| 3300031942|Ga0310916_10114420 | All Organisms → cellular organisms → Bacteria | 2186 | Open in IMG/M |
| 3300031945|Ga0310913_10436862 | All Organisms → cellular organisms → Bacteria | 929 | Open in IMG/M |
| 3300031945|Ga0310913_10562188 | Not Available | 809 | Open in IMG/M |
| 3300031946|Ga0310910_10455847 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1015 | Open in IMG/M |
| 3300031946|Ga0310910_10795786 | Not Available | 745 | Open in IMG/M |
| 3300031946|Ga0310910_10851860 | Not Available | 716 | Open in IMG/M |
| 3300031946|Ga0310910_11360126 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 547 | Open in IMG/M |
| 3300031946|Ga0310910_11394973 | Not Available | 539 | Open in IMG/M |
| 3300031947|Ga0310909_10823196 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
| 3300031947|Ga0310909_11087660 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Rhizobiales bacterium GAS113 | 650 | Open in IMG/M |
| 3300031954|Ga0306926_10151286 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 2874 | Open in IMG/M |
| 3300031954|Ga0306926_13016512 | Not Available | 502 | Open in IMG/M |
| 3300031959|Ga0318530_10030006 | All Organisms → cellular organisms → Bacteria | 1942 | Open in IMG/M |
| 3300031962|Ga0307479_11739787 | Not Available | 576 | Open in IMG/M |
| 3300031981|Ga0318531_10294316 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 733 | Open in IMG/M |
| 3300032001|Ga0306922_10129480 | All Organisms → cellular organisms → Bacteria | 2688 | Open in IMG/M |
| 3300032001|Ga0306922_12112433 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300032010|Ga0318569_10401259 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300032025|Ga0318507_10354378 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300032025|Ga0318507_10522877 | Not Available | 516 | Open in IMG/M |
| 3300032035|Ga0310911_10191477 | All Organisms → cellular organisms → Bacteria | 1161 | Open in IMG/M |
| 3300032035|Ga0310911_10441644 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas parva | 753 | Open in IMG/M |
| 3300032035|Ga0310911_10622526 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 626 | Open in IMG/M |
| 3300032039|Ga0318559_10124197 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1159 | Open in IMG/M |
| 3300032041|Ga0318549_10102778 | Not Available | 1247 | Open in IMG/M |
| 3300032041|Ga0318549_10174926 | All Organisms → cellular organisms → Bacteria | 961 | Open in IMG/M |
| 3300032041|Ga0318549_10380477 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300032042|Ga0318545_10392451 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300032043|Ga0318556_10395223 | Not Available | 723 | Open in IMG/M |
| 3300032043|Ga0318556_10761581 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300032044|Ga0318558_10448765 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 643 | Open in IMG/M |
| 3300032044|Ga0318558_10625642 | Not Available | 538 | Open in IMG/M |
| 3300032052|Ga0318506_10212829 | Not Available | 854 | Open in IMG/M |
| 3300032052|Ga0318506_10549962 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 511 | Open in IMG/M |
| 3300032055|Ga0318575_10003463 | All Organisms → cellular organisms → Bacteria | 5280 | Open in IMG/M |
| 3300032055|Ga0318575_10373398 | Not Available | 723 | Open in IMG/M |
| 3300032055|Ga0318575_10617987 | Not Available | 549 | Open in IMG/M |
| 3300032059|Ga0318533_10859354 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
| 3300032059|Ga0318533_11224247 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300032060|Ga0318505_10273266 | Not Available | 796 | Open in IMG/M |
| 3300032064|Ga0318510_10196484 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 814 | Open in IMG/M |
| 3300032065|Ga0318513_10504771 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300032066|Ga0318514_10026478 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2688 | Open in IMG/M |
| 3300032067|Ga0318524_10363953 | Not Available | 752 | Open in IMG/M |
| 3300032076|Ga0306924_11220891 | All Organisms → cellular organisms → Bacteria | 812 | Open in IMG/M |
| 3300032090|Ga0318518_10340626 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
| 3300032094|Ga0318540_10367343 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 695 | Open in IMG/M |
| 3300032174|Ga0307470_10899888 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
| 3300032180|Ga0307471_102211792 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 693 | Open in IMG/M |
| 3300032205|Ga0307472_101729378 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300032261|Ga0306920_100036039 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 7113 | Open in IMG/M |
| 3300032261|Ga0306920_101887564 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 840 | Open in IMG/M |
| 3300032261|Ga0306920_102789165 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
| 3300032261|Ga0306920_104370090 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300033289|Ga0310914_10253677 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1581 | Open in IMG/M |
| 3300033289|Ga0310914_10476117 | Not Available | 1130 | Open in IMG/M |
| 3300033289|Ga0310914_11476757 | Not Available | 583 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 41.33% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 17.05% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 13.01% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 8.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.60% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.60% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.31% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.02% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.45% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.45% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.16% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.87% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.58% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.58% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.58% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.58% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.29% |
| Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 0.29% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.29% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.29% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.29% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.29% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.29% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.29% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.29% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.29% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459013 | Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO 1O1 lysis soil at the rocks surface 0-21cm | Environmental | Open in IMG/M |
| 2170459016 | Litter degradation ZMR2 | Engineered | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005993 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021444 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R02 | Environmental | Open in IMG/M |
| 3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024347 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026527 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027109 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF008 (SPAdes) | Environmental | Open in IMG/M |
| 3300027605 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027635 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027651 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030969 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA12 Emin (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031421 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031780 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031794 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032051 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| N57_06016640 | 2170459013 | Grass Soil | MTRRELMLLLGGALTAPRALCAQQKAMPVIGFLNST |
| 2ZMR_02964370 | 2170459016 | Switchgrass, Maize And Mischanthus Litter | MRRREVILLLGAMVAAPRAPRAQQKAMPVIGFLGSLVRPECEY |
| JGI10216J12902_1128644552 | 3300000956 | Soil | MALLGGAATWPLAVRAQQAAMPVIGFLNPASTEAL |
| JGIcombinedJ26739_1009149792 | 3300002245 | Forest Soil | VNRRDLLALLGATVAWPRTLHAQQKAMPVIGYLSNT |
| Ga0062385_104543091 | 3300004080 | Bog Forest Soil | MRRRELMLLLAGTMTAVRPLHAQQKAMPVIGWLSSGSPQS |
| Ga0062386_1008118522 | 3300004152 | Bog Forest Soil | MRRRELMLLLGSSMIAVRALRAQQKAMPVIGFLGVGSPGPV |
| Ga0062388_1000219437 | 3300004635 | Bog Forest Soil | MRRRELMLLLAGTMTAVRPLHAQQKAMPVIGWLSSGSPQSDEIPARLPA |
| Ga0066675_103758601 | 3300005187 | Soil | MRRRELMLLLGGVMTPPRFLCAQQKAMPVIGFLGGSSPGPF |
| Ga0066388_1037281312 | 3300005332 | Tropical Forest Soil | MRRRDLMLMLGGAAAVPRALRAQHKTMPAIGWLHSLSADQAAAV |
| Ga0066388_1051806092 | 3300005332 | Tropical Forest Soil | MNRRELMLLLAGAMTAPSALRAQYSAMPVIGYVVSGSDGPS |
| Ga0008090_150880221 | 3300005363 | Tropical Rainforest Soil | MTSRRELLLLLGGAITVPRVVCAQQKAMPAIGFLGSFPPVM |
| Ga0008090_154944361 | 3300005363 | Tropical Rainforest Soil | MNRRDFVLLVGAAMTAARSLCAQQKAMPVIGFLSGGSPGSQAALT |
| Ga0070714_1009169431 | 3300005435 | Agricultural Soil | MNRRQLMLLLGGAMIAPANAQQKAAPVIGFLGVASPGPHAP |
| Ga0070710_102690501 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MKRRDLVLLLGGLMTAARALRAQQNVMPVIGFLSGSSAGPSAS |
| Ga0070684_1020458541 | 3300005535 | Corn Rhizosphere | VKRREFMLLLGGTMAASGPLRAQQKATPVVGFLISTSPNPPLV |
| Ga0066704_104611621 | 3300005557 | Soil | MGYRMRRRELLLLLGGALTAARTVSALQKAMPVIGF |
| Ga0066700_108245962 | 3300005559 | Soil | MKRRELMLLLGGAVTAPRALRAQQKAMPVIGYLSS |
| Ga0066694_103368261 | 3300005574 | Soil | MRRRELLLVLGGAMTAARALRAQQKAMPVIGFLGTG |
| Ga0066702_106741821 | 3300005575 | Soil | MKRRELMLLLVGAMTAAHTLRAQQKAMPVIGFLSA |
| Ga0066706_107674342 | 3300005598 | Soil | MRRRELMLLVGGAMTIVRPVRAQQKGMPAIGFLGPTF |
| Ga0066903_1039421163 | 3300005764 | Tropical Forest Soil | MNRRELMLLLDGAMTSAEAVCAQQRAMPVIGFLGVGS |
| Ga0066903_1050258923 | 3300005764 | Tropical Forest Soil | MNRRELLMLAGGVVTVPRTLQAQQKAMPVIGFLGNASAS |
| Ga0066903_1076958082 | 3300005764 | Tropical Forest Soil | MMNRRELLLAAAALLTAARPLRAQQRATPVIGFLSSEG |
| Ga0080027_103498321 | 3300005993 | Prmafrost Soil | VRRRELVLLLGGTLTSARVLRAQQKAMPVIGLLLSGLSPWD |
| Ga0070712_1002200913 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MRRRELMLLLGGAITAAPALRAQQRPMLVIGYVNG |
| Ga0079219_110172001 | 3300006954 | Agricultural Soil | MRRRELMLLLAGVIIPPRVLRAQQKAMPVIGFLGV |
| Ga0099791_101796961 | 3300007255 | Vadose Zone Soil | MKRRNLLLLLLGGAMTAARSLRAQQKAMPVIGFLGTTS |
| Ga0099794_105947012 | 3300007265 | Vadose Zone Soil | MNRRELLLSLGGALTAARAPRAQQKAMPVIGYLASGS |
| Ga0066710_1022557601 | 3300009012 | Grasslands Soil | MRRREVMLLLAGAMTVTRALRAQQKAMPVIGFLSLG |
| Ga0099828_113138721 | 3300009089 | Vadose Zone Soil | MRRRDLILGLGAALAWTHAARAQKAMPVIGFLGSTSSSM |
| Ga0099792_108575831 | 3300009143 | Vadose Zone Soil | MNRRELMLLLGAAMTAPRALHAQQKAMSVIGYLAAGPPDP |
| Ga0126374_109572842 | 3300009792 | Tropical Forest Soil | MRRRELLLLLGGAMTTAATLRAQQKAIPVIGYLSSQSADAL |
| Ga0126374_116451871 | 3300009792 | Tropical Forest Soil | MRRRELLLLLAANMIAARAVRAQQKAMPVIAQLSA |
| Ga0126384_112489442 | 3300010046 | Tropical Forest Soil | MMTRRELVLLLAGAMAAARMGHAQQKAMPVIGHISMYS |
| Ga0126382_102729011 | 3300010047 | Tropical Forest Soil | MMNRRELLLLLGGAATMTRALRAQQKAMPVIGLLGLASPGLSTP |
| Ga0126373_113766523 | 3300010048 | Tropical Forest Soil | MNRRELILLLAGTMTPAHAVRAQQKTMPVIGYLSS |
| Ga0126373_125874182 | 3300010048 | Tropical Forest Soil | MRRRELLVLLGSAMTTAPGVRAQQKAMPVVGWLSGSSPPPN |
| Ga0099796_102684391 | 3300010159 | Vadose Zone Soil | MRRRELMLLLGGAMTASHALRAQQKTMPVVGWLNST |
| Ga0134062_103758251 | 3300010337 | Grasslands Soil | MKRRQILGLIGSTLAPWPLARAQQLAMPVIGFLNTQLPGP |
| Ga0126372_109411233 | 3300010360 | Tropical Forest Soil | MRRRELLLLVGGAVIGPRALRAQQKAMPVVGYLGASS |
| Ga0126372_119919021 | 3300010360 | Tropical Forest Soil | MNRRDLMLLVAGAMTAPRLLRAQQKAFPVIGFLGSTSPN |
| Ga0126378_103790003 | 3300010361 | Tropical Forest Soil | MNRRELMLVAAGMMATGRGLRAQQKAMPVIGYLNG |
| Ga0126378_105155851 | 3300010361 | Tropical Forest Soil | MMNRRELLLAAAGLLTAARPLRAQQRATPVIGFLS |
| Ga0126378_105787663 | 3300010361 | Tropical Forest Soil | VINRRKLLLLLGGAMTAPRALCAQQKPVPVIGFLGSTSPA |
| Ga0126378_113609531 | 3300010361 | Tropical Forest Soil | MNRRELLLPIAGAVIAPRASRGQQKAMPVIGFVGVNSP |
| Ga0126378_116558701 | 3300010361 | Tropical Forest Soil | MRRRELMLSLGCALTAARSLRAQQKSMPVIGFLSS |
| Ga0126379_105009221 | 3300010366 | Tropical Forest Soil | MNRRELMLLLGGAMTSAEAVCAQQRAMPVIGFLGVGSLGSQAALV |
| Ga0126379_113832271 | 3300010366 | Tropical Forest Soil | MNRRELMLLLGCAVAAPHALRAQQKPMPVIAFLSSVSAESV |
| Ga0126379_125196241 | 3300010366 | Tropical Forest Soil | MTNRRELLALAVGAVTMARGLRAQQKAMPVIGFLNSG |
| Ga0126379_137047101 | 3300010366 | Tropical Forest Soil | MRRRELMLVLVGAVTARHEMRAQHKAMPVVGFLLIGSPIPDSPF |
| Ga0134125_119078652 | 3300010371 | Terrestrial Soil | MRRRELMLLLGGVMTAARTLGAQQKAMPVIGVLNSASPGPF |
| Ga0126381_1010814171 | 3300010376 | Tropical Forest Soil | MRRRELLLVLATGTMVARAVRAQQKAMPVIGYLNPT |
| Ga0126381_1019429891 | 3300010376 | Tropical Forest Soil | MRRRELLLMLGGAMTTGRGLRAQQKAMPVIGYLSSQSAEA |
| Ga0126381_1026621841 | 3300010376 | Tropical Forest Soil | MNRRELLMLAGGVVTVPRTLQAQEKAMPVIGFLGNASASYTAP |
| Ga0126381_1027234381 | 3300010376 | Tropical Forest Soil | MRRRELLLLVAGAMSTARTLRAQQKAMKIIGWLYP |
| Ga0126381_1038031481 | 3300010376 | Tropical Forest Soil | MRRRDFLLLTGGAAIAPRALRAEQKAMPVIGYLGS |
| Ga0126383_104216142 | 3300010398 | Tropical Forest Soil | MKRRRLLVLLGAAMTAVQGLRAQQNAMPVIGFLGGGPLVPK |
| Ga0126383_135468162 | 3300010398 | Tropical Forest Soil | MTRRELLLLLGVAMTAASAPRAQQKAMPVIGFLSSR |
| Ga0137392_107360663 | 3300011269 | Vadose Zone Soil | MRRRELMLLLGGMMTTARALCAQQKAMPVIGYLGN |
| Ga0137388_112698092 | 3300012189 | Vadose Zone Soil | MLLLGGALMAARPLRAQQKATPVIGILSVGSPGPFASRVTAF |
| Ga0137388_113570603 | 3300012189 | Vadose Zone Soil | MIGRREVTLLLWGAMTAPRVLRAQQKAMPVIGYLNGT |
| Ga0137363_107849212 | 3300012202 | Vadose Zone Soil | LKRREVLLLAGAMTAARALRAQQKAMPVIGYLNSTSP |
| Ga0137363_112323491 | 3300012202 | Vadose Zone Soil | MRRRELLFFLSSAITAARALGAQQKAMPVLGFLSSASPGP |
| Ga0137363_117605462 | 3300012202 | Vadose Zone Soil | MTRRELMLLLGGTVIAPRTLRAQQKAMPVIGFLGSTS |
| Ga0137362_110245481 | 3300012205 | Vadose Zone Soil | MRRRKFLLLLAGAVTAARAPRVQQKAMPVLGFLSS |
| Ga0137362_112960292 | 3300012205 | Vadose Zone Soil | MRRRELILLLGGAMTAARVLRAQQKAMPVIGFLNVTSPGP |
| Ga0137378_107177922 | 3300012210 | Vadose Zone Soil | MRRRELVLLLGGMMTAPCALRAQQKKMPVIGYLSGSNAASGP |
| Ga0137378_109332742 | 3300012210 | Vadose Zone Soil | MRRRDLLVLFGGAITAWPFVGRAQQKKAMPVIGYLGATSAGP |
| Ga0137377_112168182 | 3300012211 | Vadose Zone Soil | VKRRDLLVLVAGAMTAARGLRAQQKAMPVIGFLGAAPPGPNA |
| Ga0137385_108308622 | 3300012359 | Vadose Zone Soil | MRRRELMLLLGGAMTAARALRAQQKAVPVIGFLSLSSPARLQ* |
| Ga0137360_102301954 | 3300012361 | Vadose Zone Soil | MKRRELMLLLGGAMTAARALRAQQKAMPVIGYLSG |
| Ga0137360_116737911 | 3300012361 | Vadose Zone Soil | MKRRELMLLLSGAVAAARALRAQQKARPVIGYLGGGSAGPYAPVVA |
| Ga0137361_100970198 | 3300012362 | Vadose Zone Soil | MNRRELMLLLGGAMTAGRGLRAQQKAAPVIGFLGVA |
| Ga0137361_104730511 | 3300012362 | Vadose Zone Soil | VKRRELMLLLGGAMAAARAAQAQQKAMPVIGWLNSNSPGPSAPFVA |
| Ga0137361_104978031 | 3300012362 | Vadose Zone Soil | VNRREVMLLLGGAMTTARALRAKQKAMPVIGYLSSEAP |
| Ga0137361_108713582 | 3300012362 | Vadose Zone Soil | MTRRDLILLLGGAMTAARPLHAQQKAVPVIGFLGGASPG |
| Ga0137361_110535342 | 3300012362 | Vadose Zone Soil | MRRRELVLLLTGAMTAAPALRAQQKAMPVIGFLSIAASG |
| Ga0150984_1203678392 | 3300012469 | Avena Fatua Rhizosphere | MRRRELLLLLGGTIRITRPLRAQQKVMPVPVIGFL |
| Ga0137358_106786412 | 3300012582 | Vadose Zone Soil | MRRRELMLLLGGAMTAALPLHAQQKAMPVIGFLGS |
| Ga0137398_108932281 | 3300012683 | Vadose Zone Soil | MRRRELILLLSSATAAAGVLRAQQKAMPVIGYLFGGS* |
| Ga0137395_102807774 | 3300012917 | Vadose Zone Soil | MRRRELILFVAGAMTAAHALRAQQKAMPVIGFLSSSSPGP |
| Ga0137396_105280252 | 3300012918 | Vadose Zone Soil | MRRRELMLLLGGAMAAPRSLRAQQKAMPVIGYLSS |
| Ga0137396_106170462 | 3300012918 | Vadose Zone Soil | MRRRELMLLLGGAMTAAPALRAQQKAMLVIGFLSATSHEPLSPFGA |
| Ga0137394_109999011 | 3300012922 | Vadose Zone Soil | MRRRELLLLLAGAMTAPRPLRAQQKAMSVIGILGAA |
| Ga0137394_110437451 | 3300012922 | Vadose Zone Soil | MTRRELMLLLGGAMMAARALRAQQKAMPVIGWLTGAS |
| Ga0137359_110653672 | 3300012923 | Vadose Zone Soil | MNRRDLLLLLSGAVAAPRALRAQQKAMPVIGYLSI |
| Ga0137413_111881392 | 3300012924 | Vadose Zone Soil | MRRRELMLLLGGAMTAARAVGAQQKAMPVIGVLSSGSP |
| Ga0137413_113282851 | 3300012924 | Vadose Zone Soil | MRRRELLLLLGGALTAARAVSAQQKAMPVIGWLDSASAGFR |
| Ga0137416_113320971 | 3300012927 | Vadose Zone Soil | MTRRDLMLLLGGAMTAGRALGAQQKAMPVIGFLGNASPGPF |
| Ga0137407_123053111 | 3300012930 | Vadose Zone Soil | MRRRELMLMLGGAMMPARALRAQQKAMPVIGYLASGSAGP |
| Ga0137410_113053612 | 3300012944 | Vadose Zone Soil | MRRRELMLLVGGAAMAVAPPLRAQQKAMPVIGFLGG |
| Ga0126375_107050482 | 3300012948 | Tropical Forest Soil | MMNRRELLLLLGGAATMTRALRAQQKAMPVIGLLG |
| Ga0164298_115250551 | 3300012955 | Soil | MNRRELMLVLGGALTAAHALRAQQRATPVIGFLGAASP |
| Ga0126369_117801602 | 3300012971 | Tropical Forest Soil | MNRRELVLLLGGAMTAARAVHAQQKAMPVIGYVSLGAPK* |
| Ga0157375_125838681 | 3300013308 | Miscanthus Rhizosphere | MRRRDLMLLLGSAALPMRALRAQQKALPVVGYLNST |
| Ga0134079_107341811 | 3300014166 | Grasslands Soil | MKRRDLLAALAGTVLLPGTLRAQKAMPVIGFLGIGSPESD |
| Ga0137412_109583322 | 3300015242 | Vadose Zone Soil | MRRRELLLLLGGALTAARAVSAQQKAMPVIGYLFGGS* |
| Ga0137403_105246781 | 3300015264 | Vadose Zone Soil | MNRRELMLLLGGAMTAARALRAQQKAMPVIGYLISGSTGPN |
| Ga0137403_109013621 | 3300015264 | Vadose Zone Soil | MIRRELMLLLGGAMTAARGVRAQQKAMPVIGYLNGTSPV |
| Ga0182036_100929051 | 3300016270 | Soil | MNRRRLILLLGGVVFAPRALRAQQKAMPVIGYLSP |
| Ga0182041_105503941 | 3300016294 | Soil | MRRRDFVLLLAGAMTAAHALRAQQKAMPVIGWLSGNSPSANPGD |
| Ga0182041_110274422 | 3300016294 | Soil | MNRRRLMLLLGGVVIAPRALRAQQKAMPVIGYLSP |
| Ga0182041_111583541 | 3300016294 | Soil | VRRREFVLLLGGAMTAARALHAQQKALPVIGYLNATSPRPY |
| Ga0182041_121500691 | 3300016294 | Soil | MNRRNLMLLLGGAMVATPSPRAQQKAMPVIGYLDVGGLDP |
| Ga0182033_102703102 | 3300016319 | Soil | MRRRELLLLVGGAMTAPHALRAEQKAMPVIGYLGSAT |
| Ga0182033_110078092 | 3300016319 | Soil | MRRREFLLAATALMAAQPVRAQHKAMPVIGFLGLSPPG |
| Ga0182035_100815201 | 3300016341 | Soil | VKRRDFVLLLAGAMTATRALRAQQQKAMPVIGWLSI |
| Ga0182035_108440242 | 3300016341 | Soil | MRRRELLLLVGAAMTTPRSVGAQQKGMPVIGFLGGASC |
| Ga0182032_104560261 | 3300016357 | Soil | MNRRRLILLLGGVVIAPRALCAQQKAMPVIGYLGAGSP |
| Ga0182032_106457463 | 3300016357 | Soil | VKRREFLVLAGSAMAAARQLHAEQKAMPVIGWLSGAS |
| Ga0182032_117077991 | 3300016357 | Soil | MRRRELILLIGGAAIATRSARAQQPAWTPVIGFLGIG |
| Ga0182032_117711391 | 3300016357 | Soil | VKRRDFILLLAGAMIAARALRAQQKAMPVIGWLGAA |
| Ga0182032_120584032 | 3300016357 | Soil | MNRRELLLLLGSVIIVARRPRAQQKAMPVIGFLGTTS |
| Ga0182034_109833492 | 3300016371 | Soil | MKRRDFVLLLSAAMTAARRLGAQQKAMPVIGFLGSGA |
| Ga0182034_109863321 | 3300016371 | Soil | MKRRELLLLVAGALAGPRGLRAQQKAVPVIGFLCSASPGPF |
| Ga0182034_111274551 | 3300016371 | Soil | MMRRRELMLLLGGSMTLSRALYAQQRTMPVIGYVSLGAAGPNESYVV |
| Ga0182040_105985682 | 3300016387 | Soil | MMNRRELLLLVGGAMSMPRSLCAQQKAMSVVGFLGVASP |
| Ga0182040_108257952 | 3300016387 | Soil | MNRRELMLLLGAVMTVARGLRAQQKGMPVIGWLSSGSPGPFAP |
| Ga0182040_111920932 | 3300016387 | Soil | VRRRDFVLLLAGAMTAARALRAQQKAMPVIGWLSGNSPSANP |
| Ga0182040_114634512 | 3300016387 | Soil | VNRRNLMLLLGTAMTAARALRAQQRAMPLIGFLNP |
| Ga0182040_117430802 | 3300016387 | Soil | MRRRELILLLAGMMTATRALRAQQKAMPVIGFLSSRTPGDAAAV |
| Ga0182037_104093362 | 3300016404 | Soil | MKRREFVLLLGGAMTAVRSLGAQQKAMPVIGLLSSASPGQIDAYP |
| Ga0182037_118147021 | 3300016404 | Soil | MKRRELMLLLAGAMTAASAPHAQQKAIPVIGFLSGSSPGQY |
| Ga0182039_103518051 | 3300016422 | Soil | MRRRELMLLLCGAVMAARSPRAQQKAMPVIGYLNSTSADPNAPF |
| Ga0182039_112313673 | 3300016422 | Soil | MNRREMLLLLGWAVIVPRTLRAQQKAMPVVGILGGGS |
| Ga0182039_117788193 | 3300016422 | Soil | MNRRELMLLLAGVMIAPRALQAQRQGAMPVIGWLGSGSPDPFA |
| Ga0182039_120137973 | 3300016422 | Soil | MKRRELLLLLGGALMTARGLRAQQKAMPVIGFLSS |
| Ga0182038_100789204 | 3300016445 | Soil | MTRRQFMLLLSAAIMTAPALRAQQKAMPVIGFLSGAS |
| Ga0182038_102777591 | 3300016445 | Soil | VKRRDLMLLLGGALTVARALRAQQKVIPVIGWLSS |
| Ga0182038_103363241 | 3300016445 | Soil | MNRRELMLAMGSVITASRASRAQQRAMPVIGWLSS |
| Ga0182038_104010234 | 3300016445 | Soil | VKRRDFVLLLAGAMTAARSLGAQQKAMTVIGWLSPLSP |
| Ga0066667_122016882 | 3300018433 | Grasslands Soil | MRRRELMLLLLGGAMTAARALHAQQKAMPVIGYLGST |
| Ga0066669_122688201 | 3300018482 | Grasslands Soil | MNRRELMLLLGGAMMAARTLSAEQKGMPVIGYLSFASP |
| Ga0210407_103209551 | 3300020579 | Soil | MKRRELMLLLGGAMAAAPSLRAQQKAMPVIGWQLHVLT |
| Ga0210407_106611991 | 3300020579 | Soil | MRCRGLALLLGGAMMTARILRAQQKAMPVIGLLGS |
| Ga0210407_110480902 | 3300020579 | Soil | MKRRELLVLVGSAMAVARPLLAQQKPMPVIGFLGNATASYT |
| Ga0210403_103491371 | 3300020580 | Soil | VISRRELMLLMGGAMTAARALRAQQKAMPVVGFLNVT |
| Ga0210403_105903542 | 3300020580 | Soil | MRRRELLLLMGGAMAVARPLRAQQKAMPVIGFLASGAHEGG |
| Ga0210403_110895741 | 3300020580 | Soil | MRRRELMLLLGGAMTVAHPLGAQQKGMPVIGFLSGFSPPQDLGE |
| Ga0210399_102873233 | 3300020581 | Soil | MRRRELMLLLGGAMTAAGASHAQQTAMSAVGELHPT |
| Ga0210399_103949571 | 3300020581 | Soil | MRRRELVLLFGGALMAAHPLRAQQKAMPVIGFLSS |
| Ga0210399_109551021 | 3300020581 | Soil | MTRRELMLFLCGTMTVARALRAQQRAVPVIGFLSSRLP |
| Ga0210404_106453391 | 3300021088 | Soil | MRRRELMLLLGGAMTVARTLRAQQKAMPVIGYLNAAKPTPGML |
| Ga0210406_104537223 | 3300021168 | Soil | MNRREFVLLLGGATTAARALRAQQKAMPVIGFLGIS |
| Ga0210406_105700072 | 3300021168 | Soil | MRRRELMLLLAGAMTAARPLRAQQKAVPVIGFLIGF |
| Ga0210400_102732931 | 3300021170 | Soil | MRRREFLLLLGGAMTAARALSAQQKAMPVIGFLSGISP |
| Ga0210400_115438181 | 3300021170 | Soil | MNRREFMLVLGGAMTAARTLRAQHKAMPVIGYLGGGSPYAPLLAAF |
| Ga0210408_103761741 | 3300021178 | Soil | MRRRELMLLLGGAMTLARALRAQQMAMPVIGYLAFGSPGFAPT |
| Ga0210408_104016442 | 3300021178 | Soil | MNRRELMLLLGGALTAPCALRAEQKAMPVIGLLGQTSPARTR |
| Ga0210408_114998992 | 3300021178 | Soil | MRRRELVLLLGGAMMTARSLGAQQKAMPVVGFLGG |
| Ga0210393_105139613 | 3300021401 | Soil | MKRREFLLLLGGAMAAAPALRAQQKAMPVVGFLGAG |
| Ga0210397_108295251 | 3300021403 | Soil | MRRRELMLLLGGAMTAARGLRAQQKAMPVIGYLSSGSL |
| Ga0210387_101458314 | 3300021405 | Soil | VNRRELVLLLAGALTAPPTLRAQQNAMPVIGYLATSSPNPD |
| Ga0210386_110978751 | 3300021406 | Soil | VRRRELMLLLGGAMTAARALRAQQKAMPVGRLSPCGAAD |
| Ga0210386_113384591 | 3300021406 | Soil | MRRRELLLLLGGAMAASRALRAQQKAMPVIGSLAIAS |
| Ga0210394_106507174 | 3300021420 | Soil | MIRRDVIIFLGGGVIAPRVLRAQQKAMPVIGYLAS |
| Ga0210394_109959392 | 3300021420 | Soil | MKRRELMLLLGGAFIAARALRAQQKAMPVIGYLHYG |
| Ga0210384_100255241 | 3300021432 | Soil | MRRRELMLLLGGAMTAARALRAQQKAVPVIDYLGNISLSG |
| Ga0213878_100790192 | 3300021444 | Bulk Soil | MLLLGAAMTAGRAARAQHKATPVIGYLSQRSPTDSAG |
| Ga0187846_102476431 | 3300021476 | Biofilm | MRRRELILGIGGLISAPIAALAQQKAMPVIGVLSLSTQSPGS |
| Ga0187846_103874084 | 3300021476 | Biofilm | VRRREFVLFLAAAMTAARGLAAQQRAMPVIGFLSGASPAPTAPLLAAFL |
| Ga0210410_103709871 | 3300021479 | Soil | MKRRELILLLGGALTAARGLRAQQKAMPVIGYIASGSP |
| Ga0210410_110035171 | 3300021479 | Soil | VRRRELMLLLGGAMTATRTLRAQQKAMPVIGYLPSGRHSPFI |
| Ga0210410_110106343 | 3300021479 | Soil | MRRRDLVLLLGSAMTTARTLRAQQKAMPVIGYLGNISLSAGAAYL |
| Ga0210410_116899252 | 3300021479 | Soil | MRRRELMLLLGGAMTAARTLRAQQKAMLVIGFLGSAS |
| Ga0126371_101266833 | 3300021560 | Tropical Forest Soil | MRRRDLMLLLAGSFTAARALRAQQKAMPVIGWLGSSTLGGPTA |
| Ga0126371_110934592 | 3300021560 | Tropical Forest Soil | MNRREFMVLLAGAMTAPRHPRAQQKAMPVIGFIGGFA |
| Ga0126371_111852172 | 3300021560 | Tropical Forest Soil | VNRRELILLLGAAMTAPHALRAEEKAMPVIGFLNG |
| Ga0126371_135569792 | 3300021560 | Tropical Forest Soil | MINRRKLMLLLGGAISAPRALCAQQRAVPEVGFLGISSAA |
| Ga0126371_138081281 | 3300021560 | Tropical Forest Soil | MKRRELILLMVSAMTAVRSLHAQQKTMPVIGFLAAGSPGSLDVAVAA |
| Ga0242662_100121231 | 3300022533 | Soil | MKRRDLLLLMGGLMTATRALRAQQKAMPVIGFLGGAS |
| Ga0242654_104427612 | 3300022726 | Soil | MRRRELMLLLGGAMTAAHALRAQQKAMPVIGFLGVGS |
| Ga0179591_10091202 | 3300024347 | Vadose Zone Soil | MRRREVMLLLGGSMIAARDPTRRSQKAMPVIGFLGRRVESPE |
| Ga0207692_101514773 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MKRRDLVLLLGGLMTAARALRAQQNVMPVIARLHD |
| Ga0207693_110220622 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MRRRELILLLSSAMTAASGLRAQQKAMPVIGFLSSVS |
| Ga0207646_110984902 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | VKRREFMLMLGGAMTAGRGLRAQQKAKPVIGYLGAGS |
| Ga0207700_104782321 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MRRRELVLVVGGAMTIAPRLWAQQKAMPVVGHLSIGSP |
| Ga0207665_101770612 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MRRRELMLLLGGAMTAARALRARQKAVPVIGYLGNISLS |
| Ga0209059_11649812 | 3300026527 | Soil | MLLLGGAMTATPAVRAKQKAMPVIGYLNGTSPEAN |
| Ga0209056_105916561 | 3300026538 | Soil | VRRREVILLLAGAMAATGALRAQQKTMPVIGFLGSI |
| Ga0209648_104114601 | 3300026551 | Grasslands Soil | MRRRELLLLLAGALTPARALRAQQKAMPVIGFLSGGSPYAPLLAA |
| Ga0179587_109189161 | 3300026557 | Vadose Zone Soil | MNRRELMLLLGGAMTAAPRALCAQQKAMPVIGYLGTLSGLR |
| Ga0208603_10542021 | 3300027109 | Forest Soil | MRRGELILLLGSAMTAARALRAQQKAMPVIGYLHYASPG |
| Ga0209329_10956021 | 3300027605 | Forest Soil | MRRRELMLLLGGMMTAARTLRAEQKAMPVIGYLNG |
| Ga0209625_10377173 | 3300027635 | Forest Soil | MRRRDVMLLLLGGMIIRARALRAQQKAMPVIGWLSSVSPG |
| Ga0209217_10743204 | 3300027651 | Forest Soil | MNRRKLLLLAGGAMTAARALRAQQKAMPVIGFLSSASPST |
| Ga0209283_108898241 | 3300027875 | Vadose Zone Soil | VRRRELMLLLGGAVMATRGLRAQQKATPVIGFLISTS |
| Ga0209488_110136542 | 3300027903 | Vadose Zone Soil | MRRRELILFLSSATAAAGVLRAQQKAMPVIGYLFGGS |
| Ga0209488_111401781 | 3300027903 | Vadose Zone Soil | VKRRELMLLLGAAMTAAPALRAQQKAMPVIGFLGSISPG |
| Ga0222749_101105061 | 3300029636 | Soil | MRRRELILFVAGAMTAAHALRAQQKAMPVIGFRGGAD |
| Ga0075394_117374723 | 3300030969 | Soil | MRRRELMLILGGALTAARPLRAQRKATPVIGFLDGGSPGPT |
| Ga0170834_1108402202 | 3300031057 | Forest Soil | MNRRELMLLLGGAMAAAHAVRAQQKAMPVIGVLNTG |
| Ga0170834_1139208001 | 3300031057 | Forest Soil | VNRRELMLLLGSAMMAARALRAQQKPMPVIGFLWSSPG |
| Ga0170823_133128221 | 3300031128 | Forest Soil | MNRRELMLLLGSAMTASRGLGAQQKVMPVVGYFNSTWPDP |
| Ga0170824_1162495811 | 3300031231 | Forest Soil | VKRRELVLLLAGAMTGGRALRAQQKAMPVIGFLSI |
| Ga0308194_100410111 | 3300031421 | Soil | MRRRELMIFLGGAMTAARALRAQQRAIQVIGFLNGASPGPHGRF |
| Ga0170820_125699341 | 3300031446 | Forest Soil | MNRRELILLLGGAMTAANDLRAQQKAMPVIGFFNSTSPGP |
| Ga0170820_131547461 | 3300031446 | Forest Soil | MRRRELMLILGGALTAARPLRAQRKATPVIGFLDGGSPGPTAPT |
| Ga0170820_137600441 | 3300031446 | Forest Soil | MRRRELLVLVAGALTAAHPLSAQQKQKAMPVIGFLNSASPGTSPPNLAA |
| Ga0170818_1095585711 | 3300031474 | Forest Soil | MMRRRVLLLGGAMTWTPALRAQQKATPVIGYLNGTS |
| Ga0318516_105107001 | 3300031543 | Soil | VTRRELVLLLGGAMTTARPLRAQEKPLPVIGFLGS |
| Ga0318516_107182891 | 3300031543 | Soil | VDRRELMLLLAGAMGAPSAIRAQQKAMPVIGYLDG |
| Ga0318534_107731561 | 3300031544 | Soil | MRRRELLLLVGAAMTTPRSVGAQQKGMPVIGFLGGASS |
| Ga0318534_108580652 | 3300031544 | Soil | MNRRELMLLLGGAITAPCTLRAQQKAMPVIGFLSNETSDTFA |
| Ga0318541_103493812 | 3300031545 | Soil | MRRRDFVLLLAGAMTAAHALRAQQKAMPVIGWLSGNSPSAN |
| Ga0318541_103965412 | 3300031545 | Soil | MRRRGFLLLLAGTTIAPRAIYAQQKPMPVIGWLSGTS |
| Ga0318541_108599342 | 3300031545 | Soil | MRRRELMLLLGGAMTAPRTLRAQQRATHVIGWLSSVSPGPLAHLV |
| Ga0318538_107841291 | 3300031546 | Soil | MRRRDLMLILGGAMTMPLPLRAQQKAMPVIGSLYNNI |
| Ga0318571_102218242 | 3300031549 | Soil | MKRRDLLLLGSAMAAGARPLRAQQKAMPVIGFLQATPQN |
| Ga0318571_102955692 | 3300031549 | Soil | MNRRELILLLGGGCAVPRTLRAQQKAMPVIDFLLGREARP |
| Ga0318571_104537921 | 3300031549 | Soil | VKRRELLLLLGGGAMAVARPLWAQQKAMPVIGLLGI |
| Ga0318528_105850931 | 3300031561 | Soil | MRRRELMLLLGGALIAARALSAQQKAMPVIGYLATGSPGPTAP |
| Ga0318515_103150652 | 3300031572 | Soil | MNRCELLLLLGCAVAAPHALSAQQKAMPVIGFLSNE |
| Ga0318515_103805141 | 3300031572 | Soil | MTNRRELLILLGGAMTMALRVRAQQKAMPVIGFLAGGPLD |
| Ga0318515_105545582 | 3300031572 | Soil | MKRRDLMLLLAGAMTAARALYAQQKVLPVIGYLNATSPRPYAAN |
| Ga0310915_101506322 | 3300031573 | Soil | MRRRDLIILLAGAVTAAHALRAQQKAMPVIGFLCGGSPDT |
| Ga0310915_106088341 | 3300031573 | Soil | MNRREMMLLLGSAVTAPRALRAQQKAMPVIGYLNG |
| Ga0310915_111636871 | 3300031573 | Soil | MNRRELMLLLGTVMTVARGLRAQQKGMPVIGWLSSGSPGP |
| Ga0318542_105750442 | 3300031668 | Soil | MGWMRRRELLLLVGGAATASRVSRAQQKAMPVIGYLSS |
| Ga0318561_103485093 | 3300031679 | Soil | MKRRDLMLLLAGAMTAARALYAQQKAMPVIGYLNATSPRPYAAN |
| Ga0318561_105979291 | 3300031679 | Soil | MKRRELMLLLGGMMTVARTLRAQQKPMPVIGLLSSVSADSGTFRLT |
| Ga0318561_108285821 | 3300031679 | Soil | MRRRELILLVGGAITTARGLCAQQKGMPVIGFLGIG |
| Ga0318574_102491241 | 3300031680 | Soil | MTRRKLLTLLLGGIVTAPSAARAQQKAMPVIGFFNPT |
| Ga0318574_105204242 | 3300031680 | Soil | VSRRELLLLLAWAVIAPRTLRAQQKAMPVIGFLCSGAS |
| Ga0318560_101052891 | 3300031682 | Soil | VKRRDFVLLLAGAMTAARSLGAQQKAMTVIGWLSPLSPPANLG |
| Ga0318560_102066762 | 3300031682 | Soil | VTRRELVLLLGGAMTTARPLRAQEKPLPVIGFLGSTSPGPEALFLA |
| Ga0306917_106423451 | 3300031719 | Soil | MRRRDLLAVLGGAAVAAPVAARAQQKAMPVISYLAPDAPS |
| Ga0306917_107144243 | 3300031719 | Soil | VKRREFLVLAGSAMAAARQLHAEQKAMPVIGWLSGASP |
| Ga0306917_108063591 | 3300031719 | Soil | MRRRELMLVLAGGAMAAGHGLRAQQKAMPVIGFLIS |
| Ga0306917_114776491 | 3300031719 | Soil | MTRRQFMLLLSAAIMTAPALRAQQKAMPVIGFLSGASPVPTA |
| Ga0318500_104845421 | 3300031724 | Soil | MNRRNFMLLLGGAMTAARALRAQQKGMPVIGYLDPG |
| Ga0318501_104391612 | 3300031736 | Soil | MKRRKLVLALGVAMMVARGTYAQQKPMPVIGYLNGTSPAANAESLA |
| Ga0306918_107586361 | 3300031744 | Soil | VNRRELILLVAGAMTAPRALRAQQKAMPVIGFFSS |
| Ga0318502_104669822 | 3300031747 | Soil | VTRRELVLLLCGAMTVAGAVRAQQRAMPVIGFLNPTSPG |
| Ga0318502_106143271 | 3300031747 | Soil | VKRRELVLLLAGAMTAARAPRAQQKAMPVIGWLSSV |
| Ga0318492_105690492 | 3300031748 | Soil | MNRRELVLLMAGVMIAPRALRAQQKATPVIGFLNGTSPDAAAPF |
| Ga0318494_100950323 | 3300031751 | Soil | MNRRELTLLLCGAMTATRSLRAQQKAMPVVGYLGSES |
| Ga0307477_107265391 | 3300031753 | Hardwood Forest Soil | VNRRELLLWLGGAVSASRALHAQQKAMPVIGFLSGVSPETYT |
| Ga0307475_103653631 | 3300031754 | Hardwood Forest Soil | MRRRELMLLLLGGAMTAPRALRAQQKATPVIGLLGSIG |
| Ga0307475_113700191 | 3300031754 | Hardwood Forest Soil | MRRREFLLLLATNMITARAARAQQKTMPVIGWLSGVSPAPYASF |
| Ga0318537_100665701 | 3300031763 | Soil | MRRRELIVLLIGAMTAPRTLRAQQKAMPVIGYLGFA |
| Ga0318537_102375391 | 3300031763 | Soil | MRRREFLLLLATNMMAARAVRAQQKAMPVIGFLSSGLPDTD |
| Ga0318535_101148624 | 3300031764 | Soil | MTRRKLLLLLGGAMTASRVVRAQQKAMPVIGFLHGG |
| Ga0318535_102020181 | 3300031764 | Soil | MTRRELMMLLLGTAMMASRAVRAQQKAMPVIGYLNVFSPPTS |
| Ga0318554_103669231 | 3300031765 | Soil | MKRRELVLALGVAMMVARGTYAQQKPMPVIGYLNGTSPAANAESL |
| Ga0318554_105726881 | 3300031765 | Soil | MRRRELMILLGGAMTAPRALRAQQRAMPVIGSLYNNY |
| Ga0318546_112572391 | 3300031771 | Soil | VKRRELLLLLAGALTAPRALRAQQKAMPVIGWLSGA |
| Ga0318498_105536072 | 3300031778 | Soil | MNRRELMLLLGGAITAPCTLRAQQKAMPVIGFLSNETSDA |
| Ga0318508_10329384 | 3300031780 | Soil | MMKRRDFVLLLAGAMTAARSLGAQQKAMTVIGWLS |
| Ga0318508_10414843 | 3300031780 | Soil | VKRRDFVLLLAGAMTAARSLGAQQKAMTVIGWLSPLSPPSNLGDLV |
| Ga0318547_102096481 | 3300031781 | Soil | VNRRELMILLLGNAMAARALRAQQKAMPVIGYLNGTSPAANAESL |
| Ga0318552_101873222 | 3300031782 | Soil | MRRRELVLLLGGAVAAPAVLRAQQKAMPVIGILNIF |
| Ga0318552_105110401 | 3300031782 | Soil | MKRRDFVLLLAGAMTAARALRAQQKAMPVIGWLSSGSPDPLAPLV |
| Ga0318503_100905211 | 3300031794 | Soil | MTRRELLLLVGGAVTASRALRAQQKAMPVIGFLGSASPSHILAA |
| Ga0318557_102260043 | 3300031795 | Soil | VIKRRELVLLLGSAITVPRALRAQQKAMPVIGFLGLASPRP |
| Ga0318576_100703633 | 3300031796 | Soil | VDRRELMLLLAGAMGAPSAIRAQQKAVPVIGYLDR |
| Ga0318550_100536481 | 3300031797 | Soil | MKRRDFVLLLAGAMTAVRSLGAQQKAMSVVGQLSIYSPPANLRSPIRQGMS |
| Ga0318550_103235021 | 3300031797 | Soil | MRRREFLLLLATNMMAARAVRAQQKAMPVIGFLGVALLPA |
| Ga0318568_106663022 | 3300031819 | Soil | MTRRELLLLVGGAVTASRALRAQQKAMSVIGFLGSASPSHIL |
| Ga0307473_114114901 | 3300031820 | Hardwood Forest Soil | MRRREFLLLLGGAMAAASPLRAQQKAMPVIGFLNVTSAGSLA |
| Ga0307478_106195172 | 3300031823 | Hardwood Forest Soil | VTRRELMLLLGGAMTMARAPRAQQKAMPVIGWLSSGSPGTSAH |
| Ga0310917_106829272 | 3300031833 | Soil | MNRRQLMLLLGGAITAATGLRAQQKAMPVIGWLSSVSPGPLAHP |
| Ga0306925_101938604 | 3300031890 | Soil | MTRREFLLLLGAIMAGRPLHAQQKAMPVIGFLGSASPSHIV |
| Ga0306925_103667122 | 3300031890 | Soil | VNRREFVILMGTAMTAPRALRAQQKAMPVIGFLGSA |
| Ga0306925_104936373 | 3300031890 | Soil | VNRRKLTLLLGGAVTAPGAPHAQQKPLPVIGTSAA |
| Ga0306925_113661432 | 3300031890 | Soil | MMNRRELVLLVGGAMTAARASRAEQKAIPLIGFFNPTSP |
| Ga0306925_114111191 | 3300031890 | Soil | MNRREMLLLLGWAVIVPRTLRAQQKAMPVVGILGG |
| Ga0318536_101481791 | 3300031893 | Soil | MNRRELMLLLGGAITAPCTLRAQQKAMPVIGFLSNE |
| Ga0318536_101856881 | 3300031893 | Soil | MKRRELLLVLAGVMTGARGLCAQQRAMPVIGWLSSAS |
| Ga0318536_105327652 | 3300031893 | Soil | MNRRELVLLWGGVIAVARPLGAQQKAMPVIGYLSAT |
| Ga0318522_100807883 | 3300031894 | Soil | VIKRRELMLLLGSAITAPRALRAQQKAMPVIGFLN |
| Ga0318522_101374171 | 3300031894 | Soil | MRRRELILLLGGGLAVPRILRAQQKAMPVIGCLNATSPQY |
| Ga0318551_102679911 | 3300031896 | Soil | MRRRELLLLLATGTMGVRAVRAQQKAMPVIGFLGGG |
| Ga0318551_104235771 | 3300031896 | Soil | MKRRDFVLLLAGAMTAARSLAAQQKAMPVIGYLGSGTPG |
| Ga0318551_108488761 | 3300031896 | Soil | MNRREMLLLLGWAVIVPRTLRAQQKAMPVVGILGGGSSSAFA |
| Ga0318520_101362872 | 3300031897 | Soil | MKRRDFVLLLAGAMTAARSLAAQQKAMPVIGYLGS |
| Ga0318520_108402051 | 3300031897 | Soil | VIKRRELVLLLGSAITVPRALRAQQKAMPVIGFLGLASPR |
| Ga0306923_100903051 | 3300031910 | Soil | LKRRDLMLLLGGALTVARALRAQQKVIPVIGWLSSVSPGPSAHFV |
| Ga0306923_104186341 | 3300031910 | Soil | MNRRELVLLFGGAMTSARPLRAQQKAMPVIGYLGVSAPTAP |
| Ga0306923_122844002 | 3300031910 | Soil | MRRRELLLTATAMMAAPRSLRAQQKAMPVIGYLGSG |
| Ga0306921_108081031 | 3300031912 | Soil | MMNRREFLLLLGGAMTAARALRAQQKAMPVIGYLGSES |
| Ga0306921_110650092 | 3300031912 | Soil | MNRRELVLLFGGAMTSARPLRAQQKAMPVIGYLGVSAP |
| Ga0306921_117839981 | 3300031912 | Soil | VKRRELMLLLASAMMAPHAPRAQRKAMPVIGILSSGSPNAPLVATFR |
| Ga0306921_123005132 | 3300031912 | Soil | MRRRELILLLGGAMTAARALCAQQKAMPVIGFLGGASPGPF |
| Ga0306921_124518631 | 3300031912 | Soil | MMRRRELMLQLGGMMTLPQMLRAEQKTMPVIGFLSSVSTGLAAP |
| Ga0310912_100024581 | 3300031941 | Soil | MMKRRDFVLLLAGAMTAARSLGAQQKAMTVIGWLSP |
| Ga0310912_103447434 | 3300031941 | Soil | VKRRDFVLLLAGAMTAARSLGAQQKAMTVIGWLSPLSPPS |
| Ga0310912_109275262 | 3300031941 | Soil | MRRRELVLLLGGAVAAAAVLRAQQKAMLVIGILNIFSPP |
| Ga0310916_101144201 | 3300031942 | Soil | MNRRELMLLLGGAITAPCTLRAQQKAMPVIGFLSNETSDTFAPAV |
| Ga0310913_104368622 | 3300031945 | Soil | VRRRELLALLAGAMTTPRALRAQQKAMPVIGFLHFG |
| Ga0310913_105621883 | 3300031945 | Soil | MNRRELMLLLGGAITAPCTLRAQQKAMPVIGFLSNETP |
| Ga0310910_104558473 | 3300031946 | Soil | MHRRCFIALLGAAITAAPALRAQQKAMPVIGILNSA |
| Ga0310910_107957862 | 3300031946 | Soil | VKRRELLLLLCGAVTAPRAPRAQQKAMPVIGFLNPTSAGSL |
| Ga0310910_108518601 | 3300031946 | Soil | VRRRDFVLLLAGAMTAARALRAQQKAMPVIGWLSVNSP |
| Ga0310910_113601262 | 3300031946 | Soil | MKRRELLVLLGGAMAVARPLLAQQKKMPVIGFLSSASPAPT |
| Ga0310910_113949732 | 3300031946 | Soil | MRRRELMLMLGGAMTAPGALLAQQKAMPVIGFLGSTSLDPNAP |
| Ga0310909_108231962 | 3300031947 | Soil | MKRRDLMLLVAGTMTAARTPRAQQKAIPVIGWLSSVTAGPLAHLVAAF |
| Ga0310909_110876603 | 3300031947 | Soil | MNRRNLMLLLGGAMVATPSLRAQQKAMPVIGFLSGAS |
| Ga0306926_101512868 | 3300031954 | Soil | MKRRDLMLLLAGAMTAARALYAQQKAMPVIGFLSSGSHD |
| Ga0306926_130165121 | 3300031954 | Soil | MKRRDLMLLVAGAVTAARTPRAQQKAMPVIGWLSSVSPDP |
| Ga0318530_100300063 | 3300031959 | Soil | MRRRELLLLVGGAVTAPHALRAQQKAMPVIGVLSSTTPGSSAA |
| Ga0307479_117397871 | 3300031962 | Hardwood Forest Soil | MNRRTLLLLLSSAVMVSTALRAQRKAMPVIGFLGVGSPG |
| Ga0318531_102943161 | 3300031981 | Soil | MRRRELMLMLGGAMTAPRALLAQQKAMPVIGYLNV |
| Ga0306922_101294804 | 3300032001 | Soil | MNRRELMLLLGGAITAPCTLRAQQKAMPVIGFLSNET |
| Ga0306922_121124331 | 3300032001 | Soil | MKRRELVLALGVAMMVARGTYAQQKPMPVIGYLNGTSPAANAESLA |
| Ga0318569_104012592 | 3300032010 | Soil | VSRRELLLLLAWAVIAPRTLRAQQKAMPVIGFLCS |
| Ga0318507_103543781 | 3300032025 | Soil | MTRRELMMLLLGTAMMASRAVRAQQKAMPVIGYLN |
| Ga0318507_105228771 | 3300032025 | Soil | MKRRDFVLLVGAALTTARALRAQQKAMPVVGFLSGAASDGY |
| Ga0310911_101914771 | 3300032035 | Soil | MRRRELILLVGGAITTARGLCAQQKGMPVIGFFGIGSP |
| Ga0310911_104416441 | 3300032035 | Soil | MRRRELLRLLGGAVTAAQALHAQQKAMPVIGFLGVGSPDSQAALT |
| Ga0310911_106225261 | 3300032035 | Soil | MNRRAAILLLSGAAVAPRALRAQQKAMPVIGFLIGTS |
| Ga0318559_101241972 | 3300032039 | Soil | MKRRELLLLLCGATTAPRALRAQQKMMPVIGFLDGYWPPP |
| Ga0318549_101027782 | 3300032041 | Soil | MNRRELMLLLAGVMIAPRALQAQRQGAMPVIGWLGSGSPDPFAPL |
| Ga0318549_101749262 | 3300032041 | Soil | MNRRKLMLLLGGTMTPLRSLRAQHKAIPVIGYLSS |
| Ga0318549_103804771 | 3300032041 | Soil | VRRREFVLLLGGAMTAARALHAQQKALPVIGYLNATSPRPYA |
| Ga0318545_103924511 | 3300032042 | Soil | MNRRKFLLLLSGAMAVARPLRAQQKAMPVIGYLGS |
| Ga0318556_103952231 | 3300032043 | Soil | MNRRELMLLLAGVMIAPRALQAQRQGAMPVIGWLGSGSPDPFAPLAVAFG |
| Ga0318556_107615811 | 3300032043 | Soil | MTRRQFMLLLSAAIMTARALRAQQKAMPVIGYLSPGSPGAAA |
| Ga0318558_104487651 | 3300032044 | Soil | VRRRELVLLLSGAMTAPRALRAQQKAMPVIGVLAVS |
| Ga0318558_106256423 | 3300032044 | Soil | MNRRELMLLLGGAITAPCTLRAQQKAMPVIGFLSNETSDT |
| Ga0318532_1000161712 | 3300032051 | Soil | MMKRRDFVLLLAGAMTAARSLGAQQKAMTVIGWLSPLSPP |
| Ga0318506_102128291 | 3300032052 | Soil | VIKRREFLLLLGGAMTAARPLRAQQKAMPVIGYLG |
| Ga0318506_105499622 | 3300032052 | Soil | VSRRELLLLLAWAVITPRTLRAQQKAMPVIGFLSSG |
| Ga0318575_100034631 | 3300032055 | Soil | MKRRDFVLLLGGAMTAARALRAQQMAMPVIGFLHFA |
| Ga0318575_103733981 | 3300032055 | Soil | VKRRELLLLLCGAVTAPRAPCAQQKAMPVIGFLNPT |
| Ga0318575_106179872 | 3300032055 | Soil | MKRRELMLLLGGMMTVARTLRAQQKPMPVIGLLSSVS |
| Ga0318533_108593541 | 3300032059 | Soil | VTRRELVLLLGGAMTTARPLRAQEKPLPVIGFLGSTS |
| Ga0318533_112242472 | 3300032059 | Soil | MNRRELVLLVTTATIAPRALPAQQKAMPVIGYLSGVSHG |
| Ga0318505_102732661 | 3300032060 | Soil | MTRRELLLLCTAMTAPRALRAQQKAMSVIGYLSSTSPGSNA |
| Ga0318510_101964843 | 3300032064 | Soil | MKRRELILLLAGAMTAPRPLRAQQKAMPVIGFLNS |
| Ga0318513_105047711 | 3300032065 | Soil | MNRRELVLLLGCAVAAPHAPSAQQKAMPVIGVLNIT |
| Ga0318514_100264781 | 3300032066 | Soil | MKRRDLLLLGSAMAAGARPLRAQQKAMPVIGFLQATPQNP |
| Ga0318524_103639531 | 3300032067 | Soil | VKRRDFVLLLAGAMTAARALRAQQQKAMPVIGWLSIGSRE |
| Ga0306924_112208911 | 3300032076 | Soil | MKRRQLMLLLGGAMTAATGLRAQKKAVPVIGFMAFGSPVLNP |
| Ga0318518_103406261 | 3300032090 | Soil | VNRREFVILMGTAMTAPRALRAQQKAMPVIGFLGSASPD |
| Ga0318540_103673432 | 3300032094 | Soil | MRRRDLIILLAGAVTAAHALRAQQKAMPVIGFLCGGSPD |
| Ga0307470_108998882 | 3300032174 | Hardwood Forest Soil | MNRREVMLLLGGAMTTAPEVQAQQKAMSVIGFLGSAS |
| Ga0307471_1022117922 | 3300032180 | Hardwood Forest Soil | MLVLAGAMTAPRALRAQQKATPVIGYLGSESLAHLHLLSTRSATD |
| Ga0307472_1017293781 | 3300032205 | Hardwood Forest Soil | MRRREVMVLLGAMTAARALRAQQKAMPVIGFLTAFSP |
| Ga0306920_10003603910 | 3300032261 | Soil | MRRRELIVLLIGAMTAPRTLRAQQKAMPVIGYLGF |
| Ga0306920_1018875641 | 3300032261 | Soil | MRRRELLLLLAVGMMAARLVHAQQKAMPVIGYLSAI |
| Ga0306920_1027891651 | 3300032261 | Soil | VKRRELLLLLSGTMTAPCAPRAQQKALPVIGYLNATSPRPYAANVA |
| Ga0306920_1043700902 | 3300032261 | Soil | MRRRQFMLLLGGTLAAAPGLGAQQKAMPVIGFLSSGPS |
| Ga0310914_102536771 | 3300033289 | Soil | MNRRELLLLFGSVIMVPRRSRAQQKAMPAIGFLGTTSPGPFAP |
| Ga0310914_104761171 | 3300033289 | Soil | VRRRDFVLLLAGAMTAARALRAQQKAMPVIGWLSVNSPPQT |
| Ga0310914_114767573 | 3300033289 | Soil | MKRRELLLLLGGALVTARRLRAQQKAMPVIGFLSSGSP |
| ⦗Top⦘ |