


| Basic Information | |
|---|---|
| Family ID | F006861 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 363 |
| Average Sequence Length | 37 residues |
| Representative Sequence | MIAHNPLHGSGRAGFPHPALALGDDAHAAQGIGMTD |
| Number of Associated Samples | 254 |
| Number of Associated Scaffolds | 363 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 98.05 % |
| % of genes near scaffold ends (potentially truncated) | 98.35 % |
| % of genes from short scaffolds (< 2000 bps) | 67.22 % |
| Associated GOLD sequencing projects | 235 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.26 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (79.339 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (16.529 % of family members) |
| Environment Ontology (ENVO) | Unclassified (22.314 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (45.179 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 25.00% β-sheet: 0.00% Coil/Unstructured: 75.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.26 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 363 Family Scaffolds |
|---|---|---|
| PF16925 | TetR_C_13 | 1.38 |
| PF00873 | ACR_tran | 1.10 |
| PF03795 | YCII | 1.10 |
| PF13442 | Cytochrome_CBB3 | 1.10 |
| PF02627 | CMD | 0.83 |
| PF03551 | PadR | 0.83 |
| PF05988 | DUF899 | 0.83 |
| PF01872 | RibD_C | 0.83 |
| PF07238 | PilZ | 0.83 |
| PF12840 | HTH_20 | 0.83 |
| PF13432 | TPR_16 | 0.83 |
| PF08240 | ADH_N | 0.83 |
| PF12833 | HTH_18 | 0.83 |
| PF00589 | Phage_integrase | 0.83 |
| PF13365 | Trypsin_2 | 0.83 |
| PF13561 | adh_short_C2 | 0.55 |
| PF00196 | GerE | 0.55 |
| PF00578 | AhpC-TSA | 0.55 |
| PF02371 | Transposase_20 | 0.55 |
| PF04342 | DMT_6 | 0.55 |
| PF00005 | ABC_tran | 0.55 |
| PF00436 | SSB | 0.55 |
| PF02321 | OEP | 0.55 |
| PF08241 | Methyltransf_11 | 0.55 |
| PF00561 | Abhydrolase_1 | 0.55 |
| PF08669 | GCV_T_C | 0.55 |
| PF09844 | DUF2071 | 0.55 |
| PF13517 | FG-GAP_3 | 0.55 |
| PF13460 | NAD_binding_10 | 0.55 |
| PF02899 | Phage_int_SAM_1 | 0.55 |
| PF00486 | Trans_reg_C | 0.55 |
| PF13620 | CarboxypepD_reg | 0.55 |
| PF11154 | DUF2934 | 0.55 |
| PF01842 | ACT | 0.55 |
| PF02954 | HTH_8 | 0.55 |
| PF07700 | HNOB | 0.55 |
| PF01022 | HTH_5 | 0.55 |
| PF13649 | Methyltransf_25 | 0.55 |
| PF03928 | HbpS-like | 0.55 |
| PF03793 | PASTA | 0.55 |
| PF13490 | zf-HC2 | 0.55 |
| PF00106 | adh_short | 0.55 |
| PF15919 | HicB_lk_antitox | 0.55 |
| PF01940 | DUF92 | 0.55 |
| PF01695 | IstB_IS21 | 0.55 |
| PF07813 | LTXXQ | 0.55 |
| PF08401 | ArdcN | 0.28 |
| PF00759 | Glyco_hydro_9 | 0.28 |
| PF03734 | YkuD | 0.28 |
| PF02384 | N6_Mtase | 0.28 |
| PF04430 | DUF498 | 0.28 |
| PF11412 | DsbC | 0.28 |
| PF00156 | Pribosyltran | 0.28 |
| PF13545 | HTH_Crp_2 | 0.28 |
| PF09990 | DUF2231 | 0.28 |
| PF04773 | FecR | 0.28 |
| PF13604 | AAA_30 | 0.28 |
| PF01909 | NTP_transf_2 | 0.28 |
| PF01471 | PG_binding_1 | 0.28 |
| PF14490 | HHH_4 | 0.28 |
| PF04224 | DUF417 | 0.28 |
| PF01850 | PIN | 0.28 |
| PF13522 | GATase_6 | 0.28 |
| PF00144 | Beta-lactamase | 0.28 |
| PF03916 | NrfD | 0.28 |
| PF01120 | Alpha_L_fucos | 0.28 |
| PF03477 | ATP-cone | 0.28 |
| PF02730 | AFOR_N | 0.28 |
| PF00004 | AAA | 0.28 |
| PF02113 | Peptidase_S13 | 0.28 |
| PF09723 | Zn-ribbon_8 | 0.28 |
| PF13358 | DDE_3 | 0.28 |
| PF13520 | AA_permease_2 | 0.28 |
| PF03923 | Lipoprotein_16 | 0.28 |
| PF13366 | PDDEXK_3 | 0.28 |
| PF03591 | AzlC | 0.28 |
| PF01068 | DNA_ligase_A_M | 0.28 |
| PF12713 | DUF3806 | 0.28 |
| PF01370 | Epimerase | 0.28 |
| PF01425 | Amidase | 0.28 |
| PF03358 | FMN_red | 0.28 |
| PF02502 | LacAB_rpiB | 0.28 |
| PF00912 | Transgly | 0.28 |
| PF02567 | PhzC-PhzF | 0.28 |
| PF13847 | Methyltransf_31 | 0.28 |
| PF08281 | Sigma70_r4_2 | 0.28 |
| PF08751 | TrwC | 0.28 |
| PF13183 | Fer4_8 | 0.28 |
| PF04055 | Radical_SAM | 0.28 |
| PF03705 | CheR_N | 0.28 |
| PF00902 | TatC | 0.28 |
| PF02470 | MlaD | 0.28 |
| PF05015 | HigB-like_toxin | 0.28 |
| PF01656 | CbiA | 0.28 |
| PF01402 | RHH_1 | 0.28 |
| PF14319 | Zn_Tnp_IS91 | 0.28 |
| PF04454 | Linocin_M18 | 0.28 |
| PF01339 | CheB_methylest | 0.28 |
| PF02566 | OsmC | 0.28 |
| PF09862 | DUF2089 | 0.28 |
| PF02586 | SRAP | 0.28 |
| PF09656 | PGPGW | 0.28 |
| PF02142 | MGS | 0.28 |
| PF07969 | Amidohydro_3 | 0.28 |
| PF02782 | FGGY_C | 0.28 |
| PF03796 | DnaB_C | 0.28 |
| PF04945 | YHS | 0.28 |
| PF07589 | PEP-CTERM | 0.28 |
| PF02452 | PemK_toxin | 0.28 |
| PF10073 | DUF2312 | 0.28 |
| PF00210 | Ferritin | 0.28 |
| PF04679 | DNA_ligase_A_C | 0.28 |
| PF00437 | T2SSE | 0.28 |
| PF12704 | MacB_PCD | 0.28 |
| PF02082 | Rrf2 | 0.28 |
| PF09594 | GT87 | 0.28 |
| PF01259 | SAICAR_synt | 0.28 |
| PF00881 | Nitroreductase | 0.28 |
| PF04116 | FA_hydroxylase | 0.28 |
| PF01274 | Malate_synthase | 0.28 |
| PF08530 | PepX_C | 0.28 |
| PF06826 | Asp-Al_Ex | 0.28 |
| PF03200 | Glyco_hydro_63 | 0.28 |
| PF02515 | CoA_transf_3 | 0.28 |
| PF00300 | His_Phos_1 | 0.28 |
| PF13772 | AIG2_2 | 0.28 |
| PF00072 | Response_reg | 0.28 |
| PF04255 | DUF433 | 0.28 |
| PF13458 | Peripla_BP_6 | 0.28 |
| PF04536 | TPM_phosphatase | 0.28 |
| PF14833 | NAD_binding_11 | 0.28 |
| PF13115 | YtkA | 0.28 |
| PF13489 | Methyltransf_23 | 0.28 |
| PF13276 | HTH_21 | 0.28 |
| PF02837 | Glyco_hydro_2_N | 0.28 |
| PF00282 | Pyridoxal_deC | 0.28 |
| PF05977 | MFS_3 | 0.28 |
| PF05768 | Glrx-like | 0.28 |
| PF00440 | TetR_N | 0.28 |
| PF13646 | HEAT_2 | 0.28 |
| PF01738 | DLH | 0.28 |
| PF07681 | DoxX | 0.28 |
| PF16576 | HlyD_D23 | 0.28 |
| PF07944 | Glyco_hydro_127 | 0.28 |
| PF15780 | ASH | 0.28 |
| PF05088 | Bac_GDH | 0.28 |
| PF13784 | Fic_N | 0.28 |
| PF12146 | Hydrolase_4 | 0.28 |
| PF11453 | DUF2950 | 0.28 |
| PF13692 | Glyco_trans_1_4 | 0.28 |
| PF01011 | PQQ | 0.28 |
| PF02225 | PA | 0.28 |
| PF01208 | URO-D | 0.28 |
| PF00166 | Cpn10 | 0.28 |
| PF13450 | NAD_binding_8 | 0.28 |
| PF07638 | Sigma70_ECF | 0.28 |
| PF00753 | Lactamase_B | 0.28 |
| PF03938 | OmpH | 0.28 |
| PF13451 | zf-trcl | 0.28 |
| PF07883 | Cupin_2 | 0.28 |
| PF08570 | DUF1761 | 0.28 |
| PF08447 | PAS_3 | 0.28 |
| PF01206 | TusA | 0.28 |
| PF14087 | DUF4267 | 0.28 |
| PF03458 | Gly_transporter | 0.28 |
| PF11954 | DUF3471 | 0.28 |
| PF13408 | Zn_ribbon_recom | 0.28 |
| PF00891 | Methyltransf_2 | 0.28 |
| PF00496 | SBP_bac_5 | 0.28 |
| PF12832 | MFS_1_like | 0.28 |
| PF01734 | Patatin | 0.28 |
| PF01116 | F_bP_aldolase | 0.28 |
| PF00383 | dCMP_cyt_deam_1 | 0.28 |
| PF01243 | Putative_PNPOx | 0.28 |
| PF00135 | COesterase | 0.28 |
| PF08818 | DUF1801 | 0.28 |
| PF11737 | DUF3300 | 0.28 |
| PF03136 | Pup_ligase | 0.28 |
| PF11941 | DUF3459 | 0.28 |
| PF12852 | Cupin_6 | 0.28 |
| PF01261 | AP_endonuc_2 | 0.28 |
| PF00701 | DHDPS | 0.28 |
| PF00821 | PEPCK_GTP | 0.28 |
| PF03929 | PepSY_TM | 0.28 |
| PF02881 | SRP54_N | 0.28 |
| PF02738 | MoCoBD_1 | 0.28 |
| PF01663 | Phosphodiest | 0.28 |
| PF02913 | FAD-oxidase_C | 0.28 |
| PF04545 | Sigma70_r4 | 0.28 |
| PF09588 | YqaJ | 0.28 |
| PF01047 | MarR | 0.28 |
| PF03466 | LysR_substrate | 0.28 |
| PF07394 | DUF1501 | 0.28 |
| PF00702 | Hydrolase | 0.28 |
| COG ID | Name | Functional Category | % Frequency in 363 Family Scaffolds |
|---|---|---|---|
| COG3678 | Periplasmic chaperone Spy, Spy/CpxP family | Posttranslational modification, protein turnover, chaperones [O] | 2.20 |
| COG1538 | Outer membrane protein TolC | Cell wall/membrane/envelope biogenesis [M] | 1.10 |
| COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 1.10 |
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.83 |
| COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 0.83 |
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.83 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.83 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.83 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.83 |
| COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 0.83 |
| COG4312 | Predicted dithiol-disulfide oxidoreductase, DUF899 family | General function prediction only [R] | 0.83 |
| COG0329 | 4-hydroxy-tetrahydrodipicolinate synthase/N-acetylneuraminate lyase | Cell wall/membrane/envelope biogenesis [M] | 0.55 |
| COG0629 | Single-stranded DNA-binding protein | Replication, recombination and repair [L] | 0.55 |
| COG1352 | Methylase of chemotaxis methyl-accepting proteins | Signal transduction mechanisms [T] | 0.55 |
| COG1484 | DNA replication protein DnaC | Replication, recombination and repair [L] | 0.55 |
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 0.55 |
| COG1836 | Cytidylyltransferase family enzyme | General function prediction only [R] | 0.55 |
| COG2201 | Chemotaxis response regulator CheB, contains REC and protein-glutamate methylesterase domains | Signal transduction mechanisms [T] | 0.55 |
| COG2965 | Primosomal replication protein N | Replication, recombination and repair [L] | 0.55 |
| COG3169 | Uncharacterized membrane protein, DMT/DUF486 family | Function unknown [S] | 0.55 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.55 |
| COG4973 | Site-specific recombinase XerC | Replication, recombination and repair [L] | 0.55 |
| COG4974 | Site-specific recombinase XerD | Replication, recombination and repair [L] | 0.55 |
| COG0076 | Glutamate or tyrosine decarboxylase or a related PLP-dependent protein | Amino acid transport and metabolism [E] | 0.28 |
| COG0152 | Phosphoribosylaminoimidazole-succinocarboxamide synthase | Nucleotide transport and metabolism [F] | 0.28 |
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 0.28 |
| COG0191 | Fructose/tagatose bisphosphate aldolase | Carbohydrate transport and metabolism [G] | 0.28 |
| COG0234 | Co-chaperonin GroES (HSP10) | Posttranslational modification, protein turnover, chaperones [O] | 0.28 |
| COG0277 | FAD/FMN-containing lactate dehydrogenase/glycolate oxidase | Energy production and conversion [C] | 0.28 |
| COG0305 | Replicative DNA helicase | Replication, recombination and repair [L] | 0.28 |
| COG0384 | Predicted epimerase YddE/YHI9, PhzF superfamily | General function prediction only [R] | 0.28 |
| COG0407 | Uroporphyrinogen-III decarboxylase HemE | Coenzyme transport and metabolism [H] | 0.28 |
| COG0425 | Sulfur carrier protein TusA (tRNA thiolation, molybdenum cofactor biosynthesis) | Translation, ribosomal structure and biogenesis [J] | 0.28 |
| COG0640 | DNA-binding transcriptional regulator, ArsR family | Transcription [K] | 0.28 |
| COG0695 | Glutaredoxin | Posttranslational modification, protein turnover, chaperones [O] | 0.28 |
| COG0698 | Ribose 5-phosphate isomerase RpiB | Carbohydrate transport and metabolism [G] | 0.28 |
| COG0744 | Penicillin-binding protein 1B/1F, peptidoglycan transglycosylase/transpeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.28 |
| COG0805 | Twin-arginine protein secretion pathway component TatC | Intracellular trafficking, secretion, and vesicular transport [U] | 0.28 |
| COG1066 | DNA repair protein RadA/Sms, contains AAA+ ATPase domain | Replication, recombination and repair [L] | 0.28 |
| COG1274 | Phosphoenolpyruvate carboxykinase, GTP-dependent | Energy production and conversion [C] | 0.28 |
| COG1296 | Predicted branched-chain amino acid permease (azaleucine resistance) | Amino acid transport and metabolism [E] | 0.28 |
| COG1376 | Lipoprotein-anchoring transpeptidase ErfK/SrfK | Cell wall/membrane/envelope biogenesis [M] | 0.28 |
| COG1414 | DNA-binding transcriptional regulator, IclR family | Transcription [K] | 0.28 |
| COG1423 | ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family | Replication, recombination and repair [L] | 0.28 |
| COG1504 | Uncharacterized conserved protein, DUF498 domain | Function unknown [S] | 0.28 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.28 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.28 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.28 |
| COG1725 | DNA-binding transcriptional regulator YhcF, GntR family | Transcription [K] | 0.28 |
| COG1752 | Predicted acylesterase/phospholipase RssA, containd patatin domain | General function prediction only [R] | 0.28 |
| COG1764 | Organic hydroperoxide reductase OsmC/OhrA | Defense mechanisms [V] | 0.28 |
| COG1765 | Uncharacterized OsmC-related protein | General function prediction only [R] | 0.28 |
| COG1804 | Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases | Lipid transport and metabolism [I] | 0.28 |
| COG1959 | DNA-binding transcriptional regulator, IscR family | Transcription [K] | 0.28 |
| COG2027 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.28 |
| COG2135 | ssDNA abasic site-binding protein YedK/HMCES, SRAP family | Replication, recombination and repair [L] | 0.28 |
| COG2186 | DNA-binding transcriptional regulator, FadR family | Transcription [K] | 0.28 |
| COG2188 | DNA-binding transcriptional regulator, GntR family | Transcription [K] | 0.28 |
| COG2225 | Malate synthase | Energy production and conversion [C] | 0.28 |
| COG2259 | Uncharacterized membrane protein YphA, DoxX/SURF4 family | Function unknown [S] | 0.28 |
| COG2272 | Carboxylesterase type B | Lipid transport and metabolism [I] | 0.28 |
| COG2337 | mRNA-degrading endonuclease MazF, toxin component of the MazEF toxin-antitoxin module | Defense mechanisms [V] | 0.28 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.28 |
| COG2378 | Predicted DNA-binding transcriptional regulator YobV, contains HTH and WYL domains | Transcription [K] | 0.28 |
| COG2414 | Aldehyde:ferredoxin oxidoreductase | Energy production and conversion [C] | 0.28 |
| COG2442 | Predicted antitoxin component of a toxin-antitoxin system, DUF433 family | Defense mechanisms [V] | 0.28 |
| COG2524 | Predicted transcriptional regulator, contains C-terminal CBS domains | Transcription [K] | 0.28 |
| COG2814 | Predicted arabinose efflux permease AraJ, MFS family | Carbohydrate transport and metabolism [G] | 0.28 |
| COG2825 | Periplasmic chaperone for outer membrane proteins, Skp family | Cell wall/membrane/envelope biogenesis [M] | 0.28 |
| COG2860 | Uncharacterized membrane protein YeiH | Function unknown [S] | 0.28 |
| COG2902 | NAD-specific glutamate dehydrogenase | Amino acid transport and metabolism [E] | 0.28 |
| COG2936 | Predicted acyl esterase | General function prediction only [R] | 0.28 |
| COG2985 | Uncharacterized membrane protein YbjL, putative transporter | General function prediction only [R] | 0.28 |
| COG3000 | Sterol desaturase/sphingolipid hydroxylase, fatty acid hydroxylase superfamily | Lipid transport and metabolism [I] | 0.28 |
| COG3034 | Murein L,D-transpeptidase YafK | Cell wall/membrane/envelope biogenesis [M] | 0.28 |
| COG3056 | Uncharacterized lipoprotein YajG | Function unknown [S] | 0.28 |
| COG3059 | Reactive chlorine resistance protein RclC/YkgB, DUF417 family | Defense mechanisms [V] | 0.28 |
| COG3118 | Chaperedoxin CnoX, contains thioredoxin-like and TPR-like domains, YbbN/TrxSC family | Posttranslational modification, protein turnover, chaperones [O] | 0.28 |
| COG3182 | PepSY-associated TM region | Function unknown [S] | 0.28 |
| COG3250 | Beta-galactosidase/beta-glucuronidase | Carbohydrate transport and metabolism [G] | 0.28 |
| COG3295 | Uncharacterized conserved protein | Function unknown [S] | 0.28 |
| COG3533 | Beta-L-arabinofuranosidase, GH127 family | Carbohydrate transport and metabolism [G] | 0.28 |
| COG3549 | Plasmid maintenance system killer protein | Defense mechanisms [V] | 0.28 |
| COG3621 | Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotR | General function prediction only [R] | 0.28 |
| COG3669 | Alpha-L-fucosidase | Carbohydrate transport and metabolism [G] | 0.28 |
| COG3737 | Uncharacterized protein, contains Mth938-like domain | Function unknown [S] | 0.28 |
| COG4227 | Antirestriction protein ArdC | Replication, recombination and repair [L] | 0.28 |
| COG4270 | Uncharacterized membrane protein | Function unknown [S] | 0.28 |
| COG4430 | Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 family | Function unknown [S] | 0.28 |
| COG4667 | Predicted phospholipase, patatin/cPLA2 family | Lipid transport and metabolism [I] | 0.28 |
| COG4953 | Membrane carboxypeptidase/penicillin-binding protein PbpC | Cell wall/membrane/envelope biogenesis [M] | 0.28 |
| COG5009 | Membrane carboxypeptidase/penicillin-binding protein | Cell wall/membrane/envelope biogenesis [M] | 0.28 |
| COG5646 | Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis) | Posttranslational modification, protein turnover, chaperones [O] | 0.28 |
| COG5649 | Uncharacterized conserved protein, DUF1801 domain | Function unknown [S] | 0.28 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 79.34 % |
| Unclassified | root | N/A | 20.66 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001213|JGIcombinedJ13530_105880241 | Not Available | 609 | Open in IMG/M |
| 3300004475|Ga0068969_1476792 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300005167|Ga0066672_10003927 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella mallensis | 6316 | Open in IMG/M |
| 3300005174|Ga0066680_10284473 | All Organisms → cellular organisms → Bacteria | 1054 | Open in IMG/M |
| 3300005176|Ga0066679_10011227 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella mallensis | 4444 | Open in IMG/M |
| 3300005177|Ga0066690_10549170 | All Organisms → cellular organisms → Bacteria | 773 | Open in IMG/M |
| 3300005177|Ga0066690_10827724 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 598 | Open in IMG/M |
| 3300005180|Ga0066685_10019360 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 4045 | Open in IMG/M |
| 3300005187|Ga0066675_10144431 | Not Available | 1626 | Open in IMG/M |
| 3300005450|Ga0066682_10009189 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5106 | Open in IMG/M |
| 3300005468|Ga0070707_100424813 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1289 | Open in IMG/M |
| 3300005540|Ga0066697_10094908 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1734 | Open in IMG/M |
| 3300005542|Ga0070732_10785059 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 581 | Open in IMG/M |
| 3300005552|Ga0066701_10090211 | All Organisms → cellular organisms → Bacteria | 1773 | Open in IMG/M |
| 3300005553|Ga0066695_10046879 | All Organisms → cellular organisms → Bacteria | 2558 | Open in IMG/M |
| 3300005554|Ga0066661_10041718 | All Organisms → cellular organisms → Bacteria | 2592 | Open in IMG/M |
| 3300005557|Ga0066704_10005379 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 6553 | Open in IMG/M |
| 3300005557|Ga0066704_10038630 | All Organisms → cellular organisms → Bacteria | 2960 | Open in IMG/M |
| 3300005598|Ga0066706_10002801 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 7683 | Open in IMG/M |
| 3300005921|Ga0070766_10044804 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2465 | Open in IMG/M |
| 3300006041|Ga0075023_100423856 | Not Available | 581 | Open in IMG/M |
| 3300006046|Ga0066652_101393295 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 656 | Open in IMG/M |
| 3300006172|Ga0075018_10575729 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300006358|Ga0068871_101761620 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 588 | Open in IMG/M |
| 3300006794|Ga0066658_10595234 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 602 | Open in IMG/M |
| 3300006796|Ga0066665_10068408 | All Organisms → cellular organisms → Bacteria | 2513 | Open in IMG/M |
| 3300006796|Ga0066665_10867665 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 703 | Open in IMG/M |
| 3300006796|Ga0066665_11377862 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 545 | Open in IMG/M |
| 3300006865|Ga0073934_10145514 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia | 1698 | Open in IMG/M |
| 3300006893|Ga0073928_10001118 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 53511 | Open in IMG/M |
| 3300006893|Ga0073928_10002827 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 28698 | Open in IMG/M |
| 3300006893|Ga0073928_10028976 | All Organisms → cellular organisms → Bacteria | 5384 | Open in IMG/M |
| 3300006893|Ga0073928_10111499 | All Organisms → cellular organisms → Bacteria | 2272 | Open in IMG/M |
| 3300006893|Ga0073928_10160016 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1806 | Open in IMG/M |
| 3300007255|Ga0099791_10416882 | Not Available | 647 | Open in IMG/M |
| 3300007265|Ga0099794_10003159 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 6244 | Open in IMG/M |
| 3300007265|Ga0099794_10036123 | Not Available | 2334 | Open in IMG/M |
| 3300007265|Ga0099794_10452388 | Not Available | 673 | Open in IMG/M |
| 3300007265|Ga0099794_10665462 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 553 | Open in IMG/M |
| 3300007788|Ga0099795_10539770 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 548 | Open in IMG/M |
| 3300009012|Ga0066710_100439804 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_4_58_4 | 1953 | Open in IMG/M |
| 3300009038|Ga0099829_10142846 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella mallensis | 1904 | Open in IMG/M |
| 3300009038|Ga0099829_10211649 | All Organisms → cellular organisms → Bacteria | 1572 | Open in IMG/M |
| 3300009090|Ga0099827_10207979 | All Organisms → cellular organisms → Bacteria | 1630 | Open in IMG/M |
| 3300009090|Ga0099827_10733336 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 854 | Open in IMG/M |
| 3300009095|Ga0079224_103828308 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300009137|Ga0066709_100508806 | All Organisms → cellular organisms → Bacteria | 1697 | Open in IMG/M |
| 3300009137|Ga0066709_104158380 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300009157|Ga0105092_10148848 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1299 | Open in IMG/M |
| 3300009162|Ga0075423_11557257 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
| 3300009444|Ga0114945_10188203 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1194 | Open in IMG/M |
| 3300009499|Ga0114930_10008652 | All Organisms → cellular organisms → Bacteria | 7853 | Open in IMG/M |
| 3300009509|Ga0123573_11491817 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 629 | Open in IMG/M |
| 3300009702|Ga0114931_10100950 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae | 2510 | Open in IMG/M |
| 3300009802|Ga0105073_1047354 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 560 | Open in IMG/M |
| 3300010043|Ga0126380_11959718 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 535 | Open in IMG/M |
| 3300010048|Ga0126373_10120601 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2452 | Open in IMG/M |
| 3300010048|Ga0126373_10146331 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2241 | Open in IMG/M |
| 3300010373|Ga0134128_10199697 | All Organisms → cellular organisms → Bacteria | 2252 | Open in IMG/M |
| 3300010376|Ga0126381_100996030 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1209 | Open in IMG/M |
| 3300010379|Ga0136449_104657293 | Not Available | 502 | Open in IMG/M |
| 3300010398|Ga0126383_10628691 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1147 | Open in IMG/M |
| 3300010398|Ga0126383_10766567 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 1046 | Open in IMG/M |
| 3300010430|Ga0118733_107669788 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300011080|Ga0138568_1192067 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 770 | Open in IMG/M |
| 3300011118|Ga0114922_10107198 | Not Available | 2389 | Open in IMG/M |
| 3300011120|Ga0150983_16689120 | All Organisms → cellular organisms → Bacteria | 867 | Open in IMG/M |
| 3300011269|Ga0137392_10078274 | All Organisms → cellular organisms → Bacteria | 2561 | Open in IMG/M |
| 3300011270|Ga0137391_10324312 | All Organisms → cellular organisms → Bacteria | 1326 | Open in IMG/M |
| 3300011270|Ga0137391_10603576 | All Organisms → cellular organisms → Bacteria | 920 | Open in IMG/M |
| 3300012096|Ga0137389_11110755 | Not Available | 677 | Open in IMG/M |
| 3300012199|Ga0137383_10052627 | All Organisms → cellular organisms → Bacteria | 2912 | Open in IMG/M |
| 3300012202|Ga0137363_10048011 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 3046 | Open in IMG/M |
| 3300012202|Ga0137363_11331077 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 607 | Open in IMG/M |
| 3300012203|Ga0137399_10004416 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 7497 | Open in IMG/M |
| 3300012203|Ga0137399_11770989 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 506 | Open in IMG/M |
| 3300012205|Ga0137362_10122635 | Not Available | 2205 | Open in IMG/M |
| 3300012205|Ga0137362_10865027 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 773 | Open in IMG/M |
| 3300012207|Ga0137381_10120501 | All Organisms → cellular organisms → Bacteria | 2240 | Open in IMG/M |
| 3300012208|Ga0137376_11495052 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300012210|Ga0137378_10017129 | All Organisms → cellular organisms → Bacteria | 6322 | Open in IMG/M |
| 3300012210|Ga0137378_10216041 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium → Mycolicibacterium sphagni | 1785 | Open in IMG/M |
| 3300012211|Ga0137377_10363954 | All Organisms → cellular organisms → Bacteria | 1383 | Open in IMG/M |
| 3300012211|Ga0137377_10935651 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 798 | Open in IMG/M |
| 3300012349|Ga0137387_10107944 | All Organisms → cellular organisms → Bacteria | 1948 | Open in IMG/M |
| 3300012349|Ga0137387_10442002 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 943 | Open in IMG/M |
| 3300012349|Ga0137387_10826708 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 670 | Open in IMG/M |
| 3300012349|Ga0137387_10926741 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 628 | Open in IMG/M |
| 3300012351|Ga0137386_10009512 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6489 | Open in IMG/M |
| 3300012351|Ga0137386_10190400 | All Organisms → cellular organisms → Bacteria | 1473 | Open in IMG/M |
| 3300012353|Ga0137367_10117628 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1953 | Open in IMG/M |
| 3300012353|Ga0137367_10258345 | Not Available | 1252 | Open in IMG/M |
| 3300012361|Ga0137360_10839514 | All Organisms → cellular organisms → Bacteria | 791 | Open in IMG/M |
| 3300012582|Ga0137358_10961573 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 556 | Open in IMG/M |
| 3300012683|Ga0137398_11144955 | Not Available | 534 | Open in IMG/M |
| 3300012685|Ga0137397_10253366 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1312 | Open in IMG/M |
| 3300012685|Ga0137397_10317020 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1162 | Open in IMG/M |
| 3300012917|Ga0137395_10131690 | All Organisms → cellular organisms → Bacteria | 1696 | Open in IMG/M |
| 3300012923|Ga0137359_10150581 | All Organisms → cellular organisms → Bacteria | 2074 | Open in IMG/M |
| 3300012925|Ga0137419_10042374 | All Organisms → cellular organisms → Bacteria | 2881 | Open in IMG/M |
| 3300012925|Ga0137419_11200536 | Not Available | 635 | Open in IMG/M |
| 3300012927|Ga0137416_10054225 | All Organisms → cellular organisms → Bacteria | 2829 | Open in IMG/M |
| 3300012927|Ga0137416_10459589 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 1090 | Open in IMG/M |
| 3300012929|Ga0137404_10403804 | All Organisms → cellular organisms → Bacteria | 1205 | Open in IMG/M |
| 3300012971|Ga0126369_10499411 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1274 | Open in IMG/M |
| 3300012971|Ga0126369_12259572 | Not Available | 631 | Open in IMG/M |
| 3300013308|Ga0157375_10393998 | Not Available | 1552 | Open in IMG/M |
| 3300014154|Ga0134075_10001410 | All Organisms → cellular organisms → Bacteria | 8162 | Open in IMG/M |
| 3300014154|Ga0134075_10501907 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 544 | Open in IMG/M |
| 3300014164|Ga0181532_10044426 | Not Available | 2971 | Open in IMG/M |
| 3300014166|Ga0134079_10401557 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300014260|Ga0075307_1069539 | Not Available | 697 | Open in IMG/M |
| 3300014491|Ga0182014_10571615 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 549 | Open in IMG/M |
| 3300014496|Ga0182011_10595131 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 704 | Open in IMG/M |
| 3300014501|Ga0182024_10042469 | All Organisms → cellular organisms → Bacteria | 7427 | Open in IMG/M |
| 3300014501|Ga0182024_10680763 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE0068 | 1273 | Open in IMG/M |
| 3300014501|Ga0182024_11335799 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 829 | Open in IMG/M |
| 3300014501|Ga0182024_12228033 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 599 | Open in IMG/M |
| 3300014838|Ga0182030_10200176 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2392 | Open in IMG/M |
| 3300014838|Ga0182030_10241353 | Not Available | 2082 | Open in IMG/M |
| 3300014839|Ga0182027_10005539 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 19152 | Open in IMG/M |
| 3300015242|Ga0137412_11122236 | Not Available | 556 | Open in IMG/M |
| 3300015245|Ga0137409_10172367 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1965 | Open in IMG/M |
| 3300016319|Ga0182033_10220348 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1523 | Open in IMG/M |
| 3300016341|Ga0182035_10077533 | All Organisms → cellular organisms → Bacteria | 2362 | Open in IMG/M |
| 3300016341|Ga0182035_11084032 | Not Available | 712 | Open in IMG/M |
| 3300016357|Ga0182032_10251793 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidicapsa → Acidicapsa acidisoli | 1373 | Open in IMG/M |
| 3300016371|Ga0182034_10099888 | All Organisms → cellular organisms → Bacteria | 2076 | Open in IMG/M |
| 3300016387|Ga0182040_10461036 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1009 | Open in IMG/M |
| 3300016387|Ga0182040_11485837 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300016404|Ga0182037_10812835 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 806 | Open in IMG/M |
| 3300016445|Ga0182038_11119076 | Not Available | 700 | Open in IMG/M |
| 3300017946|Ga0187879_10711502 | Not Available | 559 | Open in IMG/M |
| 3300017959|Ga0187779_10765412 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
| 3300017972|Ga0187781_10100403 | Not Available | 2009 | Open in IMG/M |
| 3300018020|Ga0187861_10335850 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
| 3300018034|Ga0187863_10640774 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 599 | Open in IMG/M |
| 3300018077|Ga0184633_10500294 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 590 | Open in IMG/M |
| 3300018078|Ga0184612_10159069 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1181 | Open in IMG/M |
| 3300018079|Ga0184627_10001870 | All Organisms → cellular organisms → Bacteria | 8707 | Open in IMG/M |
| 3300018422|Ga0190265_10126844 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2450 | Open in IMG/M |
| 3300018431|Ga0066655_11164133 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 544 | Open in IMG/M |
| 3300018468|Ga0066662_10003515 | All Organisms → cellular organisms → Bacteria | 7527 | Open in IMG/M |
| 3300019458|Ga0187892_10002581 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 35612 | Open in IMG/M |
| 3300019458|Ga0187892_10013272 | All Organisms → cellular organisms → Bacteria | 9551 | Open in IMG/M |
| 3300019458|Ga0187892_10180924 | Not Available | 1145 | Open in IMG/M |
| 3300019458|Ga0187892_10206793 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1044 | Open in IMG/M |
| 3300019458|Ga0187892_10456030 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 597 | Open in IMG/M |
| 3300019487|Ga0187893_10109011 | All Organisms → cellular organisms → Bacteria | 2401 | Open in IMG/M |
| 3300019487|Ga0187893_10167437 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1751 | Open in IMG/M |
| 3300019487|Ga0187893_10368572 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Novosphingobium → unclassified Novosphingobium → Novosphingobium sp. B2580 | 987 | Open in IMG/M |
| 3300019487|Ga0187893_10677988 | Not Available | 641 | Open in IMG/M |
| 3300019788|Ga0182028_1061617 | Not Available | 1012 | Open in IMG/M |
| 3300019788|Ga0182028_1203097 | Not Available | 1535 | Open in IMG/M |
| 3300019885|Ga0193747_1002814 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4355 | Open in IMG/M |
| 3300019890|Ga0193728_1033032 | All Organisms → cellular organisms → Bacteria | 2567 | Open in IMG/M |
| 3300020006|Ga0193735_1009050 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3148 | Open in IMG/M |
| 3300020074|Ga0194113_10061093 | All Organisms → cellular organisms → Bacteria | 3554 | Open in IMG/M |
| 3300020140|Ga0179590_1203814 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 542 | Open in IMG/M |
| 3300020170|Ga0179594_10179059 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 791 | Open in IMG/M |
| 3300020170|Ga0179594_10181935 | All Organisms → cellular organisms → Bacteria | 784 | Open in IMG/M |
| 3300020198|Ga0194120_10001368 | All Organisms → cellular organisms → Bacteria | 44840 | Open in IMG/M |
| 3300020199|Ga0179592_10357256 | Not Available | 642 | Open in IMG/M |
| 3300020579|Ga0210407_10003177 | All Organisms → cellular organisms → Bacteria | 13495 | Open in IMG/M |
| 3300020579|Ga0210407_10180577 | Not Available | 1635 | Open in IMG/M |
| 3300020581|Ga0210399_10592576 | All Organisms → cellular organisms → Bacteria | 917 | Open in IMG/M |
| 3300020581|Ga0210399_10601278 | Not Available | 910 | Open in IMG/M |
| 3300020582|Ga0210395_10006485 | All Organisms → cellular organisms → Bacteria | 8887 | Open in IMG/M |
| 3300020582|Ga0210395_10261318 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1301 | Open in IMG/M |
| 3300020582|Ga0210395_10466139 | Not Available | 951 | Open in IMG/M |
| 3300021046|Ga0215015_10575448 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 83 | 1014 | Open in IMG/M |
| 3300021086|Ga0179596_10183305 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1012 | Open in IMG/M |
| 3300021171|Ga0210405_10514510 | Not Available | 937 | Open in IMG/M |
| 3300021401|Ga0210393_10862826 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 735 | Open in IMG/M |
| 3300021402|Ga0210385_10003448 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 9514 | Open in IMG/M |
| 3300021402|Ga0210385_10151602 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1658 | Open in IMG/M |
| 3300021405|Ga0210387_10475118 | All Organisms → cellular organisms → Bacteria | 1110 | Open in IMG/M |
| 3300021407|Ga0210383_11185109 | Not Available | 642 | Open in IMG/M |
| 3300021420|Ga0210394_10003022 | All Organisms → cellular organisms → Bacteria | 21978 | Open in IMG/M |
| 3300021420|Ga0210394_10324710 | All Organisms → cellular organisms → Bacteria | 1351 | Open in IMG/M |
| 3300021420|Ga0210394_10385838 | All Organisms → cellular organisms → Bacteria | 1232 | Open in IMG/M |
| 3300021420|Ga0210394_10803579 | Not Available | 821 | Open in IMG/M |
| 3300021432|Ga0210384_10000538 | All Organisms → cellular organisms → Bacteria | 57527 | Open in IMG/M |
| 3300021433|Ga0210391_10921682 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 681 | Open in IMG/M |
| 3300021444|Ga0213878_10300686 | Not Available | 688 | Open in IMG/M |
| 3300021475|Ga0210392_10137768 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1653 | Open in IMG/M |
| 3300021476|Ga0187846_10012038 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4142 | Open in IMG/M |
| 3300021477|Ga0210398_10025885 | All Organisms → cellular organisms → Bacteria | 4957 | Open in IMG/M |
| 3300021477|Ga0210398_10028714 | All Organisms → cellular organisms → Bacteria | 4671 | Open in IMG/M |
| 3300021477|Ga0210398_10034714 | All Organisms → cellular organisms → Bacteria | 4209 | Open in IMG/M |
| 3300021559|Ga0210409_10052837 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3815 | Open in IMG/M |
| 3300021559|Ga0210409_10174154 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1966 | Open in IMG/M |
| 3300021559|Ga0210409_10475885 | Not Available | 1111 | Open in IMG/M |
| 3300021559|Ga0210409_11524565 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300021560|Ga0126371_10301210 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1730 | Open in IMG/M |
| 3300021560|Ga0126371_12860291 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 585 | Open in IMG/M |
| 3300022557|Ga0212123_10012746 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 11186 | Open in IMG/M |
| 3300022557|Ga0212123_10235431 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Acidithiobacillia → Acidithiobacillales → Thermithiobacillaceae → Thermithiobacillus → Thermithiobacillus tepidarius | 1326 | Open in IMG/M |
| 3300022731|Ga0224563_1008095 | Not Available | 820 | Open in IMG/M |
| 3300022732|Ga0224569_107432 | All Organisms → cellular organisms → Bacteria | 793 | Open in IMG/M |
| 3300022850|Ga0224552_1020579 | Not Available | 904 | Open in IMG/M |
| 3300022873|Ga0224550_1041667 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella | 656 | Open in IMG/M |
| 3300023247|Ga0224529_1007149 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3306 | Open in IMG/M |
| 3300024233|Ga0224521_1119805 | Not Available | 562 | Open in IMG/M |
| 3300024353|Ga0209979_1074209 | Not Available | 1492 | Open in IMG/M |
| 3300025051|Ga0208961_1002365 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 5442 | Open in IMG/M |
| 3300025111|Ga0208968_1014019 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2978 | Open in IMG/M |
| 3300025313|Ga0209431_10418862 | Not Available | 1031 | Open in IMG/M |
| 3300025318|Ga0209519_10296187 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 939 | Open in IMG/M |
| 3300025325|Ga0209341_10198715 | Not Available | 1677 | Open in IMG/M |
| 3300025906|Ga0207699_10918233 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 646 | Open in IMG/M |
| 3300025910|Ga0207684_10067732 | All Organisms → cellular organisms → Bacteria | 3034 | Open in IMG/M |
| 3300025910|Ga0207684_10542267 | All Organisms → cellular organisms → Bacteria | 995 | Open in IMG/M |
| 3300025910|Ga0207684_11462849 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300025922|Ga0207646_10053597 | All Organisms → cellular organisms → Bacteria | 3608 | Open in IMG/M |
| 3300026277|Ga0209350_1002265 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 7633 | Open in IMG/M |
| 3300026295|Ga0209234_1084844 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 1201 | Open in IMG/M |
| 3300026298|Ga0209236_1109710 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 1230 | Open in IMG/M |
| 3300026298|Ga0209236_1114953 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1194 | Open in IMG/M |
| 3300026301|Ga0209238_1066243 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1275 | Open in IMG/M |
| 3300026304|Ga0209240_1012578 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3223 | Open in IMG/M |
| 3300026304|Ga0209240_1047531 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella tundricola | 1620 | Open in IMG/M |
| 3300026309|Ga0209055_1000157 | All Organisms → cellular organisms → Bacteria | 46749 | Open in IMG/M |
| 3300026309|Ga0209055_1005952 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6945 | Open in IMG/M |
| 3300026309|Ga0209055_1097975 | All Organisms → cellular organisms → Bacteria | 1178 | Open in IMG/M |
| 3300026309|Ga0209055_1119110 | All Organisms → cellular organisms → Bacteria | 1008 | Open in IMG/M |
| 3300026313|Ga0209761_1037328 | All Organisms → cellular organisms → Bacteria | 2849 | Open in IMG/M |
| 3300026317|Ga0209154_1016911 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3458 | Open in IMG/M |
| 3300026318|Ga0209471_1001493 | All Organisms → cellular organisms → Bacteria | 13819 | Open in IMG/M |
| 3300026325|Ga0209152_10000182 | All Organisms → cellular organisms → Bacteria | 33001 | Open in IMG/M |
| 3300026329|Ga0209375_1108340 | All Organisms → cellular organisms → Bacteria | 1238 | Open in IMG/M |
| 3300026329|Ga0209375_1118793 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1164 | Open in IMG/M |
| 3300026351|Ga0257170_1024747 | All Organisms → cellular organisms → Bacteria | 797 | Open in IMG/M |
| 3300026480|Ga0257177_1075602 | Not Available | 542 | Open in IMG/M |
| 3300026482|Ga0257172_1025188 | Not Available | 1060 | Open in IMG/M |
| 3300026482|Ga0257172_1027808 | All Organisms → cellular organisms → Bacteria | 1014 | Open in IMG/M |
| 3300026489|Ga0257160_1003282 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1863 | Open in IMG/M |
| 3300026537|Ga0209157_1081144 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1591 | Open in IMG/M |
| 3300026547|Ga0209156_10213923 | Not Available | 913 | Open in IMG/M |
| 3300026551|Ga0209648_10348313 | All Organisms → cellular organisms → Bacteria | 1020 | Open in IMG/M |
| 3300026551|Ga0209648_10492902 | Not Available | 718 | Open in IMG/M |
| 3300026557|Ga0179587_10558624 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 752 | Open in IMG/M |
| 3300027548|Ga0209523_1007190 | All Organisms → cellular organisms → Bacteria | 1962 | Open in IMG/M |
| 3300027671|Ga0209588_1001422 | All Organisms → cellular organisms → Bacteria | 6253 | Open in IMG/M |
| 3300027745|Ga0209908_10044773 | All Organisms → cellular organisms → Bacteria | 958 | Open in IMG/M |
| 3300027762|Ga0209288_10035171 | Not Available | 1472 | Open in IMG/M |
| 3300027767|Ga0209655_10304819 | Not Available | 513 | Open in IMG/M |
| 3300027812|Ga0209656_10182134 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1030 | Open in IMG/M |
| 3300027846|Ga0209180_10217127 | All Organisms → cellular organisms → Bacteria | 1102 | Open in IMG/M |
| 3300027846|Ga0209180_10433634 | Not Available | 742 | Open in IMG/M |
| 3300027869|Ga0209579_10572352 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 613 | Open in IMG/M |
| 3300027875|Ga0209283_10737383 | Not Available | 612 | Open in IMG/M |
| 3300027884|Ga0209275_10097686 | Not Available | 1498 | Open in IMG/M |
| 3300027884|Ga0209275_10150275 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1234 | Open in IMG/M |
| 3300027902|Ga0209048_11002603 | Not Available | 533 | Open in IMG/M |
| 3300027911|Ga0209698_10500347 | Not Available | 941 | Open in IMG/M |
| 3300027968|Ga0209061_1015111 | All Organisms → cellular organisms → Bacteria | 4482 | Open in IMG/M |
| 3300028536|Ga0137415_10027818 | All Organisms → cellular organisms → Bacteria | 5574 | Open in IMG/M |
| 3300028653|Ga0265323_10004437 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 6048 | Open in IMG/M |
| 3300028653|Ga0265323_10026249 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli | 2197 | Open in IMG/M |
| 3300028745|Ga0302267_10079259 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1680 | Open in IMG/M |
| 3300028792|Ga0307504_10055391 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1146 | Open in IMG/M |
| 3300028906|Ga0308309_10907425 | All Organisms → cellular organisms → Bacteria | 765 | Open in IMG/M |
| 3300029922|Ga0311363_10001186 | All Organisms → cellular organisms → Bacteria | 55313 | Open in IMG/M |
| 3300029945|Ga0311330_10000357 | All Organisms → cellular organisms → Bacteria | 55287 | Open in IMG/M |
| 3300030518|Ga0302275_10199743 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola | 1187 | Open in IMG/M |
| 3300030620|Ga0302046_10332673 | All Organisms → cellular organisms → Bacteria | 1248 | Open in IMG/M |
| 3300031231|Ga0170824_126997845 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 655 | Open in IMG/M |
| 3300031234|Ga0302325_13382551 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300031235|Ga0265330_10003161 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Holophagae → Holophagales → Holophagaceae → Geothrix → unclassified Geothrix → Geothrix sp. SG178 | 8709 | Open in IMG/M |
| 3300031236|Ga0302324_100201048 | All Organisms → cellular organisms → Bacteria | 3179 | Open in IMG/M |
| 3300031421|Ga0308194_10054922 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1031 | Open in IMG/M |
| 3300031474|Ga0170818_111594442 | Not Available | 1431 | Open in IMG/M |
| 3300031543|Ga0318516_10630472 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 611 | Open in IMG/M |
| 3300031545|Ga0318541_10007872 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4648 | Open in IMG/M |
| 3300031548|Ga0307408_100016291 | All Organisms → cellular organisms → Bacteria | 4959 | Open in IMG/M |
| 3300031564|Ga0318573_10458453 | Not Available | 686 | Open in IMG/M |
| 3300031573|Ga0310915_10674962 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 730 | Open in IMG/M |
| 3300031708|Ga0310686_103949837 | Not Available | 1182 | Open in IMG/M |
| 3300031708|Ga0310686_108736362 | All Organisms → cellular organisms → Bacteria | 863 | Open in IMG/M |
| 3300031708|Ga0310686_108742318 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1378 | Open in IMG/M |
| 3300031708|Ga0310686_109701879 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300031708|Ga0310686_113647858 | Not Available | 536 | Open in IMG/M |
| 3300031708|Ga0310686_114056176 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4833 | Open in IMG/M |
| 3300031708|Ga0310686_114058553 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 654 | Open in IMG/M |
| 3300031708|Ga0310686_117089679 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidicapsa → Acidicapsa acidisoli | 1575 | Open in IMG/M |
| 3300031708|Ga0310686_118364528 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rhodanobacter → unclassified Rhodanobacter → Rhodanobacter sp. | 816 | Open in IMG/M |
| 3300031715|Ga0307476_10000137 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 73670 | Open in IMG/M |
| 3300031715|Ga0307476_10000336 | All Organisms → cellular organisms → Bacteria | 39701 | Open in IMG/M |
| 3300031715|Ga0307476_10336301 | All Organisms → cellular organisms → Bacteria | 1110 | Open in IMG/M |
| 3300031715|Ga0307476_10792484 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 701 | Open in IMG/M |
| 3300031718|Ga0307474_10001049 | All Organisms → cellular organisms → Bacteria | 20109 | Open in IMG/M |
| 3300031718|Ga0307474_10005892 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 8837 | Open in IMG/M |
| 3300031718|Ga0307474_10992704 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 664 | Open in IMG/M |
| 3300031719|Ga0306917_10484429 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 970 | Open in IMG/M |
| 3300031724|Ga0318500_10450055 | Not Available | 644 | Open in IMG/M |
| 3300031740|Ga0307468_101545839 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300031744|Ga0306918_10290231 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1258 | Open in IMG/M |
| 3300031744|Ga0306918_11191943 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 588 | Open in IMG/M |
| 3300031747|Ga0318502_10786694 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300031753|Ga0307477_10001292 | All Organisms → cellular organisms → Bacteria | 21690 | Open in IMG/M |
| 3300031753|Ga0307477_10027397 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3895 | Open in IMG/M |
| 3300031754|Ga0307475_10093347 | All Organisms → cellular organisms → Bacteria | 2338 | Open in IMG/M |
| 3300031754|Ga0307475_11050097 | Not Available | 639 | Open in IMG/M |
| 3300031771|Ga0318546_10407200 | All Organisms → cellular organisms → Bacteria | 950 | Open in IMG/M |
| 3300031772|Ga0315288_11384685 | Not Available | 590 | Open in IMG/M |
| 3300031782|Ga0318552_10392159 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 708 | Open in IMG/M |
| 3300031788|Ga0302319_10715922 | All Organisms → cellular organisms → Bacteria | 1011 | Open in IMG/M |
| 3300031823|Ga0307478_10007793 | All Organisms → cellular organisms → Bacteria | 7369 | Open in IMG/M |
| 3300031823|Ga0307478_10152151 | All Organisms → cellular organisms → Bacteria | 1836 | Open in IMG/M |
| 3300031823|Ga0307478_10899703 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 741 | Open in IMG/M |
| 3300031890|Ga0306925_12107840 | Not Available | 528 | Open in IMG/M |
| 3300031910|Ga0306923_11957899 | Not Available | 596 | Open in IMG/M |
| 3300031912|Ga0306921_10148633 | All Organisms → cellular organisms → Bacteria | 2741 | Open in IMG/M |
| 3300031941|Ga0310912_11329748 | Not Available | 544 | Open in IMG/M |
| 3300031942|Ga0310916_10775251 | Not Available | 809 | Open in IMG/M |
| 3300031949|Ga0214473_10209203 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division NC10 | 2255 | Open in IMG/M |
| 3300031954|Ga0306926_11129586 | Not Available | 925 | Open in IMG/M |
| 3300032041|Ga0318549_10215690 | All Organisms → cellular organisms → Bacteria | 862 | Open in IMG/M |
| 3300032054|Ga0318570_10280503 | All Organisms → cellular organisms → Bacteria | 757 | Open in IMG/M |
| 3300032063|Ga0318504_10282114 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 784 | Open in IMG/M |
| 3300032076|Ga0306924_12066597 | Not Available | 585 | Open in IMG/M |
| 3300032089|Ga0318525_10493775 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 627 | Open in IMG/M |
| 3300032163|Ga0315281_10121186 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Candidatus Nitrospira inopinata | 3001 | Open in IMG/M |
| 3300032163|Ga0315281_10576878 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira moscoviensis | 1186 | Open in IMG/M |
| 3300032163|Ga0315281_12351234 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 501 | Open in IMG/M |
| 3300032174|Ga0307470_11039803 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae | 654 | Open in IMG/M |
| 3300032180|Ga0307471_101462491 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 842 | Open in IMG/M |
| 3300032180|Ga0307471_103114710 | Not Available | 588 | Open in IMG/M |
| 3300032180|Ga0307471_103568934 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300032180|Ga0307471_104032490 | Not Available | 519 | Open in IMG/M |
| 3300032205|Ga0307472_100805571 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 858 | Open in IMG/M |
| 3300032261|Ga0306920_100006437 | All Organisms → cellular organisms → Bacteria | 15329 | Open in IMG/M |
| 3300032261|Ga0306920_100083137 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4712 | Open in IMG/M |
| 3300032261|Ga0306920_100113496 | All Organisms → cellular organisms → Bacteria | 4019 | Open in IMG/M |
| 3300032261|Ga0306920_100257133 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2605 | Open in IMG/M |
| 3300032261|Ga0306920_100616395 | All Organisms → cellular organisms → Bacteria | 1605 | Open in IMG/M |
| 3300032261|Ga0306920_100728585 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1460 | Open in IMG/M |
| 3300032770|Ga0335085_10000748 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 83242 | Open in IMG/M |
| 3300032770|Ga0335085_10003686 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 26161 | Open in IMG/M |
| 3300032770|Ga0335085_10031915 | All Organisms → cellular organisms → Bacteria | 7331 | Open in IMG/M |
| 3300032782|Ga0335082_10003398 | All Organisms → cellular organisms → Bacteria | 17300 | Open in IMG/M |
| 3300032783|Ga0335079_11516742 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 661 | Open in IMG/M |
| 3300032892|Ga0335081_10562088 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 1417 | Open in IMG/M |
| 3300032892|Ga0335081_10768962 | All Organisms → cellular organisms → Bacteria | 1156 | Open in IMG/M |
| 3300032895|Ga0335074_10006299 | All Organisms → cellular organisms → Bacteria | 16471 | Open in IMG/M |
| 3300032897|Ga0335071_10891504 | Not Available | 837 | Open in IMG/M |
| 3300032954|Ga0335083_10022114 | All Organisms → cellular organisms → Bacteria | 7298 | Open in IMG/M |
| 3300032955|Ga0335076_10150732 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Deltaproteobacteria incertae sedis → Deferrisoma → Deferrisoma camini | 2241 | Open in IMG/M |
| 3300033158|Ga0335077_11969269 | Not Available | 544 | Open in IMG/M |
| 3300033289|Ga0310914_10021037 | All Organisms → cellular organisms → Bacteria | 5058 | Open in IMG/M |
| 3300033289|Ga0310914_10627004 | All Organisms → cellular organisms → Bacteria | 968 | Open in IMG/M |
| 3300033405|Ga0326727_10290300 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 1626 | Open in IMG/M |
| 3300033407|Ga0214472_10803693 | All Organisms → cellular organisms → Bacteria | 846 | Open in IMG/M |
| 3300033480|Ga0316620_12258369 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 541 | Open in IMG/M |
| 3300033487|Ga0316630_10085729 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2060 | Open in IMG/M |
| 3300033513|Ga0316628_100367463 | All Organisms → cellular organisms → Bacteria | 1817 | Open in IMG/M |
| 3300033827|Ga0334848_005296 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 3333 | Open in IMG/M |
| 3300034149|Ga0364929_0237103 | Not Available | 611 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 16.53% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 13.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 8.54% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.34% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.79% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.96% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.13% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.13% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.75% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.93% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.65% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.38% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 1.38% |
| Bio-Ooze | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Bio-Ooze | 1.38% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.10% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 1.10% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 1.10% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.10% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.10% |
| Microbial Mat On Rocks | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks | 1.10% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.83% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 0.83% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.83% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.83% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.83% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.83% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.83% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.83% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.83% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.28% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.28% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 0.28% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.28% |
| Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 0.28% |
| Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.28% |
| Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 0.28% |
| Thermal Springs | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs | 0.28% |
| Hot Spring Sediment | Environmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment | 0.28% |
| Mangrove Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Mangrove Sediment | 0.28% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.28% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.28% |
| Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 0.28% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Agricultural Soil | 0.28% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.28% |
| Thawing Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost | 0.28% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.28% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.28% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.28% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.28% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.28% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.28% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.28% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.28% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.55% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.55% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.55% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.55% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.55% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.55% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.55% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.55% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.55% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
| 3300004475 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 62 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006865 | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009095 | Agricultural soil microbial communities from Utah to study Nitrogen management - Steer compost 2015 | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009157 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009444 | Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP3 | Environmental | Open in IMG/M |
| 3300009499 | Deep subsurface microbial communities from Anholt, Denmark to uncover new lineages of life (NeLLi) - Anholt_01485 metaG | Environmental | Open in IMG/M |
| 3300009509 | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_11 | Environmental | Open in IMG/M |
| 3300009702 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV14_V59a metaG | Environmental | Open in IMG/M |
| 3300009802 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_50_60 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010430 | Marine sediment microbial communities from Gulf of Thailand under amendment with organic carbon and nitrate - JGI co-assembly of 8 samples | Environmental | Open in IMG/M |
| 3300011080 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 53 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011118 | Deep subsurface microbial communities from Aarhus Bay to uncover new lineages of life (NeLLi) - Aarhus_00045 metaG | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300014260 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqA_D1_rd | Environmental | Open in IMG/M |
| 3300014491 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaG | Environmental | Open in IMG/M |
| 3300014496 | Permafrost microbial communities from Stordalen Mire, Sweden - 711E1D metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014839 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018020 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_100 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018077 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1 | Environmental | Open in IMG/M |
| 3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
| 3300018079 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1 | Environmental | Open in IMG/M |
| 3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019458 | Bio-ooze microbial communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-3 metaG | Environmental | Open in IMG/M |
| 3300019487 | White microbial mat communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-4 metaG | Environmental | Open in IMG/M |
| 3300019788 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019885 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m2 | Environmental | Open in IMG/M |
| 3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
| 3300020006 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m2 | Environmental | Open in IMG/M |
| 3300020074 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200m | Environmental | Open in IMG/M |
| 3300020140 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020198 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015019 Mahale Deep Cast 65m | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021444 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R02 | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300022731 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU4 | Environmental | Open in IMG/M |
| 3300022732 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU1 | Host-Associated | Open in IMG/M |
| 3300022850 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S2 1-5 | Environmental | Open in IMG/M |
| 3300022873 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 10-14 | Environmental | Open in IMG/M |
| 3300023247 | Peat soil microbial communities from Stordalen Mire, Sweden - C.B.S.T50 | Environmental | Open in IMG/M |
| 3300024233 | Peat soil microbial communities from Stordalen Mire, Sweden - C.F.S.T0 | Environmental | Open in IMG/M |
| 3300024353 | Deep subsurface microbial communities from Anholt, Denmark to uncover new lineages of life (NeLLi) - Anholt_01485 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025051 | Groundwater microbial communities from Rifle, Colorado - Rifle Oxygen_injection B3 (SPAdes) | Environmental | Open in IMG/M |
| 3300025111 | Groundwater microbial communities from Rifle, Colorado - Rifle Oxygen_injection A3 (SPAdes) | Environmental | Open in IMG/M |
| 3300025313 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300025318 | Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 1 | Environmental | Open in IMG/M |
| 3300025325 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026277 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
| 3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300026329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes) | Environmental | Open in IMG/M |
| 3300026351 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-05-B | Environmental | Open in IMG/M |
| 3300026480 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-B | Environmental | Open in IMG/M |
| 3300026482 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-B | Environmental | Open in IMG/M |
| 3300026489 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-11-A | Environmental | Open in IMG/M |
| 3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027548 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027745 | Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 812P2M | Environmental | Open in IMG/M |
| 3300027762 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027767 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027902 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027968 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen10_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Host-Associated | Open in IMG/M |
| 3300028745 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E1_3 | Environmental | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029922 | III_Fen_E1 coassembly | Environmental | Open in IMG/M |
| 3300029945 | I_Bog_N2 coassembly | Environmental | Open in IMG/M |
| 3300030518 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_2 | Environmental | Open in IMG/M |
| 3300030620 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111 | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Host-Associated | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031421 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031772 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031788 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_2 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031949 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032163 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032177 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033405 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MY | Environmental | Open in IMG/M |
| 3300033407 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT140D175 | Environmental | Open in IMG/M |
| 3300033480 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_B | Environmental | Open in IMG/M |
| 3300033487 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D6_A | Environmental | Open in IMG/M |
| 3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
| 3300033827 | Peat soil microbial communities from Stordalen Mire, Sweden - 714 E2 5-9 | Environmental | Open in IMG/M |
| 3300034149 | Sediment microbial communities from East River floodplain, Colorado, United States - 20_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGIcombinedJ13530_1058802411 | 3300001213 | Wetland | MVTHNPLHGSGQAALPHPALALSDERQALGGPGMADA |
| Ga0068969_14767921 | 3300004475 | Peatlands Soil | MITHNPLHGSGRADFPHPALALGDDAHATQRIGMTDDRHRQ |
| Ga0066672_100039274 | 3300005167 | Soil | VISDHPVGVGITIAHDPLHGSGRAELPHPALALGNDAHATQRIGM |
| Ga0066680_102844731 | 3300005174 | Soil | MITHNPLHGSGQAGFPHPALALGEDADAMQGIGMTDRRRRQP |
| Ga0066679_100112271 | 3300005176 | Soil | VISDHPVGVGITIAHDPLHGSGRAELPHPALALGNDAHATQRIGMT |
| Ga0066690_105491702 | 3300005177 | Soil | MIAHDPLHGSGQADFPHPALALGDNAHAAQGIRMTDGRQRQPAS |
| Ga0066690_108277242 | 3300005177 | Soil | MITHNPLHGSGQADFPHPALALGDNAHAAQGIRMTDGRQRQPAS |
| Ga0066685_100193606 | 3300005180 | Soil | MITHNPLHGSGQADFPHPALALGDNAHAAQGIRMTDGRQR |
| Ga0066675_101444311 | 3300005187 | Soil | MITHNPLHGSGQAGFPHPALALGDNAHAAQGIGMTDGRQR |
| Ga0066682_100091896 | 3300005450 | Soil | MITHNPLHGSGQAGFPHPALALGDNAHAAQGIGMTDGRQRQP |
| Ga0070707_1004248132 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MRSECSQVGVGIMIAHNPLHGSGQAALPHPALALGKDAHAAERIGM |
| Ga0066697_100949086 | 3300005540 | Soil | MTIARNPLHGSGRAALPHPALASGDDAKSPQGIGM |
| Ga0070732_107850591 | 3300005542 | Surface Soil | MIDHNPLHGSGRADFPHPALALGDNAHAPQRIGMT |
| Ga0066701_100902111 | 3300005552 | Soil | MTIARNPLHGSGRAALPHPALASGDDAKSPQRIGM |
| Ga0066695_100468796 | 3300005553 | Soil | MITHNPLHGSGQAGFPHPALALGDNAHAAQGIGMTDGR |
| Ga0066661_100417181 | 3300005554 | Soil | MIAHNPLHGSGQAGFPHPALALGDNAHAAQGIGMT |
| Ga0066704_100053796 | 3300005557 | Soil | MITHNNPLHGSGQADFPHPALALGDNAHAAQGIRMTDG |
| Ga0066704_100386301 | 3300005557 | Soil | MTVARNPLHGSQRAGLPHWALALGDNAKSPQGIGMTNAR |
| Ga0066706_100028011 | 3300005598 | Soil | MTVARNPLHRSGRAALPHPAPASGDNAKSPQGIRV |
| Ga0070766_100448041 | 3300005921 | Soil | MMARNTLHGSGHAGFPHPALALGDDAHAAQGIGMTDSR |
| Ga0075023_1004238562 | 3300006041 | Watersheds | MFNSVGVGITIARDPLHGSGQAAFPHPALALGDNAHAPQRIG |
| Ga0066652_1013932951 | 3300006046 | Soil | MIAHNPLHGSGQAGFPHPALALGDNAHAAQGIGMTDGRQRQP |
| Ga0075018_105757292 | 3300006172 | Watersheds | MVTHNPLYGSGQAGLPHPALTSGDDAHAAQGIRMTSAGGR |
| Ga0068871_1017616202 | 3300006358 | Miscanthus Rhizosphere | MTITRNPLHGSQRAEFPHWALALGDDAKPPERIGMANARRG |
| Ga0066658_105952341 | 3300006794 | Soil | MITHNPLHGSGRADFPHPALALGDNAHAAQGIGMADGRQ |
| Ga0066665_100684085 | 3300006796 | Soil | MIAHDPLHGSGRAALPHPALALGEDAHATQGIGMT |
| Ga0066665_108676652 | 3300006796 | Soil | MVTHNPLHGSGQAGLPHPALTSGDNAHAAQGIRMTSAGGRQ |
| Ga0066665_113778622 | 3300006796 | Soil | MITHNNPLHGSGQADFPHPALALGDNAHAAQGIRMTDGRQRQPAS |
| Ga0073934_101455143 | 3300006865 | Hot Spring Sediment | MITHNPLHGSQRAGLPHWALASGDNAKSPQGIGMS |
| Ga0073928_1000111848 | 3300006893 | Iron-Sulfur Acid Spring | MIAHNPLHGSGQAALPHPALALGKDAHATQGIGMTD |
| Ga0073928_1000282730 | 3300006893 | Iron-Sulfur Acid Spring | MIAHNPLHGSGQAALPHPALALGKDAHATQGIGMT |
| Ga0073928_100289768 | 3300006893 | Iron-Sulfur Acid Spring | MIAHNPLHGSGQAGFPHPALALGEDAYASQGIGMT |
| Ga0073928_101114991 | 3300006893 | Iron-Sulfur Acid Spring | MFAHNPLHGSGQAGFPHPALALGDDAHATQGIGMT |
| Ga0073928_101600161 | 3300006893 | Iron-Sulfur Acid Spring | MFAHNPLHGSGQAGFPHPALALGDDAHAAQGIGMT |
| Ga0099791_104168822 | 3300007255 | Vadose Zone Soil | MTIARNPLHGSGRAALPHPALALGDNAKSPQGIGMT |
| Ga0099794_100031599 | 3300007265 | Vadose Zone Soil | MVAHNPLHRSGRAAFPHPALASGDDAKSPQGIGMT |
| Ga0099794_100361231 | 3300007265 | Vadose Zone Soil | MIAHNPLHGSGQAALPHPALALGDDAHAAQGIGMTDDRHGQPASD |
| Ga0099794_104523881 | 3300007265 | Vadose Zone Soil | MIAHNPLHGSGRAGFPHPALALGDDAHAAQGIGMTD |
| Ga0099794_106654622 | 3300007265 | Vadose Zone Soil | MVTHNPLYGSGQAGLPHPALTSGDNAHAAQGIRMT |
| Ga0099795_105397701 | 3300007788 | Vadose Zone Soil | MIAHNPLHGSGRADFPHPALALGDDTHAAQGIGMTDRR |
| Ga0066710_1004398042 | 3300009012 | Grasslands Soil | MIAHNPLHGSGQAGFPHPALALGEDADAMQGIGMTDRRRRQPA |
| Ga0099829_101428463 | 3300009038 | Vadose Zone Soil | VIAHDPLHGSGQADFPHPALALGDDAHAAQGIGMT |
| Ga0099829_102116491 | 3300009038 | Vadose Zone Soil | MIAHNPLHGSGRAVLPHPALALGNDAHATQGIGMT |
| Ga0099827_102079793 | 3300009090 | Vadose Zone Soil | MIAHNPLHGSGRAALPHPALALGDDAHAMQGVGMTDRR |
| Ga0099827_107333362 | 3300009090 | Vadose Zone Soil | MVAHNPLHGSGRAGFPHPALASGDNAEAAQGIRMM |
| Ga0079224_1038283083 | 3300009095 | Agricultural Soil | MIAHSPLHRSGRAVFPHPAPASGNDAKSPQGIGVA |
| Ga0066709_1005088061 | 3300009137 | Grasslands Soil | MFAHNALPGSGQAGFPDPALTLGDDARAPQGIGMTDGGGGSRRV |
| Ga0066709_1041583801 | 3300009137 | Grasslands Soil | MVTHNPLHGSGLAVLPHPALASGDNAKSPQWIRMTN |
| Ga0105092_101488481 | 3300009157 | Freshwater Sediment | MELVGVGIMVAHNPLHGSGRAALPHPALASGNNAKALPGIRM |
| Ga0075423_115572571 | 3300009162 | Populus Rhizosphere | MVTHNPLHGSGQAGLPHTALTSGDNAHAAQGIRMTSAGGRQPT |
| Ga0114945_101882034 | 3300009444 | Thermal Springs | MTVTRNPLHGSGRAALPHPALASGDNAKPPQGIGVT |
| Ga0114930_100086521 | 3300009499 | Deep Subsurface | MVAHDPLPRSQRAGLPHWAPASGNNAHTTQGIGMT |
| Ga0123573_114918171 | 3300009509 | Mangrove Sediment | MVAHNPLHRSGRAGLPHPALASGNDAKAAQGIVMIDSGLGQI |
| Ga0114931_101009503 | 3300009702 | Deep Subsurface | MPITEHPLHGSQRALLTHWALASGHNAKSPQRIGVT |
| Ga0105073_10473542 | 3300009802 | Groundwater Sand | MIAHNPLHGSQRAGLPHWALASGDNAKSPQGIGMA |
| Ga0126380_119597181 | 3300010043 | Tropical Forest Soil | MVAHNPLHGSGRAALLHPALALGNNAKTLPGIRMTHASQR |
| Ga0126373_101206011 | 3300010048 | Tropical Forest Soil | MVAHNPLHGSGRAGLPHPALASGDDAEAAQWIGMTD |
| Ga0126373_101463311 | 3300010048 | Tropical Forest Soil | MIAHNPLHGSGQADFPHLALALGDDAHAAQGIGMT |
| Ga0134128_101996974 | 3300010373 | Terrestrial Soil | MIAHNPLHGSGQAGFPHPALALGEDAHAMQRIGMT |
| Ga0126381_1009960303 | 3300010376 | Tropical Forest Soil | MIAHNPLHGSGQAELPHPALALGNDAHAAQGIGMT |
| Ga0136449_1046572931 | 3300010379 | Peatlands Soil | MVSHNPLHGSGLAGFPHPARALGNDAHAAQGIRMMD |
| Ga0126383_106286913 | 3300010398 | Tropical Forest Soil | MVAHNPLHGSGRAVLLHPALALGNNAKTLPGIRMT |
| Ga0126383_107665671 | 3300010398 | Tropical Forest Soil | MVAHNPLDGSGRVVLPHPALASGDNAEATQRIGRMN |
| Ga0118733_1076697881 | 3300010430 | Marine Sediment | MPITEHPLHGSQRALLTHWALASGDNAKSPQRIGV |
| Ga0138568_11920672 | 3300011080 | Peatlands Soil | MIAHDPLHGSGRADFPHPALALGDNAHAAQRIRMT |
| Ga0114922_101071984 | 3300011118 | Deep Subsurface | MVAHDPLHRSQRAGLPHWAPASGDDAHAAQGIRMT |
| Ga0150983_166891202 | 3300011120 | Forest Soil | MITHNPLHGSGQAGFPHPTLALGDNAHAAQGIGMTDGRQRQPA |
| Ga0137392_100782741 | 3300011269 | Vadose Zone Soil | MIAHNPLHGSGRAVLPHPALALGNDAHATQGIGMTD |
| Ga0137391_103243123 | 3300011270 | Vadose Zone Soil | MIAHNPLHGSGQAALPHPALALGNDAHATQGIRMT |
| Ga0137391_106035761 | 3300011270 | Vadose Zone Soil | MVGVGITITHDPLHGSGRAGFPHPALALGDNAHAAQRIGMT |
| Ga0137389_111107552 | 3300012096 | Vadose Zone Soil | MITHNPLHGSGQAALPHPALALGDDAQATQGIGMT |
| Ga0137383_100526275 | 3300012199 | Vadose Zone Soil | MNFLVGVGIMITHNPLHGSGQAALPHPALTLGDDAHAAQGIGMT |
| Ga0137363_100480114 | 3300012202 | Vadose Zone Soil | VIAHNPLRGSGQAAFPHPALALGNDAHAPQRIGMT |
| Ga0137363_113310772 | 3300012202 | Vadose Zone Soil | MIAHNPLHGSGQAGFPHPALALGEDAHASQGIGMT |
| Ga0137399_100044168 | 3300012203 | Vadose Zone Soil | MIAHNPLHGSGQAALPHPALALGDDAHAAQGIGMTDDR |
| Ga0137399_117709892 | 3300012203 | Vadose Zone Soil | MIAHNPLHGSGQAALPHPALALGDDAHATQGIGMTD |
| Ga0137362_101226352 | 3300012205 | Vadose Zone Soil | MIAHNPLHGSGRAALPHPALALGDDAHAAQGIGMTDCRTGGPGVK* |
| Ga0137362_108650272 | 3300012205 | Vadose Zone Soil | MIAHNPLHGSGQAGFPHPALASGDNAHAAQGIGMTDGR |
| Ga0137381_101205013 | 3300012207 | Vadose Zone Soil | MIAHNPLHGSGRAVLPHPALALGNDAHATQGIRMT |
| Ga0137376_114950521 | 3300012208 | Vadose Zone Soil | MIARNPLHGSGQAALPHPALALGKDAHAAQGIGMTDG |
| Ga0137378_100171296 | 3300012210 | Vadose Zone Soil | MVTHNPLHGSGQAGLPHPALTSGDNAHAAQGIRMTS |
| Ga0137378_102160411 | 3300012210 | Vadose Zone Soil | MVTHNPLHGSGQAGLPHPALTSGDNAHAAQGIRMT |
| Ga0137377_103639543 | 3300012211 | Vadose Zone Soil | MTIARNPLHGSGRAALPHPALASGDDAKSPQGIGMT |
| Ga0137377_109356512 | 3300012211 | Vadose Zone Soil | MIAHNPLQGSGQAGFPHPALALGEDADAMQGIGMTDRRRRQPA |
| Ga0137387_101079441 | 3300012349 | Vadose Zone Soil | MITHDPLHGSGQAALPHPALTLGDDAHAAQGIGMTDGRQRQPAGD |
| Ga0137387_104420021 | 3300012349 | Vadose Zone Soil | MVTHNPLHGSGQAGLPHPALTSGNNAHAAQGIRMTG |
| Ga0137387_108267082 | 3300012349 | Vadose Zone Soil | MIAHNPLHGSGQAGFPHPAPALGEDAPAMQGIGMTDGRQGQPAGD |
| Ga0137387_109267411 | 3300012349 | Vadose Zone Soil | MGTHNPLYGSGQAGLPHPALTSGDNAHAAQGIRMTS |
| Ga0137386_100095127 | 3300012351 | Vadose Zone Soil | MIAHNPLQGSGQAGFPHPALALGEDADAMQGIGMT |
| Ga0137386_101904002 | 3300012351 | Vadose Zone Soil | MIAHNPLHGSGRAVLPHPALAVGEDAHAAQGIGMTD |
| Ga0137367_101176281 | 3300012353 | Vadose Zone Soil | MVTHNPLYGSGQAGLPHPALTSGDNAHAAQGIRMTS |
| Ga0137367_102583453 | 3300012353 | Vadose Zone Soil | MVTHNPLHGSGQADFPHPALTSGDDAHAAQGIRMT |
| Ga0137360_108395142 | 3300012361 | Vadose Zone Soil | MIAHNPLHGSGQAGFPHLALALGEAAHATQGIGMTEGRHRQPASE |
| Ga0137358_109615731 | 3300012582 | Vadose Zone Soil | MVTHNPLYGSGQAGLPHPALTSGDNAHAAQGIRMTSTGG |
| Ga0137398_111449551 | 3300012683 | Vadose Zone Soil | VIAHNPLHGSGQADFPHPALALGSNAHALQRIGMTDRRQRK |
| Ga0137397_102533663 | 3300012685 | Vadose Zone Soil | MIAHNPLHGSGRAALPHPALALGDDAHAAQGIGMTD |
| Ga0137397_103170202 | 3300012685 | Vadose Zone Soil | MFAHNPLHGSGQAGFPHPALALGEDAHAAQGIGMT |
| Ga0137395_101316901 | 3300012917 | Vadose Zone Soil | MFAHNPLHGSGRAEFPHPALALGEDAHATQGIRMI |
| Ga0137359_101505812 | 3300012923 | Vadose Zone Soil | MIAHDPLHGSGRAALPHPALALGDDAHAAQGIGMTDDRQRQPAVD |
| Ga0137419_100423745 | 3300012925 | Vadose Zone Soil | VIARIITYEVGVGITIAHDPLHGSGRAGFPHPALALGNNAHASQRIGM |
| Ga0137419_112005361 | 3300012925 | Vadose Zone Soil | MIAHDPLHGSGRAALPHPALALGDDAHATQGIGMTDRR |
| Ga0137416_100542255 | 3300012927 | Vadose Zone Soil | VIARIITYEVGVGITIAHDPLHGSGRAGFPHPALALGNNAHAAQRIGMTD |
| Ga0137416_104595891 | 3300012927 | Vadose Zone Soil | MVAHNPLHGSGQAGLPHPALTSGDNAHAAQGIRMTS |
| Ga0137404_104038043 | 3300012929 | Vadose Zone Soil | MIAHNPLHGSGQAGFPHPALALGEDAHAAQGIGMTDGRQRQP |
| Ga0126369_104994113 | 3300012971 | Tropical Forest Soil | MIAHNPLHGSGQAALPHPALALGDDAHAAERIGMT |
| Ga0126369_122595722 | 3300012971 | Tropical Forest Soil | MIAHDPLYGSGQAAFPHPALALVVDDQPLRGIGMNNVDWWQ |
| Ga0157375_103939983 | 3300013308 | Miscanthus Rhizosphere | MITHNPLHRSVRAEFPHTAPALGADAHSLQRIGMANGGWRKPAI |
| Ga0134075_1000141010 | 3300014154 | Grasslands Soil | MIAHDPLHGSGRAALPHPALALGDNAEAHEGIGMA |
| Ga0134075_105019071 | 3300014154 | Grasslands Soil | MVTHDPLHGSGRAELPHPALALGDDAHATQGMAGDRQRQPA |
| Ga0181532_100444262 | 3300014164 | Bog | MILDKSAVGVGITITHDPLHGSGRAAFPHPALALGNNAQAPQRIGMT |
| Ga0134079_104015572 | 3300014166 | Grasslands Soil | MITHNPLHGSGQAGFPHPALALGDNAHAAQGIGMT |
| Ga0075307_10695392 | 3300014260 | Natural And Restored Wetlands | MVAHNPLHRSGRAELPHPALASGNDAKAAQRIVMIDS |
| Ga0182014_105716152 | 3300014491 | Bog | MVTHNPLHGSGRAGFPHPALALGDDAQTAQGIVVV |
| Ga0182011_105951312 | 3300014496 | Fen | MVAHNPLHGSGRAAFPHPALALGDKAHAVQGIVVEDT |
| Ga0182024_100424698 | 3300014501 | Permafrost | MRVGVGITIAHDPLHGSGRADFPHPALALGNDAHAAQGIRMT |
| Ga0182024_106807634 | 3300014501 | Permafrost | MISHNPLRGSGRADFPHPALTSGNDAHAAQRKRMIY |
| Ga0182024_113357993 | 3300014501 | Permafrost | MISHNPLRGSGRADFPHPALTSGNDAHAAQRKRMI |
| Ga0182024_122280332 | 3300014501 | Permafrost | MFTHNPLHGSGQAGFPHPALALGDDAHTAQGIGMT |
| Ga0182030_102001764 | 3300014838 | Bog | MVAHNPLHGSGRADFPHPALALGDDAHAAQGIVVE |
| Ga0182030_102413534 | 3300014838 | Bog | MIAHDPLRGSGRADFPHPALTSGDDAHAAQRKRMI |
| Ga0182027_1000553919 | 3300014839 | Fen | MVTHNPLHRSGQAALPHPALALGGDGESHEGIGMA |
| Ga0137412_111222361 | 3300015242 | Vadose Zone Soil | MISHNPLHGSGQAALPHPALALGEDAYTAQGIGMTDRRQGQP |
| Ga0137409_101723671 | 3300015245 | Vadose Zone Soil | MIAHNPLHGSGQAALPHPALALGDDAHAAQGIGMTDD |
| Ga0182033_102203481 | 3300016319 | Soil | MIAHNPLHGSGQAELPHPALALGKDAHAAERIGMT |
| Ga0182035_100775333 | 3300016341 | Soil | MVAHNPLHGSGRAGFPHPALALGDDAQPAQGIVMVGA |
| Ga0182035_110840321 | 3300016341 | Soil | MVAHNPLNRSGRAGLPHPALASGDNAEAAQRVRMMD |
| Ga0182032_102517931 | 3300016357 | Soil | MKVGVGIMVAHNPLHGSGRAGFPHPALALGDDAHAAQGIV |
| Ga0182034_100998881 | 3300016371 | Soil | MVTHNPLRGSGRAGFPHPALTLGNNAHAAQSIRMIDANRMQPVSN |
| Ga0182040_104610361 | 3300016387 | Soil | MVTHNPLRGSGRAGFPHPALALGDDAHAAQGIVMIDANGREPAV |
| Ga0182040_114858372 | 3300016387 | Soil | MVTHNPLHGSGRAGFPHPALALGDDAHAAQGIVMA |
| Ga0182037_108128351 | 3300016404 | Soil | MVTHNPLRGSGRAGFPHPALALGDDAHAAQGIVMI |
| Ga0182038_111190761 | 3300016445 | Soil | MVAHNPLHGSGRAGSPHPALALGDDAHAAQGIVMEDANRREP |
| Ga0187879_107115021 | 3300017946 | Peatland | MVAHNPLHGTGRAGFPHPALALGDNAHAAQGIVVE |
| Ga0187779_107654122 | 3300017959 | Tropical Peatland | MVAHNPLNGSGRAAFPHPALASGDDAEAAQGIGMM |
| Ga0187781_101004035 | 3300017972 | Tropical Peatland | MVARDPLHGSGQAGFPHPALALGDDAHAAQGIIVV |
| Ga0187861_103358502 | 3300018020 | Peatland | MVAHNPLHGSGRAAFPHPALALGDNAHAVQGIVVE |
| Ga0187863_106407741 | 3300018034 | Peatland | MSVGVGITITHDPLRGSGQAAFPHPALALGDNAHAAQRVRM |
| Ga0184633_105002942 | 3300018077 | Groundwater Sediment | MPITERPLHGSGRADFPHPALALGDDAKPSQRIGMA |
| Ga0184612_101590691 | 3300018078 | Groundwater Sediment | MVAHNPLHGSGRAGLLHPALASGNDAKAYPRIRMT |
| Ga0184627_1000187013 | 3300018079 | Groundwater Sediment | MVAHHPLHRSGRADFPHPALASGDDAKSAQRVGMT |
| Ga0184639_101046244 | 3300018082 | Groundwater Sediment | MVLTDHPLHRSGRAGFPHPALASGSDAKATRGIGM |
| Ga0190265_101268444 | 3300018422 | Soil | MVTHNPLHRSGQAALPHPALALGGDGKSHEGIRVA |
| Ga0066655_111641331 | 3300018431 | Grasslands Soil | MITHNPLHGSGQAGFPHPALALGDNAHAAQGIGMTDGRQRQPA |
| Ga0066662_1000351512 | 3300018468 | Grasslands Soil | MIAHNPLHGSGRADFPHPALALGDNAHAPQRIGMT |
| Ga0187892_1000258138 | 3300019458 | Bio-Ooze | MMVAHNPLHRSGLAAFPHPALASGDDAKTAQWVGM |
| Ga0187892_1001327212 | 3300019458 | Bio-Ooze | MMVAHNPLHRSGLAAFPHPALASGDDAKTAQWVGMT |
| Ga0187892_101809243 | 3300019458 | Bio-Ooze | MTITRNPLHGSQRAELPHWALALGDNAKSPQGIGMA |
| Ga0187892_102067933 | 3300019458 | Bio-Ooze | MVAHNPLHRSGLAAFPHPALASGDDAKTAQWVGMT |
| Ga0187892_104560301 | 3300019458 | Bio-Ooze | MTITRNPLHGSQRAELPHWALALGDNAKSPQGIGM |
| Ga0187893_101090114 | 3300019487 | Microbial Mat On Rocks | MTIARNPLHGSGRAALPHPALASGDNAKSPQGIGVT |
| Ga0187893_101674375 | 3300019487 | Microbial Mat On Rocks | MTIARNPLHGSGRAALPHPALASGDNAKSPQGIGV |
| Ga0187893_103685722 | 3300019487 | Microbial Mat On Rocks | MTVTRNPLHGSQRAGLPHWALALGDNAKSPQGIGVSEARW |
| Ga0187893_106779882 | 3300019487 | Microbial Mat On Rocks | MTITRNPLHGSQRAGLPHWALASGDNAKSPQGIGMA |
| Ga0182028_10616171 | 3300019788 | Fen | MVTHNPLHRSGQAALPHPALALGGDGESHEGIGGDGESH |
| Ga0182028_12030971 | 3300019788 | Fen | MVTHNPLHRSGQAALPHPALALGGDGESHEGIGMADAAGVWQ |
| Ga0193747_10028146 | 3300019885 | Soil | MIAHNPLHGSGRAALPHPALALGDDAHAAQGIGMTDD |
| Ga0193728_10330324 | 3300019890 | Soil | MIAHNALHGSGRAGFPHPALALGDDAHAPQRIGMT |
| Ga0193735_10090504 | 3300020006 | Soil | MIAHNPLHGSGRAALPHPALALGDDAHAAQVIGMTDD |
| Ga0194113_100610934 | 3300020074 | Freshwater Lake | MIAHDPLHGSGHAALPHPALALGDDAEADEGIGMT |
| Ga0179590_12038141 | 3300020140 | Vadose Zone Soil | MFAHNPLHGSGQAGFPHPALALGDDAHAAQGIGMTD |
| Ga0179594_101790592 | 3300020170 | Vadose Zone Soil | MIAHNPLHGSGQAALPHPALALGDDAHAAQGIGMTD |
| Ga0179594_101819351 | 3300020170 | Vadose Zone Soil | MITHNPLHGSGQADFPHPALALGDNAHASQGIGMTDGRRRQPASD |
| Ga0194120_1000136841 | 3300020198 | Freshwater Lake | MIAHDPLHGSGHAALPHPALALGDDAEADEGIGMTD |
| Ga0179592_103572562 | 3300020199 | Vadose Zone Soil | MIAHDPLHGSGRAALPHPALALGEDAHATQGIGMTD |
| Ga0210407_100031771 | 3300020579 | Soil | MIAHNPLHGSGQAGFPHPALALGDDAHATQGVGMTDG |
| Ga0210407_101805771 | 3300020579 | Soil | MIAHDPLHGSGRADFPHPALALSNNAHAAQRIGMTDS |
| Ga0210399_105925763 | 3300020581 | Soil | MISHNPLHGSGRAGFPHPALALGDDAHATQRIGMTD |
| Ga0210399_106012782 | 3300020581 | Soil | MIAHDPLYRSGQAAFPHPALALGVDDQPLRGIGMKN |
| Ga0210395_100064851 | 3300020582 | Soil | MIAHDPLHGSGRADFPHPTLALGNNAHAAQGIGMTDRRH |
| Ga0210395_102613181 | 3300020582 | Soil | MIAHDPLHGSGRADFPHPALALGNNAHAAQGIGMTD |
| Ga0210395_104661392 | 3300020582 | Soil | MITHNPLHGSGQADFPHPALALGDNAHAAQGIGMTDG |
| Ga0215015_105754481 | 3300021046 | Soil | MIAHNPLHGSGRAAFPHPALALGNDAHAAQGIGMTDGRQRQPA |
| Ga0179596_101833052 | 3300021086 | Vadose Zone Soil | MFAHNPLHGSGQAGFPHPALALGDDAHATPGIGMTD |
| Ga0210405_105145101 | 3300021171 | Soil | MITHNPLHGSGQAGFPHPALALGEDAYASQGIGMTD |
| Ga0210393_108628261 | 3300021401 | Soil | MIAHNPLHGSGQAGFPHPALALGSDAHTAQGIGMTDGRQRQSAS |
| Ga0210385_1000344815 | 3300021402 | Soil | MIAHNPLHGSGQAAFPHPALTLGDNAHAAERIRMVDAN |
| Ga0210385_101516021 | 3300021402 | Soil | MVTHNPLYGSGQAGLPHPALTSGDNAQAAQGIRMTS |
| Ga0210387_104751181 | 3300021405 | Soil | MIAHDPLHGSGRADFPHPARALGNNAHAAQGIGMTD |
| Ga0210383_111851091 | 3300021407 | Soil | MIAHNPLHGSGQAALPHPALALGEDAHAAQGVGMTDGRRGQPA |
| Ga0210394_1000302231 | 3300021420 | Soil | VIAHDPLHGSGRADFPHPALALGKNAHAAQGIGMTD |
| Ga0210394_103247101 | 3300021420 | Soil | VIAHDPLHGSGRADFPHPALALSNNAHAAQGIGMTD |
| Ga0210394_103858381 | 3300021420 | Soil | MIAHNPLHGSGQAGFPHPALALGDDAHAAQGIGMTD |
| Ga0210394_108035791 | 3300021420 | Soil | VIAHDPLHGSGRADFPHPALALSNNAHAAQGIGMT |
| Ga0210384_1000053853 | 3300021432 | Soil | MITHNPLHGSGRADFPHPALASGDDAHAAQGIRMIG |
| Ga0210391_109216821 | 3300021433 | Soil | MIAHNPLRGSGRADFPHPALTSGNDAHAAQRKGMIY |
| Ga0213878_103006861 | 3300021444 | Bulk Soil | MVAHNPLNRSGRAVLPHPALASGDNAEAAQRVGMID |
| Ga0210392_101377681 | 3300021475 | Soil | MITHNPLHGSGQADFPHPALALGDNAHAAQGIGMTD |
| Ga0187846_100120382 | 3300021476 | Biofilm | MVTHNPLHGSGRAGFPHLALALGDDAHTAQGIVMGRHGQEGASG |
| Ga0210398_100258858 | 3300021477 | Soil | MIAHNPLHGSGQAALPHPAFALGEDVHAAQGVGMGSPGSR |
| Ga0210398_100287141 | 3300021477 | Soil | MIAHDPLHGSGRADFPHPALALGNNAHAAQGIGMT |
| Ga0210398_100347148 | 3300021477 | Soil | MIAHDPLHGSGRADFPHPALALGNNAHAAQGIGMTERRHGKQAI |
| Ga0210409_100528371 | 3300021559 | Soil | MITHNPLHGSGQADFPHPALALGDNAHAAQGIVMT |
| Ga0210409_101741541 | 3300021559 | Soil | MIAHNPLHGSGRAGFPHPALALGNDAHAAQGIGMTD |
| Ga0210409_104758851 | 3300021559 | Soil | VIAHDPLHGSGRAELPHPALASGDDAEAAQRIGMI |
| Ga0210409_115245651 | 3300021559 | Soil | MIAHNPLHGSGPTALPHPALALGADAHAAERIGMTDG |
| Ga0126371_103012101 | 3300021560 | Tropical Forest Soil | MVAHNPLDRSGRAAFPHPALASGDNAEAAQRVWMM |
| Ga0126371_128602912 | 3300021560 | Tropical Forest Soil | MIAHNPLHGSGQADFPHPALALGDDAQAAQGIGMT |
| Ga0212123_100127461 | 3300022557 | Iron-Sulfur Acid Spring | MIAHNPLHGSGQAALPHPALALGKDAHATQGIGMTDG |
| Ga0212123_102354313 | 3300022557 | Iron-Sulfur Acid Spring | MVTHDPLHRSGRAAFPHPALASGDDPKSPQRIRMTN |
| Ga0224563_10080951 | 3300022731 | Soil | MIAHNPLHGSGRADFPHPALALGNNAHAAQGIGMTD |
| Ga0224569_1074323 | 3300022732 | Rhizosphere | MIAHNPIHGSGRAGVPHPALALGDDAHAAERIGMTDGRHRQPA |
| Ga0224552_10205791 | 3300022850 | Soil | MIAHNPLRGSGRADFPHPALTSGDDAHAAQRKRMIH |
| Ga0224550_10416671 | 3300022873 | Soil | MITHNPLHGSGRAVFPHPALALGDDAHAAQWIGMTD |
| Ga0224529_10071491 | 3300023247 | Soil | MITHNPLHRSGRADFPHPAPTSGNDAHAAQRKRMIH |
| Ga0224521_11198051 | 3300024233 | Soil | MVTHNPLHRSGQAALPHPALALGGDGESHEGIGMADA |
| Ga0209979_10742093 | 3300024353 | Deep Subsurface | MVAHDPLPRSQRAGLPHWAPASGNNAHTTQGIGMTY |
| Ga0208961_10023651 | 3300025051 | Groundwater | MVAHSPLHRSQRAVFPHWALASGDDAKSHQGIGVTY |
| Ga0208968_10140191 | 3300025111 | Soil | MVAHSPLHRSQRAVFPHWALASGDDAKSHQGIGVT |
| Ga0209431_104188622 | 3300025313 | Soil | MVAHNPLHRSQRAGLPHWALALGDNAKSPQRIGVRD |
| Ga0209519_102961873 | 3300025318 | Soil | MITHNPLHRSQRAGLPHWALALGDNAKSPQGIGMAN |
| Ga0209341_101987151 | 3300025325 | Soil | MVTHNPLHRSQRAGLPHWALALGDNAKSPQRIGVR |
| Ga0207699_109182332 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MIAHNPLHGSGQAGFPHPALALGEDAHAMQRIGMTD |
| Ga0207684_100677324 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MIAHNPLHGSGQAALPHPALALGKDAHAAERIGMT |
| Ga0207684_105422672 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MIAHNPLHGSGQAGFPHPALALGEDAHAAQGIGMTD |
| Ga0207684_114628492 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MFAHNPLHGSGQAGFPHPALALGEDAHAAQGIGMAD |
| Ga0207646_100535974 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MIAHNPLHGSGRAGFPHPALALGNDAHAAQGIGMT |
| Ga0209350_100226513 | 3300026277 | Grasslands Soil | MIAHNPLHGSGQAGFPHPALALGDNAHAAQGIGMTDG |
| Ga0209234_10848442 | 3300026295 | Grasslands Soil | MVAHNPLHGSGQAGLPHPALTSGDNAHAAQGIRMTSAGGR |
| Ga0209236_11097102 | 3300026298 | Grasslands Soil | MVAHNPLHGSGQAGLPHPALTSVDNAHAAQGIRMTS |
| Ga0209236_11149531 | 3300026298 | Grasslands Soil | MTIARNPLHGSGRAALPHPALALGDNAKSPQGIGMTNA |
| Ga0209238_10662431 | 3300026301 | Grasslands Soil | MITHNPLHGSGQADFPHPALALGDNAHASQGIGMTDGRQWQPA |
| Ga0209240_10125784 | 3300026304 | Grasslands Soil | MIAHNPLHGSGQAGFPHPALALGEDAHATQGIGMTE |
| Ga0209240_10475312 | 3300026304 | Grasslands Soil | MVAHNPLHGSGQAGLPHPALTSGDDAHAAQGIRMTSA |
| Ga0209055_10001571 | 3300026309 | Soil | MIAHNPLHGSGRADFPHPALALGDNAHAPQRIGMTDR |
| Ga0209055_10059529 | 3300026309 | Soil | MIAHNPLHGSGRADFPHPALALGDNAHAPQRIGMTD |
| Ga0209055_10979752 | 3300026309 | Soil | MIAHNPLHGSGQAALPHPALALGENAHAAQGIGMTDG |
| Ga0209055_11191101 | 3300026309 | Soil | MIAHNPLHGSGQAALPHPALALGENAHAAQGIGMTD |
| Ga0209761_10373281 | 3300026313 | Grasslands Soil | MTIARNPLHGSGRAALPHPALASGDDAKSPQGIGMTN |
| Ga0209154_10169111 | 3300026317 | Soil | MITHNPLHGSGQADFPHPALALGDNAHAAQGIRMTDGRQRQ |
| Ga0209471_10014931 | 3300026318 | Soil | VISDHPVGVGITIAHDPLHGSGRAELPHPALALGNDAHATQRIGMTDS |
| Ga0209152_1000018232 | 3300026325 | Soil | MLAHNPLHGSGQAGFPHPALALGDNAHAAQGIGMTDGRQRQPA |
| Ga0209375_11083403 | 3300026329 | Soil | MITHNPLHGSGQADFPHPALALGDNAHAAQGIRMTDGRQRQP |
| Ga0209375_11187931 | 3300026329 | Soil | MIAHDPLHGSGRAALPHPALALGEDAHATQGIGMTDRRQWQPTVDE |
| Ga0257170_10247473 | 3300026351 | Soil | MIAHNPLHGSGQAALPHPALALGEDAHAAERIGMTD |
| Ga0257177_10756022 | 3300026480 | Soil | MVAHNPLHGSGRAELPHPALASGNNAKAPEGIGMADTRS |
| Ga0257172_10251881 | 3300026482 | Soil | MIAHNPLHGSGQAALPHPALALGDHAHAAQGIGMTDDRQRQPASD |
| Ga0257172_10278081 | 3300026482 | Soil | MIAHNPLHGSGQAGFPHPALALGDDAHTAQGIGMTDGRRGQPA |
| Ga0257160_10032821 | 3300026489 | Soil | MIAHNPLHGSGRADFPHPALALGNDAHAAQRIGMTD |
| Ga0209157_10811443 | 3300026537 | Soil | MTIARNPLHGSGRAALPHPALASGDDAKSPQGIGMTYA |
| Ga0209156_102139233 | 3300026547 | Soil | MVAQNPLHGSGRAALLHPALALGNNAKALPGIRVTN |
| Ga0209648_103483134 | 3300026551 | Grasslands Soil | MITHNPLHGSGQAALPHPALALGDDAHAAQGIGMTDRRQW |
| Ga0209648_104929023 | 3300026551 | Grasslands Soil | MITHNPLHGSGQADFPHPALALGDNAHAAQGIGMTDGR |
| Ga0179587_105586241 | 3300026557 | Vadose Zone Soil | MIAHNPLHGSGQAGFPHPALASGDNAHAAQGIGMTD |
| Ga0209523_10071901 | 3300027548 | Forest Soil | VAHDPLRGSGRADFPHPALTLGNNAHAAQRIRMIDANRM |
| Ga0209588_10014221 | 3300027671 | Vadose Zone Soil | MVAHNPLHRSGRAAFPHPALASGDDAKSPQGIGMTDA |
| Ga0209908_100447731 | 3300027745 | Thawing Permafrost | MITHNPLHGSGRAVFPHPALALGDDAHAAQWIGMT |
| Ga0209288_100351713 | 3300027762 | Freshwater Sediment | MVAHNPLHGSGRAGLPHPALASGDDAEAAQGIVMID |
| Ga0209655_103048192 | 3300027767 | Bog Forest Soil | MITHNPLHGSGQADFPHPALALGDNAHAAQGIGMTDGRQ |
| Ga0209656_101821343 | 3300027812 | Bog Forest Soil | MIAHNSLHGSGQAGFPHPALALGEDAYASQGIGMADGRQRQPAS |
| Ga0209180_102171273 | 3300027846 | Vadose Zone Soil | MIAHNPLHGSGQAGFPHPALALGEDAHAMQGIGMTD |
| Ga0209180_104336342 | 3300027846 | Vadose Zone Soil | MIAHNPLHGSGRADFPHPALALGDDTHAAQGIGMTD |
| Ga0209579_105723521 | 3300027869 | Surface Soil | MFAHNPLHGSGRAGFPHPALALGEDAHASQGIRMIGAH |
| Ga0209283_107373831 | 3300027875 | Vadose Zone Soil | MVTHNPLHRSGQAGFPHPALALGDDAHAAQGIRMEDANGR |
| Ga0209275_100976863 | 3300027884 | Soil | MIAHNPLHGSGQAGFPHPALALGNDAHTPQRIRMTDRREGQ |
| Ga0209275_101502753 | 3300027884 | Soil | MIAHNPLRGSGRAVFPHPALALGEDGHAMQGIGMT |
| Ga0209048_110026033 | 3300027902 | Freshwater Lake Sediment | MVAHNPLHRSGRAGLPHPALASGNDAKATQGIVMIDSGIGQI |
| Ga0209698_105003472 | 3300027911 | Watersheds | MIAHNPLHGSGQADFPHPALALGDDAHAAQRIGMTDSR |
| Ga0209061_10151111 | 3300027968 | Surface Soil | MVTHDPLHGSGRAGFPHPALALGDDAHAAQRLVMID |
| Ga0137415_1002781810 | 3300028536 | Vadose Zone Soil | VIARIITYEVGVGITIAHDPLHGSGRAGFPHPALALGNN |
| Ga0265323_100044371 | 3300028653 | Rhizosphere | MVTHNPIHGSGLADFPHPALALGDDAEAAQRIVMVDANRREP |
| Ga0265323_100262494 | 3300028653 | Rhizosphere | MVTHNPLHGSGLADFPHPALALGDDAEAAQRIVMVD |
| Ga0302267_100792592 | 3300028745 | Bog | MIAHNPLRGSGRADFPHPALTSGNDAHAAQGKRMIYA |
| Ga0307504_100553911 | 3300028792 | Soil | MIAHNPLHGSGQAELPHPALTSGNNAHAAQGIRMTS |
| Ga0308309_109074251 | 3300028906 | Soil | MLVGVGIMIAHNPLHGSGRAGFPHPALALGNDAHAAQGIGMTD |
| Ga0311363_1000118644 | 3300029922 | Fen | MIAHNPLRGSGRADFPHPALTSGDDAHAAQRKRMIHM |
| Ga0311330_100003571 | 3300029945 | Bog | MIAHNPLRGSGRADFPHPALTSGDDAHAAQRKRMI |
| Ga0302275_101997433 | 3300030518 | Bog | MIAHNPLRGSGRADFPHPAPTSGNDAHAAQGKRMIY |
| Ga0302046_103326731 | 3300030620 | Soil | MVAHNPLHRSGRAAFPHPAPASGDDAKAPQWIGMTDA |
| Ga0170824_1269978452 | 3300031231 | Forest Soil | MVAHNPLNGSGRAGLPHPALASGDDAKAAQRIGMM |
| Ga0302325_133825511 | 3300031234 | Palsa | MIDHNPLHGSGRAGFPHPALALGNDAHAAQRIGMTD |
| Ga0265330_100031618 | 3300031235 | Rhizosphere | MVTHNPLHRSGQAALPHPALALGGDGESHEGIGMAD |
| Ga0302324_1002010481 | 3300031236 | Palsa | MITHNPLHGSGQADFPHPALALGDDAHAAQGIGMTDG |
| Ga0308194_100549221 | 3300031421 | Soil | MIAHNPLHGSGRAALPHPALALGDDAHAAQGIGMT |
| Ga0170818_1115944423 | 3300031474 | Forest Soil | MIAHNPLHGSGQAGFPHPALALGEDARATQGIGMTDSRQWQPTG |
| Ga0318516_106304722 | 3300031543 | Soil | MVTHNPLHGSGRAGFPHPALALGDDAHAAQGIVVVDANRREP |
| Ga0318541_100078721 | 3300031545 | Soil | MIAHNPLHGSGQAELPHPALALGNDAHAAQGIGMTDSSSEN |
| Ga0307408_1000080201 | 3300031548 | Rhizosphere | MPIAEYPLHGSGRAALPHPALALGGERQTLVGIGMT |
| Ga0307408_1000162911 | 3300031548 | Rhizosphere | MPIAEYPLHGSGRAALPHPALALGGERQTLVGIGMTDTR |
| Ga0318573_104584531 | 3300031564 | Soil | MVAHNPLHGSGRAGFPHPALALGDDAHAAQGIVMED |
| Ga0310915_106749621 | 3300031573 | Soil | MIAHNPLHGSGRADFPHPALALGNDAHAAQGIGMTD |
| Ga0310686_1039498371 | 3300031708 | Soil | MIAHNPLHGSGQADFPHPALALGDDAHAAQGIGMTDG |
| Ga0310686_1087363621 | 3300031708 | Soil | MITHNPLHGSGRADFPHPALALGDDAHATQRIGMTD |
| Ga0310686_1087423181 | 3300031708 | Soil | MKVGVGIMITHNPLHGSGRADFPHPALALGDDAHATQRIGMTD |
| Ga0310686_1097018792 | 3300031708 | Soil | MIAHNPLHGSGRADFPHPALALGNNAHAAQGIGMTDG |
| Ga0310686_1136478581 | 3300031708 | Soil | MIAHDPLHGSGRADFPHPALALGNNAHAAQRIGMADS |
| Ga0310686_1140561767 | 3300031708 | Soil | MIAHNPLHGSGRAGFPHPALALGNDAHAAQGIGMTDG |
| Ga0310686_1140585531 | 3300031708 | Soil | MIAHNPLHGSGQAGFPHPALALGEDAYASQGIGMTDG |
| Ga0310686_1170896791 | 3300031708 | Soil | MIAHDPLHGSGRADFPHPALALSNNAHAAQRIGMADS |
| Ga0310686_1183645281 | 3300031708 | Soil | MIAHNPLHGSGQADFPHPALALGDDAHAAQGIGMTD |
| Ga0307476_100001371 | 3300031715 | Hardwood Forest Soil | MITHNPLHGSGRAGFPHPALALGNDAHAAQRIGMTDG |
| Ga0307476_1000033638 | 3300031715 | Hardwood Forest Soil | MITHNPLHGSGRAGFPHPALALGNDAQAAQRIGMTDG |
| Ga0307476_103363011 | 3300031715 | Hardwood Forest Soil | MIAHDPLHGSGRADFPHPALALGKNAHAAQRIRMTD |
| Ga0307476_107924841 | 3300031715 | Hardwood Forest Soil | VIAHNPLHGSGRAAFPHPALALGNDAHATQRIGMTDIR |
| Ga0307474_100010491 | 3300031718 | Hardwood Forest Soil | MIAHNPLHGSGQAGFPHPALALGEDAYASQGIGMTDGRHRQPA |
| Ga0307474_1000589213 | 3300031718 | Hardwood Forest Soil | MIAHNPLHGSGQAGFPHPALALGNDAHAAQGIGMTD |
| Ga0307474_109927042 | 3300031718 | Hardwood Forest Soil | MITHNPLHGSGRAGFPHPALALGSDAHAAQRIGMTDG |
| Ga0306917_104844292 | 3300031719 | Soil | MIAHNPLHGSGQAELPHPALALGNDAHAAQGIGMTDSS |
| Ga0318500_104500551 | 3300031724 | Soil | MIAHNPLHGSGQAELPHPALALCNDAHAAQGIGMT |
| Ga0307468_1015458391 | 3300031740 | Hardwood Forest Soil | MVTHNPLHGSGRAALLHPALALGNNAKAVPGIRVTD |
| Ga0306918_102902311 | 3300031744 | Soil | MIAHNPLHGSGQAELPHPALALGNDAHAAQGIGMTD |
| Ga0306918_111919431 | 3300031744 | Soil | MITHNPLHGSGQADFPHPALALGDDAHAAQGRGMTD |
| Ga0318502_107866942 | 3300031747 | Soil | MIAHNPLHGSGQADFPHPALALGDDAHAAQGIGMTDGRQRQPA |
| Ga0307477_100012921 | 3300031753 | Hardwood Forest Soil | MIAHNPLHGSGQAGFPHPALALGEDAQAAQGIGMTDG |
| Ga0307477_100273976 | 3300031753 | Hardwood Forest Soil | MIAHNPLHGSGRAAFPHPALALGNDAHAAQGIGMTD |
| Ga0307475_100933474 | 3300031754 | Hardwood Forest Soil | MIAHNPFHGFGQAGFRHPALALGDDAHAAQGIGMTDGR |
| Ga0307475_110500971 | 3300031754 | Hardwood Forest Soil | MIAHKPLHGSGRAELPHPALALGEDAHAAQGIGMTD |
| Ga0318546_104072001 | 3300031771 | Soil | MVAHNPLNRSGRADFPHPALASGDNAEAAQGIGMMD |
| Ga0315288_113846852 | 3300031772 | Sediment | MVAHDPLHGSQRAELPHWALASGDDAHAAQGITRTT |
| Ga0318552_103921592 | 3300031782 | Soil | MITHNPLHGSGQADFPHPALALGDDAHAAQGIGMT |
| Ga0302319_107159221 | 3300031788 | Bog | MIAHNPLHRSVRAEFPHTAPALGDDAHAPQRIGMANGGGR |
| Ga0307478_1000779315 | 3300031823 | Hardwood Forest Soil | MITHNPLHGSGRAGFPHPALALGSDAHAAQRIGMTD |
| Ga0307478_101521511 | 3300031823 | Hardwood Forest Soil | MIAHNPLHGSGQAGFPHPALALGEDAQAAQGIGMTD |
| Ga0307478_108997032 | 3300031823 | Hardwood Forest Soil | MIAHNPLHGSGQAALPHPALALGDDAHAAQGIGMTDGR |
| Ga0306925_121078401 | 3300031890 | Soil | MVAHDPLHRSGRAGFPHPALALGDHAHAAQGIVVVD |
| Ga0306923_119578992 | 3300031910 | Soil | MVAHNPLDGSGRAVLPHPALASGDNAEAAQRVRMMDAGRG |
| Ga0306921_101486331 | 3300031912 | Soil | MVAHNPLNRSGRADFPHPALASGDNAEAAQRVGMMD |
| Ga0310912_113297481 | 3300031941 | Soil | MVAHNPLARSGRAVLPHPALASGDNAEAAERVRMM |
| Ga0310916_107752511 | 3300031942 | Soil | MVAHHPLIRSGRAVLPHPALASDDNAEAAQRVGMVD |
| Ga0214473_102092035 | 3300031949 | Soil | MVTHNPLHRSQRAGLPHWALALGDNAKSPQRIGVRD |
| Ga0306926_111295861 | 3300031954 | Soil | MVAHNPLNRSGRAVLPHPALTSGDEAEAAQGIGMMK |
| Ga0318549_102156901 | 3300032041 | Soil | MIAHNPLHGSGQAELPHPALALADDAHATQGIGMTD |
| Ga0318549_104186671 | 3300032041 | Soil | MVAHNPLARSGRAVLPHPALASGDNAEAAERVRMMDTNGGQP |
| Ga0318570_102805032 | 3300032054 | Soil | MVAHNPLNRSGRADFPHPALASGDNAEAAQRVGMM |
| Ga0318504_102821141 | 3300032063 | Soil | MVTHNPLHGSGRAGFPHPALALGDDAHAAQGIVVV |
| Ga0306924_120665971 | 3300032076 | Soil | MIAHNPLHGSGRADFPHPALALGNDAHAAQGIGMT |
| Ga0318525_104937752 | 3300032089 | Soil | MIAHNPLHGSGQAELPHPALASGNDAQAAERIGMTDGRQR |
| Ga0315281_101211861 | 3300032163 | Sediment | MVTHNPLHGSGRAAFPHPALASGDNAKSPQGIGVAD |
| Ga0315281_105768781 | 3300032163 | Sediment | MVTHNPLHGSGRAAFPHPALASGDNAKSPQGIGVADA |
| Ga0315281_123512342 | 3300032163 | Sediment | MVAHNPLHRSGQAALPHPALALGGYGEAQAWIGMADAGT |
| Ga0307470_110398031 | 3300032174 | Hardwood Forest Soil | MVAHNPLHGSGQAGLPHPALTSGDDAHATQGIRMTS |
| Ga0315276_100080571 | 3300032177 | Sediment | MVAHNPLHRSGRAGLPHPAPASGDDATSPQGIVMTYAGLGQ |
| Ga0307471_1014624911 | 3300032180 | Hardwood Forest Soil | MIAHNPLHGSGQAGFPHPALALGYDAHAAQGIGMTD |
| Ga0307471_1031147102 | 3300032180 | Hardwood Forest Soil | MIAHNPLHGSGQAGFPHPALALGDDAHAAQGIGMTDGRRRQPASD |
| Ga0307471_1035689342 | 3300032180 | Hardwood Forest Soil | MIAHNPLRGSGQAALPHPALALGENAYATQGIGMTDRRQR |
| Ga0307471_1040324902 | 3300032180 | Hardwood Forest Soil | MIARNPLHGSGQAALPHPALALGSDAHASQRIGTDGFGV |
| Ga0307472_1008055712 | 3300032205 | Hardwood Forest Soil | MIAHNPLHGSGQAGFPHPALALGDNAHAAQGIGMTDS |
| Ga0306920_1000064371 | 3300032261 | Soil | MVAHNPLNRSGRADFPHPALASGDNAEAAQGIGMMDA |
| Ga0306920_1000831376 | 3300032261 | Soil | MVAHNPLHGSGRAGFPHPALALGDDAHAAQGIVMEDA |
| Ga0306920_1001134964 | 3300032261 | Soil | MVAHNPLHGSGRAGLLHPALASGNDAKALPGIRMTNV |
| Ga0306920_1002571331 | 3300032261 | Soil | MITHNPLHGSGQAGFPHPALALGDNAHAAQGIGMID |
| Ga0306920_1006163953 | 3300032261 | Soil | MIARNPLHGSGQAGLPHPALALGEDAHAAQGIGMTDG |
| Ga0306920_1007285853 | 3300032261 | Soil | MVTHNPLHGSGRAGFPHPALALGDDAHAAQGIVMAD |
| Ga0335085_1000074874 | 3300032770 | Soil | MVAHNPLHRSGRAGFPHPALALGDDAQAAQRISMVD |
| Ga0335085_100036861 | 3300032770 | Soil | MIAHNTLHGSGQADFPHPALALGDDAHATQGIGMAD |
| Ga0335085_100319151 | 3300032770 | Soil | MVTHNPLHRSGRADFPHPAPALGDDAKAAQGIVMIDADRREPA |
| Ga0335082_1000339814 | 3300032782 | Soil | MIAHNTLHGSGQADFPHPALALGDDAHATQGIGMA |
| Ga0335079_115167422 | 3300032783 | Soil | MIAHNPLHGSGQADFPHPALALGEDAHAAQGIRMTDG |
| Ga0335081_105620881 | 3300032892 | Soil | MVAHNPLNGSGRAAFPHPALASGDDAEAAQGIGMMNA |
| Ga0335081_107689622 | 3300032892 | Soil | MIAHNPLHGSGQADFPHPALALGEDAHAAQGIRMTD |
| Ga0335074_100062991 | 3300032895 | Soil | MPGSEVGVGIRVAPDPLHGSGRADFPHPALASGNDAHAAKRIR |
| Ga0335071_108915041 | 3300032897 | Soil | MVAHDPLHRSGQAALPHPALALGDNAEAHKGIRMTD |
| Ga0335083_100221148 | 3300032954 | Soil | MVTHNPLHRSGRADFPHPAPALGDDAKAAQGIVMI |
| Ga0335076_101507321 | 3300032955 | Soil | MVAHNTLNGSGRAAFPHPALASGDDAEAAQGIGMMN |
| Ga0335077_119692692 | 3300033158 | Soil | MVAHDPLHRSGRAGFPHPALALGDDAQAAQRISMVD |
| Ga0310914_100210371 | 3300033289 | Soil | MIAHNPLHGSGQADFPHPALALGDDAHAAQGIGMT |
| Ga0310914_106270041 | 3300033289 | Soil | MVAHNPLHGSGRAGFPHPALALGDDAHAAQGIVME |
| Ga0326727_102903004 | 3300033405 | Peat Soil | MVAHNPLHGSGRAGLPHPALASGDDAKAAQGIVMVD |
| Ga0214472_108036931 | 3300033407 | Soil | MVAHDPLHRSGRAGFPHPALASGDDAKPPQRIGMTHAGR |
| Ga0316620_122583691 | 3300033480 | Soil | MIIADHPLHGSGRAELPHPALASGTSVKALPGIGMKD |
| Ga0316630_100857293 | 3300033487 | Soil | VVAHNPLHGSGRAAFPHPALALGEDAKSPQRVGVKNVNRG |
| Ga0316628_1003674631 | 3300033513 | Soil | MIAHNPLHGSGRAAFPHPALALGNDAHASQRIGMTDSRHR |
| Ga0334848_005296_3223_3333 | 3300033827 | Soil | MIAHNPLHGSGQAALPHPALALGGDGKSHEGIGMTDA |
| Ga0364929_0237103_506_610 | 3300034149 | Sediment | MVTHNPLHGSGRAALPHPALALGNDAQAHEGLRMA |
| ⦗Top⦘ |