


| Basic Information | |
|---|---|
| Family ID | F006593 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 369 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MKALIAALALATLIAVPTFAQPANAAPMSPASSSFGSNGY |
| Number of Associated Samples | 205 |
| Number of Associated Scaffolds | 369 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 80.71 % |
| % of genes near scaffold ends (potentially truncated) | 31.71 % |
| % of genes from short scaffolds (< 2000 bps) | 73.44 % |
| Associated GOLD sequencing projects | 184 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.38 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (72.358 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil (20.867 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.436 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (56.640 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 25.00% β-sheet: 0.00% Coil/Unstructured: 75.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 369 Family Scaffolds |
|---|---|---|
| PF00266 | Aminotran_5 | 3.52 |
| PF03401 | TctC | 3.25 |
| PF09694 | Gcw_chp | 3.25 |
| PF00300 | His_Phos_1 | 3.25 |
| PF07681 | DoxX | 2.44 |
| PF04392 | ABC_sub_bind | 2.17 |
| PF07007 | LprI | 1.90 |
| PF10129 | OpgC_C | 1.63 |
| PF08327 | AHSA1 | 1.36 |
| PF13714 | PEP_mutase | 1.08 |
| PF01047 | MarR | 1.08 |
| PF00155 | Aminotran_1_2 | 0.81 |
| PF01042 | Ribonuc_L-PSP | 0.81 |
| PF02617 | ClpS | 0.81 |
| PF00027 | cNMP_binding | 0.54 |
| PF00378 | ECH_1 | 0.54 |
| PF00211 | Guanylate_cyc | 0.54 |
| PF01799 | Fer2_2 | 0.54 |
| PF13358 | DDE_3 | 0.54 |
| PF00529 | CusB_dom_1 | 0.54 |
| PF02518 | HATPase_c | 0.54 |
| PF13442 | Cytochrome_CBB3 | 0.54 |
| PF01068 | DNA_ligase_A_M | 0.54 |
| PF09954 | DUF2188 | 0.54 |
| PF01425 | Amidase | 0.54 |
| PF13356 | Arm-DNA-bind_3 | 0.27 |
| PF17172 | GST_N_4 | 0.27 |
| PF02627 | CMD | 0.27 |
| PF01557 | FAA_hydrolase | 0.27 |
| PF00873 | ACR_tran | 0.27 |
| PF00496 | SBP_bac_5 | 0.27 |
| PF00196 | GerE | 0.27 |
| PF05368 | NmrA | 0.27 |
| PF00149 | Metallophos | 0.27 |
| PF08281 | Sigma70_r4_2 | 0.27 |
| PF02775 | TPP_enzyme_C | 0.27 |
| PF04542 | Sigma70_r2 | 0.27 |
| PF02469 | Fasciclin | 0.27 |
| PF17171 | GST_C_6 | 0.27 |
| PF09084 | NMT1 | 0.27 |
| PF07992 | Pyr_redox_2 | 0.27 |
| PF04324 | Fer2_BFD | 0.27 |
| PF00486 | Trans_reg_C | 0.27 |
| PF16884 | ADH_N_2 | 0.27 |
| PF01717 | Meth_synt_2 | 0.27 |
| PF03595 | SLAC1 | 0.27 |
| PF07536 | HWE_HK | 0.27 |
| PF09123 | DUF1931 | 0.27 |
| PF11794 | HpaB_N | 0.27 |
| PF13391 | HNH_2 | 0.27 |
| PF02322 | Cyt_bd_oxida_II | 0.27 |
| PF00871 | Acetate_kinase | 0.27 |
| PF13384 | HTH_23 | 0.27 |
| PF07400 | IL11 | 0.27 |
| PF13533 | Biotin_lipoyl_2 | 0.27 |
| PF12681 | Glyoxalase_2 | 0.27 |
| PF00905 | Transpeptidase | 0.27 |
| PF03330 | DPBB_1 | 0.27 |
| PF10431 | ClpB_D2-small | 0.27 |
| PF01515 | PTA_PTB | 0.27 |
| PF13618 | Gluconate_2-dh3 | 0.27 |
| PF04545 | Sigma70_r4 | 0.27 |
| PF14247 | DUF4344 | 0.27 |
| PF13473 | Cupredoxin_1 | 0.27 |
| COG ID | Name | Functional Category | % Frequency in 369 Family Scaffolds |
|---|---|---|---|
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 3.25 |
| COG2259 | Uncharacterized membrane protein YphA, DoxX/SURF4 family | Function unknown [S] | 2.44 |
| COG4270 | Uncharacterized membrane protein | Function unknown [S] | 2.44 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 2.17 |
| COG3755 | Uncharacterized conserved protein YecT, DUF1311 family | Function unknown [S] | 1.90 |
| COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 0.81 |
| COG2127 | ATP-dependent Clp protease adapter protein ClpS | Posttranslational modification, protein turnover, chaperones [O] | 0.81 |
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 0.54 |
| COG1423 | ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family | Replication, recombination and repair [L] | 0.54 |
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 0.54 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.54 |
| COG0280 | Phosphotransacetylase (includes Pta, EutD and phosphobutyryltransferase) | Energy production and conversion [C] | 0.27 |
| COG0282 | Acetate kinase | Energy production and conversion [C] | 0.27 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.27 |
| COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 0.27 |
| COG0620 | Methionine synthase II (cobalamin-independent) | Amino acid transport and metabolism [E] | 0.27 |
| COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.27 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.27 |
| COG1275 | Tellurite resistance protein TehA and related permeases | Defense mechanisms [V] | 0.27 |
| COG1294 | Cytochrome bd-type quinol oxidase, subunit 2 | Energy production and conversion [C] | 0.27 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.27 |
| COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 0.27 |
| COG2335 | Uncaracterized surface protein containing fasciclin (FAS1) repeats | General function prediction only [R] | 0.27 |
| COG3426 | Butyrate kinase | Energy production and conversion [C] | 0.27 |
| COG3920 | Two-component sensor histidine kinase, HisKA and HATPase domains | Signal transduction mechanisms [T] | 0.27 |
| COG4251 | Bacteriophytochrome (light-regulated signal transduction histidine kinase) | Signal transduction mechanisms [T] | 0.27 |
| COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.27 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.27 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 72.63 % |
| Unclassified | root | N/A | 27.37 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2088090014|GPIPI_16669286 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 5754 | Open in IMG/M |
| 2088090014|GPIPI_16806024 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2943 | Open in IMG/M |
| 2088090014|GPIPI_17349655 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 7900 | Open in IMG/M |
| 2170459004|F62QY1Z01DVE6H | Not Available | 509 | Open in IMG/M |
| 2228664022|INPgaii200_c1015116 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1163 | Open in IMG/M |
| 2228664022|INPgaii200_c1106536 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium | 2378 | Open in IMG/M |
| 2228664022|INPgaii200_c1190010 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2734 | Open in IMG/M |
| 3300000033|ICChiseqgaiiDRAFT_c2211144 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 724 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101224600 | Not Available | 765 | Open in IMG/M |
| 3300000550|F24TB_14885137 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
| 3300000579|AP72_2010_repI_A01DRAFT_1046727 | Not Available | 629 | Open in IMG/M |
| 3300000597|AF_2010_repII_A1DRAFT_10017430 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1972 | Open in IMG/M |
| 3300000793|AF_2010_repII_A001DRAFT_10101569 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300000955|JGI1027J12803_105014791 | Not Available | 816 | Open in IMG/M |
| 3300000956|JGI10216J12902_101787763 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 933 | Open in IMG/M |
| 3300000956|JGI10216J12902_112557231 | Not Available | 756 | Open in IMG/M |
| 3300001431|F14TB_100798901 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 1168 | Open in IMG/M |
| 3300001431|F14TB_101159009 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 1262 | Open in IMG/M |
| 3300001661|JGI12053J15887_10021076 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium mesoamericanum | 3647 | Open in IMG/M |
| 3300001867|JGI12627J18819_10080940 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1348 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100945380 | Not Available | 745 | Open in IMG/M |
| 3300002906|JGI25614J43888_10000462 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 11242 | Open in IMG/M |
| 3300002906|JGI25614J43888_10005064 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4220 | Open in IMG/M |
| 3300002906|JGI25614J43888_10045984 | All Organisms → cellular organisms → Bacteria | 1339 | Open in IMG/M |
| 3300002910|JGI25615J43890_1024982 | Not Available | 986 | Open in IMG/M |
| 3300002911|JGI25390J43892_10016726 | All Organisms → cellular organisms → Bacteria | 1747 | Open in IMG/M |
| 3300004267|Ga0066396_10003666 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1559 | Open in IMG/M |
| 3300004268|Ga0066398_10031897 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 969 | Open in IMG/M |
| 3300004268|Ga0066398_10223958 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300004479|Ga0062595_100198205 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1239 | Open in IMG/M |
| 3300004633|Ga0066395_10010172 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3458 | Open in IMG/M |
| 3300004633|Ga0066395_10014668 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2990 | Open in IMG/M |
| 3300004633|Ga0066395_10017572 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2785 | Open in IMG/M |
| 3300004633|Ga0066395_10159030 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1152 | Open in IMG/M |
| 3300004633|Ga0066395_10204722 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1035 | Open in IMG/M |
| 3300004633|Ga0066395_10288339 | Not Available | 893 | Open in IMG/M |
| 3300004633|Ga0066395_10742373 | Not Available | 585 | Open in IMG/M |
| 3300005163|Ga0066823_10027737 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 921 | Open in IMG/M |
| 3300005165|Ga0066869_10008628 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1345 | Open in IMG/M |
| 3300005166|Ga0066674_10162705 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1056 | Open in IMG/M |
| 3300005166|Ga0066674_10195217 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 963 | Open in IMG/M |
| 3300005167|Ga0066672_10040731 | All Organisms → cellular organisms → Bacteria | 2610 | Open in IMG/M |
| 3300005172|Ga0066683_10695122 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 604 | Open in IMG/M |
| 3300005174|Ga0066680_10063005 | All Organisms → cellular organisms → Bacteria | 2206 | Open in IMG/M |
| 3300005174|Ga0066680_10099941 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1774 | Open in IMG/M |
| 3300005174|Ga0066680_10217286 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1210 | Open in IMG/M |
| 3300005175|Ga0066673_10043447 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2234 | Open in IMG/M |
| 3300005184|Ga0066671_10974623 | Not Available | 534 | Open in IMG/M |
| 3300005187|Ga0066675_10143857 | Not Available | 1629 | Open in IMG/M |
| 3300005332|Ga0066388_100129735 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3063 | Open in IMG/M |
| 3300005332|Ga0066388_100161520 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2831 | Open in IMG/M |
| 3300005332|Ga0066388_100170399 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2776 | Open in IMG/M |
| 3300005332|Ga0066388_100199493 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2620 | Open in IMG/M |
| 3300005332|Ga0066388_100220605 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2525 | Open in IMG/M |
| 3300005332|Ga0066388_100295090 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2265 | Open in IMG/M |
| 3300005332|Ga0066388_101449975 | All Organisms → Viruses → Predicted Viral | 1196 | Open in IMG/M |
| 3300005332|Ga0066388_101724738 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1109 | Open in IMG/M |
| 3300005332|Ga0066388_101728280 | Not Available | 1108 | Open in IMG/M |
| 3300005332|Ga0066388_101824149 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1082 | Open in IMG/M |
| 3300005332|Ga0066388_101850468 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Marinobacteraceae | 1075 | Open in IMG/M |
| 3300005332|Ga0066388_102108770 | All Organisms → cellular organisms → Bacteria | 1014 | Open in IMG/M |
| 3300005332|Ga0066388_102305065 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 974 | Open in IMG/M |
| 3300005332|Ga0066388_102483039 | Not Available | 942 | Open in IMG/M |
| 3300005332|Ga0066388_102928682 | Not Available | 872 | Open in IMG/M |
| 3300005332|Ga0066388_103394754 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 813 | Open in IMG/M |
| 3300005332|Ga0066388_103500564 | Not Available | 801 | Open in IMG/M |
| 3300005332|Ga0066388_103622831 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. CCGUVB1N3 | 788 | Open in IMG/M |
| 3300005332|Ga0066388_105123371 | Not Available | 665 | Open in IMG/M |
| 3300005332|Ga0066388_105229978 | Not Available | 658 | Open in IMG/M |
| 3300005332|Ga0066388_105439304 | Not Available | 645 | Open in IMG/M |
| 3300005332|Ga0066388_105793935 | Not Available | 625 | Open in IMG/M |
| 3300005332|Ga0066388_106181428 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 604 | Open in IMG/M |
| 3300005332|Ga0066388_106324837 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → unclassified Methylobacterium → Methylobacterium sp. 174MFSha1.1 | 597 | Open in IMG/M |
| 3300005332|Ga0066388_106859613 | Not Available | 573 | Open in IMG/M |
| 3300005332|Ga0066388_107267014 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 556 | Open in IMG/M |
| 3300005332|Ga0066388_107840692 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300005343|Ga0070687_101164059 | Not Available | 567 | Open in IMG/M |
| 3300005347|Ga0070668_101712554 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 577 | Open in IMG/M |
| 3300005363|Ga0008090_10092261 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1166 | Open in IMG/M |
| 3300005363|Ga0008090_10216809 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 948 | Open in IMG/M |
| 3300005363|Ga0008090_10253512 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1109 | Open in IMG/M |
| 3300005435|Ga0070714_100806206 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 909 | Open in IMG/M |
| 3300005436|Ga0070713_100007602 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 7623 | Open in IMG/M |
| 3300005436|Ga0070713_100577971 | All Organisms → cellular organisms → Bacteria | 1066 | Open in IMG/M |
| 3300005437|Ga0070710_11259846 | Not Available | 548 | Open in IMG/M |
| 3300005439|Ga0070711_101455707 | Not Available | 597 | Open in IMG/M |
| 3300005440|Ga0070705_100916958 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 706 | Open in IMG/M |
| 3300005445|Ga0070708_100290890 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1538 | Open in IMG/M |
| 3300005445|Ga0070708_100426210 | Not Available | 1251 | Open in IMG/M |
| 3300005445|Ga0070708_101504541 | Not Available | 627 | Open in IMG/M |
| 3300005446|Ga0066686_10031673 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3093 | Open in IMG/M |
| 3300005467|Ga0070706_100005710 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia | 11833 | Open in IMG/M |
| 3300005467|Ga0070706_101034697 | Not Available | 757 | Open in IMG/M |
| 3300005468|Ga0070707_100268429 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1659 | Open in IMG/M |
| 3300005471|Ga0070698_100203758 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1914 | Open in IMG/M |
| 3300005471|Ga0070698_100403031 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1301 | Open in IMG/M |
| 3300005471|Ga0070698_100672090 | All Organisms → cellular organisms → Bacteria | 977 | Open in IMG/M |
| 3300005518|Ga0070699_100004291 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 12600 | Open in IMG/M |
| 3300005518|Ga0070699_100108575 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2435 | Open in IMG/M |
| 3300005536|Ga0070697_100174296 | All Organisms → cellular organisms → Bacteria | 1821 | Open in IMG/M |
| 3300005536|Ga0070697_100835622 | Not Available | 816 | Open in IMG/M |
| 3300005552|Ga0066701_10633979 | Not Available | 648 | Open in IMG/M |
| 3300005553|Ga0066695_10036477 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2871 | Open in IMG/M |
| 3300005559|Ga0066700_10047185 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2628 | Open in IMG/M |
| 3300005575|Ga0066702_10961732 | Not Available | 510 | Open in IMG/M |
| 3300005615|Ga0070702_100283564 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1138 | Open in IMG/M |
| 3300005713|Ga0066905_100006852 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 5017 | Open in IMG/M |
| 3300005713|Ga0066905_100043424 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2687 | Open in IMG/M |
| 3300005713|Ga0066905_100168622 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1600 | Open in IMG/M |
| 3300005713|Ga0066905_100194041 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1511 | Open in IMG/M |
| 3300005713|Ga0066905_100363841 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1160 | Open in IMG/M |
| 3300005713|Ga0066905_100502411 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1008 | Open in IMG/M |
| 3300005713|Ga0066905_100513964 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 998 | Open in IMG/M |
| 3300005713|Ga0066905_100561139 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 960 | Open in IMG/M |
| 3300005713|Ga0066905_100690915 | Not Available | 874 | Open in IMG/M |
| 3300005713|Ga0066905_100840075 | Not Available | 799 | Open in IMG/M |
| 3300005713|Ga0066905_100983111 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 743 | Open in IMG/M |
| 3300005713|Ga0066905_101118341 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
| 3300005713|Ga0066905_101469081 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 619 | Open in IMG/M |
| 3300005713|Ga0066905_101987060 | Not Available | 539 | Open in IMG/M |
| 3300005713|Ga0066905_102273677 | Not Available | 506 | Open in IMG/M |
| 3300005719|Ga0068861_101275758 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 713 | Open in IMG/M |
| 3300005764|Ga0066903_100109691 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3777 | Open in IMG/M |
| 3300005764|Ga0066903_100125295 | All Organisms → cellular organisms → Bacteria | 3589 | Open in IMG/M |
| 3300005764|Ga0066903_100304100 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2527 | Open in IMG/M |
| 3300005764|Ga0066903_100381511 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2304 | Open in IMG/M |
| 3300005764|Ga0066903_100606323 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1899 | Open in IMG/M |
| 3300005764|Ga0066903_100887072 | All Organisms → cellular organisms → Bacteria | 1611 | Open in IMG/M |
| 3300005764|Ga0066903_101337311 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1341 | Open in IMG/M |
| 3300005764|Ga0066903_101565517 | Not Available | 1248 | Open in IMG/M |
| 3300005764|Ga0066903_101597485 | All Organisms → cellular organisms → Bacteria | 1236 | Open in IMG/M |
| 3300005764|Ga0066903_101597956 | Not Available | 1236 | Open in IMG/M |
| 3300005764|Ga0066903_101804682 | All Organisms → cellular organisms → Bacteria | 1168 | Open in IMG/M |
| 3300005764|Ga0066903_102762676 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 952 | Open in IMG/M |
| 3300005764|Ga0066903_103327601 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 868 | Open in IMG/M |
| 3300005764|Ga0066903_103573542 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 837 | Open in IMG/M |
| 3300005764|Ga0066903_103942665 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 796 | Open in IMG/M |
| 3300005764|Ga0066903_104584525 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 736 | Open in IMG/M |
| 3300005764|Ga0066903_104779140 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
| 3300005764|Ga0066903_106378978 | Not Available | 615 | Open in IMG/M |
| 3300005764|Ga0066903_106929079 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 588 | Open in IMG/M |
| 3300005764|Ga0066903_107230799 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 574 | Open in IMG/M |
| 3300005764|Ga0066903_108524215 | Not Available | 522 | Open in IMG/M |
| 3300005937|Ga0081455_10002386 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 22424 | Open in IMG/M |
| 3300005937|Ga0081455_10002661 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 21127 | Open in IMG/M |
| 3300005981|Ga0081538_10209753 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 787 | Open in IMG/M |
| 3300005983|Ga0081540_1026625 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3295 | Open in IMG/M |
| 3300006032|Ga0066696_10492297 | All Organisms → cellular organisms → Bacteria | 805 | Open in IMG/M |
| 3300006050|Ga0075028_100441529 | Not Available | 751 | Open in IMG/M |
| 3300006178|Ga0075367_10350171 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 932 | Open in IMG/M |
| 3300006178|Ga0075367_11044305 | Not Available | 522 | Open in IMG/M |
| 3300006606|Ga0074062_12127360 | Not Available | 589 | Open in IMG/M |
| 3300006796|Ga0066665_10276308 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1340 | Open in IMG/M |
| 3300006796|Ga0066665_10587144 | All Organisms → cellular organisms → Bacteria | 899 | Open in IMG/M |
| 3300006797|Ga0066659_10345620 | Not Available | 1152 | Open in IMG/M |
| 3300006797|Ga0066659_10831663 | Not Available | 767 | Open in IMG/M |
| 3300006844|Ga0075428_100038492 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 5263 | Open in IMG/M |
| 3300006844|Ga0075428_100339033 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1614 | Open in IMG/M |
| 3300006845|Ga0075421_100151455 | All Organisms → cellular organisms → Bacteria | 2897 | Open in IMG/M |
| 3300006845|Ga0075421_100439813 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 1560 | Open in IMG/M |
| 3300006852|Ga0075433_11954056 | Not Available | 503 | Open in IMG/M |
| 3300006854|Ga0075425_101157445 | Not Available | 880 | Open in IMG/M |
| 3300006871|Ga0075434_100777098 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 974 | Open in IMG/M |
| 3300006904|Ga0075424_100723700 | Not Available | 1062 | Open in IMG/M |
| 3300006904|Ga0075424_101072563 | Not Available | 859 | Open in IMG/M |
| 3300007255|Ga0099791_10232546 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 872 | Open in IMG/M |
| 3300007788|Ga0099795_10617511 | Not Available | 517 | Open in IMG/M |
| 3300007788|Ga0099795_10652432 | Not Available | 503 | Open in IMG/M |
| 3300009012|Ga0066710_101500856 | Not Available | 1040 | Open in IMG/M |
| 3300009038|Ga0099829_10648024 | Not Available | 878 | Open in IMG/M |
| 3300009089|Ga0099828_10028993 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Salinarimonadaceae → unclassified Salinarimonadaceae → Salinarimonadaceae bacterium HL-109 | 4435 | Open in IMG/M |
| 3300009090|Ga0099827_10080025 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2548 | Open in IMG/M |
| 3300009100|Ga0075418_10292769 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1735 | Open in IMG/M |
| 3300009137|Ga0066709_102338501 | Not Available | 730 | Open in IMG/M |
| 3300009147|Ga0114129_10173646 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2937 | Open in IMG/M |
| 3300009148|Ga0105243_12488628 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 557 | Open in IMG/M |
| 3300009162|Ga0075423_10738460 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1040 | Open in IMG/M |
| 3300009792|Ga0126374_11033614 | Not Available | 647 | Open in IMG/M |
| 3300010043|Ga0126380_12029165 | Not Available | 527 | Open in IMG/M |
| 3300010046|Ga0126384_10097736 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2158 | Open in IMG/M |
| 3300010046|Ga0126384_10141636 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1840 | Open in IMG/M |
| 3300010046|Ga0126384_11559759 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 620 | Open in IMG/M |
| 3300010047|Ga0126382_10014652 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3899 | Open in IMG/M |
| 3300010047|Ga0126382_10302754 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1201 | Open in IMG/M |
| 3300010047|Ga0126382_10527019 | All Organisms → cellular organisms → Bacteria | 956 | Open in IMG/M |
| 3300010358|Ga0126370_11004897 | Not Available | 762 | Open in IMG/M |
| 3300010359|Ga0126376_12349229 | Not Available | 579 | Open in IMG/M |
| 3300010361|Ga0126378_10218644 | Not Available | 1988 | Open in IMG/M |
| 3300010376|Ga0126381_100856675 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1307 | Open in IMG/M |
| 3300010398|Ga0126383_10257202 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1718 | Open in IMG/M |
| 3300010398|Ga0126383_11001087 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 924 | Open in IMG/M |
| 3300010398|Ga0126383_11686163 | Not Available | 723 | Open in IMG/M |
| 3300010398|Ga0126383_12031607 | Not Available | 662 | Open in IMG/M |
| 3300010863|Ga0124850_1018420 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2229 | Open in IMG/M |
| 3300011269|Ga0137392_10898911 | Not Available | 729 | Open in IMG/M |
| 3300011270|Ga0137391_10583634 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 939 | Open in IMG/M |
| 3300011271|Ga0137393_10754470 | Not Available | 833 | Open in IMG/M |
| 3300012198|Ga0137364_10976439 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 641 | Open in IMG/M |
| 3300012201|Ga0137365_10645789 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 775 | Open in IMG/M |
| 3300012202|Ga0137363_10126820 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1977 | Open in IMG/M |
| 3300012202|Ga0137363_10454046 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1073 | Open in IMG/M |
| 3300012202|Ga0137363_10753911 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 825 | Open in IMG/M |
| 3300012202|Ga0137363_10993906 | Not Available | 712 | Open in IMG/M |
| 3300012203|Ga0137399_10600351 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 925 | Open in IMG/M |
| 3300012205|Ga0137362_10492214 | Not Available | 1061 | Open in IMG/M |
| 3300012205|Ga0137362_11603710 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 538 | Open in IMG/M |
| 3300012206|Ga0137380_11348329 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 598 | Open in IMG/M |
| 3300012207|Ga0137381_10078224 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2773 | Open in IMG/M |
| 3300012208|Ga0137376_10074608 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2831 | Open in IMG/M |
| 3300012211|Ga0137377_10352355 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1409 | Open in IMG/M |
| 3300012211|Ga0137377_10410469 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1292 | Open in IMG/M |
| 3300012211|Ga0137377_10557582 | Not Available | 1083 | Open in IMG/M |
| 3300012357|Ga0137384_10605241 | Not Available | 894 | Open in IMG/M |
| 3300012358|Ga0137368_10302389 | All Organisms → cellular organisms → Bacteria | 1081 | Open in IMG/M |
| 3300012358|Ga0137368_10843087 | Not Available | 564 | Open in IMG/M |
| 3300012361|Ga0137360_10123075 | All Organisms → cellular organisms → Bacteria | 2020 | Open in IMG/M |
| 3300012362|Ga0137361_11027658 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 744 | Open in IMG/M |
| 3300012917|Ga0137395_10043761 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2781 | Open in IMG/M |
| 3300012922|Ga0137394_10610245 | All Organisms → cellular organisms → Bacteria | 922 | Open in IMG/M |
| 3300012944|Ga0137410_11397574 | Not Available | 608 | Open in IMG/M |
| 3300012948|Ga0126375_10086570 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1811 | Open in IMG/M |
| 3300012948|Ga0126375_11024911 | Not Available | 674 | Open in IMG/M |
| 3300012948|Ga0126375_11606633 | Not Available | 560 | Open in IMG/M |
| 3300012961|Ga0164302_10314339 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1030 | Open in IMG/M |
| 3300012971|Ga0126369_12210727 | Not Available | 637 | Open in IMG/M |
| 3300012977|Ga0134087_10442862 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 642 | Open in IMG/M |
| 3300012987|Ga0164307_11424633 | Not Available | 584 | Open in IMG/M |
| 3300012989|Ga0164305_10159231 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1542 | Open in IMG/M |
| 3300013297|Ga0157378_12235843 | Not Available | 598 | Open in IMG/M |
| 3300013297|Ga0157378_12866611 | Not Available | 534 | Open in IMG/M |
| 3300013306|Ga0163162_10484274 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1368 | Open in IMG/M |
| 3300015371|Ga0132258_10397500 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3423 | Open in IMG/M |
| 3300015373|Ga0132257_104470732 | Not Available | 509 | Open in IMG/M |
| 3300016270|Ga0182036_11106514 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. CCGUVB1N3 | 656 | Open in IMG/M |
| 3300016294|Ga0182041_10064202 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2551 | Open in IMG/M |
| 3300016319|Ga0182033_11371534 | Not Available | 636 | Open in IMG/M |
| 3300016387|Ga0182040_10245508 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1342 | Open in IMG/M |
| 3300016404|Ga0182037_10245010 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1415 | Open in IMG/M |
| 3300016445|Ga0182038_11675061 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 573 | Open in IMG/M |
| 3300018433|Ga0066667_10425600 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1079 | Open in IMG/M |
| 3300018433|Ga0066667_11403822 | Not Available | 613 | Open in IMG/M |
| 3300019890|Ga0193728_1280172 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 647 | Open in IMG/M |
| 3300020581|Ga0210399_10763201 | Not Available | 792 | Open in IMG/M |
| 3300021168|Ga0210406_10059618 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3313 | Open in IMG/M |
| 3300021168|Ga0210406_10267241 | All Organisms → cellular organisms → Bacteria | 1399 | Open in IMG/M |
| 3300021178|Ga0210408_10019366 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5450 | Open in IMG/M |
| 3300021405|Ga0210387_10323865 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1358 | Open in IMG/M |
| 3300021439|Ga0213879_10004814 | All Organisms → cellular organisms → Bacteria | 2616 | Open in IMG/M |
| 3300021560|Ga0126371_10080648 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3192 | Open in IMG/M |
| 3300021560|Ga0126371_10093255 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2983 | Open in IMG/M |
| 3300021560|Ga0126371_10099714 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2891 | Open in IMG/M |
| 3300021560|Ga0126371_10184946 | All Organisms → cellular organisms → Bacteria | 2170 | Open in IMG/M |
| 3300021560|Ga0126371_10360422 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1590 | Open in IMG/M |
| 3300021560|Ga0126371_11924765 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 710 | Open in IMG/M |
| 3300021560|Ga0126371_13329925 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 543 | Open in IMG/M |
| 3300024288|Ga0179589_10538125 | Not Available | 544 | Open in IMG/M |
| 3300024330|Ga0137417_1361559 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2170 | Open in IMG/M |
| 3300025898|Ga0207692_10484575 | Not Available | 783 | Open in IMG/M |
| 3300025910|Ga0207684_10037927 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 4089 | Open in IMG/M |
| 3300025910|Ga0207684_10131003 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium RIFCSPLOWO2_02_FULL_68_19 | 2152 | Open in IMG/M |
| 3300025922|Ga0207646_10199712 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1806 | Open in IMG/M |
| 3300025922|Ga0207646_10206236 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 1775 | Open in IMG/M |
| 3300025929|Ga0207664_10648019 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 949 | Open in IMG/M |
| 3300026285|Ga0209438_1155477 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 601 | Open in IMG/M |
| 3300026304|Ga0209240_1000843 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 12477 | Open in IMG/M |
| 3300026304|Ga0209240_1001523 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 9020 | Open in IMG/M |
| 3300026304|Ga0209240_1001876 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 8088 | Open in IMG/M |
| 3300026304|Ga0209240_1274369 | Not Available | 519 | Open in IMG/M |
| 3300026310|Ga0209239_1006937 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 6258 | Open in IMG/M |
| 3300026310|Ga0209239_1012050 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 4543 | Open in IMG/M |
| 3300026310|Ga0209239_1013028 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 4343 | Open in IMG/M |
| 3300026326|Ga0209801_1136895 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1041 | Open in IMG/M |
| 3300026334|Ga0209377_1320644 | Not Available | 518 | Open in IMG/M |
| 3300026343|Ga0209159_1243621 | Not Available | 548 | Open in IMG/M |
| 3300026374|Ga0257146_1089107 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 505 | Open in IMG/M |
| 3300026536|Ga0209058_1016255 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 5046 | Open in IMG/M |
| 3300026547|Ga0209156_10443852 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 537 | Open in IMG/M |
| 3300027288|Ga0208525_1039773 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 583 | Open in IMG/M |
| 3300027873|Ga0209814_10243644 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
| 3300027874|Ga0209465_10005239 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 5652 | Open in IMG/M |
| 3300027874|Ga0209465_10006139 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 5260 | Open in IMG/M |
| 3300027874|Ga0209465_10201654 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. CCGUVB1N3 | 993 | Open in IMG/M |
| 3300027882|Ga0209590_10613325 | Not Available | 700 | Open in IMG/M |
| 3300027909|Ga0209382_10043255 | All Organisms → cellular organisms → Bacteria | 5393 | Open in IMG/M |
| 3300027909|Ga0209382_12248621 | Not Available | 514 | Open in IMG/M |
| 3300028811|Ga0307292_10466222 | Not Available | 540 | Open in IMG/M |
| 3300028878|Ga0307278_10013493 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 3807 | Open in IMG/M |
| 3300028878|Ga0307278_10026798 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2646 | Open in IMG/M |
| 3300028878|Ga0307278_10406054 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300028884|Ga0307308_10361004 | Not Available | 696 | Open in IMG/M |
| 3300031543|Ga0318516_10003630 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 6686 | Open in IMG/M |
| 3300031543|Ga0318516_10058818 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2109 | Open in IMG/M |
| 3300031543|Ga0318516_10091466 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1709 | Open in IMG/M |
| 3300031543|Ga0318516_10109678 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 1565 | Open in IMG/M |
| 3300031543|Ga0318516_10539120 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 668 | Open in IMG/M |
| 3300031544|Ga0318534_10584301 | Not Available | 635 | Open in IMG/M |
| 3300031544|Ga0318534_10832542 | Not Available | 518 | Open in IMG/M |
| 3300031545|Ga0318541_10009011 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 4409 | Open in IMG/M |
| 3300031545|Ga0318541_10093685 | All Organisms → cellular organisms → Bacteria | 1604 | Open in IMG/M |
| 3300031545|Ga0318541_10445077 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. CCGUVB1N3 | 724 | Open in IMG/M |
| 3300031549|Ga0318571_10394296 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 539 | Open in IMG/M |
| 3300031561|Ga0318528_10026465 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 2821 | Open in IMG/M |
| 3300031573|Ga0310915_10029570 | Not Available | 3409 | Open in IMG/M |
| 3300031573|Ga0310915_10055382 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2573 | Open in IMG/M |
| 3300031573|Ga0310915_10149516 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. CCGUVB1N3 | 1614 | Open in IMG/M |
| 3300031573|Ga0310915_10938703 | Not Available | 605 | Open in IMG/M |
| 3300031640|Ga0318555_10038547 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2370 | Open in IMG/M |
| 3300031640|Ga0318555_10329403 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 827 | Open in IMG/M |
| 3300031640|Ga0318555_10622030 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 585 | Open in IMG/M |
| 3300031668|Ga0318542_10009434 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3635 | Open in IMG/M |
| 3300031668|Ga0318542_10560566 | Not Available | 595 | Open in IMG/M |
| 3300031680|Ga0318574_10721273 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 584 | Open in IMG/M |
| 3300031682|Ga0318560_10112040 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1420 | Open in IMG/M |
| 3300031682|Ga0318560_10752030 | Not Available | 526 | Open in IMG/M |
| 3300031719|Ga0306917_10032954 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3347 | Open in IMG/M |
| 3300031719|Ga0306917_10660234 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 822 | Open in IMG/M |
| 3300031719|Ga0306917_10911722 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 687 | Open in IMG/M |
| 3300031720|Ga0307469_10274562 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1373 | Open in IMG/M |
| 3300031724|Ga0318500_10293936 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 795 | Open in IMG/M |
| 3300031724|Ga0318500_10298899 | Not Available | 788 | Open in IMG/M |
| 3300031724|Ga0318500_10462208 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300031744|Ga0306918_10068201 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 2430 | Open in IMG/M |
| 3300031744|Ga0306918_10155259 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1694 | Open in IMG/M |
| 3300031747|Ga0318502_10001580 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 8440 | Open in IMG/M |
| 3300031768|Ga0318509_10759704 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 537 | Open in IMG/M |
| 3300031770|Ga0318521_10004028 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 5561 | Open in IMG/M |
| 3300031771|Ga0318546_10455991 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. CCGUVB1N3 | 895 | Open in IMG/M |
| 3300031771|Ga0318546_10527058 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 830 | Open in IMG/M |
| 3300031780|Ga0318508_1020374 | All Organisms → cellular organisms → Bacteria | 1606 | Open in IMG/M |
| 3300031780|Ga0318508_1169945 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300031781|Ga0318547_10280113 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1010 | Open in IMG/M |
| 3300031782|Ga0318552_10301198 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 815 | Open in IMG/M |
| 3300031794|Ga0318503_10000555 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 6782 | Open in IMG/M |
| 3300031805|Ga0318497_10009802 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4372 | Open in IMG/M |
| 3300031805|Ga0318497_10722429 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 558 | Open in IMG/M |
| 3300031821|Ga0318567_10047483 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. CCGUVB1N3 | 2208 | Open in IMG/M |
| 3300031821|Ga0318567_10400041 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
| 3300031821|Ga0318567_10400410 | Not Available | 778 | Open in IMG/M |
| 3300031833|Ga0310917_10004196 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 7334 | Open in IMG/M |
| 3300031833|Ga0310917_10021893 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3681 | Open in IMG/M |
| 3300031833|Ga0310917_10233825 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1235 | Open in IMG/M |
| 3300031833|Ga0310917_10481686 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 844 | Open in IMG/M |
| 3300031845|Ga0318511_10067847 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. CCGUVB1N3 | 1467 | Open in IMG/M |
| 3300031859|Ga0318527_10006868 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3564 | Open in IMG/M |
| 3300031879|Ga0306919_10093379 | Not Available | 2101 | Open in IMG/M |
| 3300031890|Ga0306925_10014211 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 7775 | Open in IMG/M |
| 3300031896|Ga0318551_10006232 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4853 | Open in IMG/M |
| 3300031910|Ga0306923_10075524 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3769 | Open in IMG/M |
| 3300031912|Ga0306921_10084537 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3657 | Open in IMG/M |
| 3300031912|Ga0306921_10434312 | Not Available | 1531 | Open in IMG/M |
| 3300031942|Ga0310916_10345616 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1263 | Open in IMG/M |
| 3300031945|Ga0310913_11286443 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 507 | Open in IMG/M |
| 3300031954|Ga0306926_10200713 | Not Available | 2475 | Open in IMG/M |
| 3300031954|Ga0306926_12548412 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 559 | Open in IMG/M |
| 3300031959|Ga0318530_10006837 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3495 | Open in IMG/M |
| 3300031981|Ga0318531_10277570 | Not Available | 757 | Open in IMG/M |
| 3300031981|Ga0318531_10557976 | Not Available | 519 | Open in IMG/M |
| 3300032025|Ga0318507_10033355 | All Organisms → cellular organisms → Bacteria | 1938 | Open in IMG/M |
| 3300032035|Ga0310911_10101849 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1576 | Open in IMG/M |
| 3300032035|Ga0310911_10260655 | Not Available | 993 | Open in IMG/M |
| 3300032041|Ga0318549_10332111 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 685 | Open in IMG/M |
| 3300032051|Ga0318532_10250132 | Not Available | 629 | Open in IMG/M |
| 3300032055|Ga0318575_10364928 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. CCGUVB1N3 | 732 | Open in IMG/M |
| 3300032065|Ga0318513_10100040 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. CCGUVB1N3 | 1355 | Open in IMG/M |
| 3300032066|Ga0318514_10512172 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 638 | Open in IMG/M |
| 3300032094|Ga0318540_10464252 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 612 | Open in IMG/M |
| 3300032261|Ga0306920_103154165 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 618 | Open in IMG/M |
| 3300033289|Ga0310914_10711811 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 900 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 20.87% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 19.24% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 9.49% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 9.49% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 7.32% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.15% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.61% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.06% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.44% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.08% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.08% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.81% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.81% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.81% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.81% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.54% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.54% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.54% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.54% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.27% |
| Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 0.27% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.27% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.27% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.27% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.27% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.27% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.27% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.27% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.27% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.27% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.27% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2088090014 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 2170459004 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect MP BIO 1O1 lysis 0-21cm (2) | Environmental | Open in IMG/M |
| 2228664022 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
| 3300000579 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A01 | Environmental | Open in IMG/M |
| 3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
| 3300000793 | Forest soil microbial communities from Amazon forest - 2010 replicate II A001 | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002906 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm | Environmental | Open in IMG/M |
| 3300002910 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm | Environmental | Open in IMG/M |
| 3300002911 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm | Environmental | Open in IMG/M |
| 3300004267 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBio | Environmental | Open in IMG/M |
| 3300004268 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005163 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMB | Environmental | Open in IMG/M |
| 3300005165 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMC | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Host-Associated | Open in IMG/M |
| 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006178 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Host-Associated | Open in IMG/M |
| 3300006606 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010863 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (PacBio error correction) | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021439 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R03 | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026285 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
| 3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
| 3300026343 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes) | Environmental | Open in IMG/M |
| 3300026374 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-A | Environmental | Open in IMG/M |
| 3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300027288 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMC (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031780 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031794 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032051 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPIPI_03489480 | 2088090014 | Soil | MVQTWKRIMKALIAAIALATLIAVPTFAQPANAAPVSPASSSFGSNGY |
| GPIPI_01024180 | 2088090014 | Soil | MKALIAAIALATLIAVPTFAQPANAAPVSPASSSFGSNGY |
| GPIPI_00398950 | 2088090014 | Soil | MKNIIAALALAALISIPTFNAAANAAPVSPASSSFGSNGY |
| E4B_05697760 | 2170459004 | Grass Soil | MKALIAALALVTLIAVPTFAPPANAAPMSPASSSFGSNGY |
| INPgaii200_10151162 | 2228664022 | Soil | MKSLIAALALAALIAVPTFAPSANAAPVSPSSSAFGGNGY |
| INPgaii200_11065363 | 2228664022 | Soil | MKALIVALALATLIAIPTFAPSASAAPMSAASSSFGSNGY |
| INPgaii200_11900104 | 2228664022 | Soil | MKTLIAALALAIFLALPLLAQPVSAAPMSPSSSSFGSNGY |
| ICChiseqgaiiDRAFT_22111442 | 3300000033 | Soil | MKNIIAALALAALISIPTFNAAANAAPVSPASSSFGSNGY* |
| INPhiseqgaiiFebDRAFT_1012246001 | 3300000364 | Soil | MKRLTAVLTLIPLIAVPMFAQSASAAPVSPASSSIGSNGY* |
| F24TB_148851372 | 3300000550 | Soil | MKMLIAALALAALIAVPTFTAPVQAAPMSPASSSFGSNGY* |
| AP72_2010_repI_A01DRAFT_10467273 | 3300000579 | Forest Soil | MKMLIAALAFAALIAVPTLTTPVQAAPMSPASSSFGSN |
| AF_2010_repII_A1DRAFT_100174303 | 3300000597 | Forest Soil | MKSLIAALALVALIAVPTLTTPVQAAPVSPASSSFGSNGY* |
| AF_2010_repII_A001DRAFT_101015692 | 3300000793 | Forest Soil | MKSLIAALALIALIAVPTLTTPVQAAPVSPASSSFGSNGLIE |
| JGI1027J12803_1050147912 | 3300000955 | Soil | MKALIVALALAALIAIPTFAPSATAAPISPSSSSFGSNGY* |
| JGI10216J12902_1017877632 | 3300000956 | Soil | MKTLIAALALAALIAIPTLTQSANAAPMSPANSSFGSNGY* |
| JGI10216J12902_1125572311 | 3300000956 | Soil | VMKALIAALALAALIAVPTFAPSATAAPMSPSSSSFGSNGY* |
| F14TB_1007989011 | 3300001431 | Soil | MKVLIAALALAALIAGPTLAPSANAAPMSPANSSFGSNGY* |
| F14TB_1011590093 | 3300001431 | Soil | MKVLIAALALAALIAGPTFAPPANAAPTSPASSSFGSNGY* |
| JGI12053J15887_100210761 | 3300001661 | Forest Soil | MKKFIATLALVTLIAVPTLTLPASAANVSPSSSSFGDNGY* |
| JGI12627J18819_100809401 | 3300001867 | Forest Soil | MKKIIAALALAALISIPTFNAAANAAPVSPSSSSFGSNGY* |
| JGIcombinedJ26739_1009453802 | 3300002245 | Forest Soil | MKALIAALALATLIAIPMLAQPASAAPMSPASSSFGSNGY* |
| JGI25614J43888_1000046211 | 3300002906 | Grasslands Soil | MKALITALALATLLAVPILVQPAGAAPMSPASSSFGSNGY* |
| JGI25614J43888_100050643 | 3300002906 | Grasslands Soil | MKALIAALALVTLIAVPTFAPPANAAPMSPASSSFGSNGY* |
| JGI25614J43888_100459842 | 3300002906 | Grasslands Soil | MKALVAALALATLIAIPTFTQPASAAPMSPASSSFGSNGY* |
| JGI25615J43890_10249822 | 3300002910 | Grasslands Soil | MKTLIAALALAMLIAIPTFAPVANAAPMSPASSSFGGNGY* |
| JGI25390J43892_100167261 | 3300002911 | Grasslands Soil | MKTLIAALALATLIAVPTFTQPANAAPMSPASSSFGSNGY* |
| Ga0066396_100036662 | 3300004267 | Tropical Forest Soil | MKMLFAALALAALIVVPTLTSPANAAPMSPASSSFGSNGY* |
| Ga0066398_100318972 | 3300004268 | Tropical Forest Soil | MKALIAALALATVIAAPIFAQPANAAPVSPASSSFGSNGY* |
| Ga0066398_102239583 | 3300004268 | Tropical Forest Soil | MKTLIAALALATLIAAPTFAHPANAAPMSPASSSFGSNGY* |
| Ga0062595_1001982052 | 3300004479 | Soil | MKALIAALALATWIVMPTFASSASAAPVSPASSSFGSNG* |
| Ga0066395_100101724 | 3300004633 | Tropical Forest Soil | MKMLFAALALAALIALPTFTPPANAAPVSPASSSFGSNGY* |
| Ga0066395_100146685 | 3300004633 | Tropical Forest Soil | MKALITALALATLVAVPILAQPASAAPVSPASSSFGSNGY* |
| Ga0066395_100175722 | 3300004633 | Tropical Forest Soil | MKALIAAFALATLIAVPTFAQLANAAPVSPASSSFGSNGY* |
| Ga0066395_101590302 | 3300004633 | Tropical Forest Soil | MKSLIAALALAALIAVPTFTQPVNAAPVSPASSSFGSNGY* |
| Ga0066395_102047222 | 3300004633 | Tropical Forest Soil | MKTLIAALALATLIAIPTFAPPANAAPMSPASSSFGSNGY* |
| Ga0066395_102883392 | 3300004633 | Tropical Forest Soil | MKALIAALALATLIAAPTFARPANAAPVSPASSSFGSNGY* |
| Ga0066395_107423731 | 3300004633 | Tropical Forest Soil | MKALIAALALVTLIAAPTFAQPANAAPMSPASSSFGSNGY* |
| Ga0066823_100277373 | 3300005163 | Soil | MKALIAALALATLIAAPTFAHPANSAPMSPASSSFGSNGY* |
| Ga0066869_100086281 | 3300005165 | Soil | MKALIAALALATLIAAPTFAHPANAAPMSPASSSFGSNGY* |
| Ga0066674_101627051 | 3300005166 | Soil | KALIAALALVTLIAVPTFAPPANAAPMSPASSSFGSNGY* |
| Ga0066674_101952173 | 3300005166 | Soil | MKTLIAALALATLVADPILVQPASAAPMSPASSSFGSNGY* |
| Ga0066672_100407313 | 3300005167 | Soil | MKALVAALALATLIAMPTFTQSASAAPMSPASSSFGSNGY* |
| Ga0066683_106951221 | 3300005172 | Soil | MKTLIAALALAMLIAVPTFAPSANAAPMSPASSSFGGNGY* |
| Ga0066680_100630052 | 3300005174 | Soil | MKALVAALALATLIAIPTFTQSASAAPMSPASSSFGSNGY* |
| Ga0066680_100999411 | 3300005174 | Soil | MKALIAALALVTLIAVPTFAPSANAAPMSPASSSFGSNGY* |
| Ga0066680_102172861 | 3300005174 | Soil | MKTLIAALALATLVAVPILVQPASAAPMSPASSSFGSNGY* |
| Ga0066673_100434473 | 3300005175 | Soil | MKMFIAALALAALIAIPTSAPANAAPVSPASSSFGSNGY* |
| Ga0066671_109746231 | 3300005184 | Soil | MKALITALALATLVAVPILVQPASAAPMSPASSSFGSNGY |
| Ga0066675_101438572 | 3300005187 | Soil | MKRLIAILAFATLIAVPTFAQSANAAPVSPASSSFGGNGY* |
| Ga0066388_1001297355 | 3300005332 | Tropical Forest Soil | MKTFIVALALAFLIAVPTFTPSANAAPMSPSSSSFGSNGY* |
| Ga0066388_1001615201 | 3300005332 | Tropical Forest Soil | MKALVAALALAALIAVPTFAQPANAAPVSPSSSSFGSNGY* |
| Ga0066388_1001703992 | 3300005332 | Tropical Forest Soil | MKMLFAALTLAALIAVPTLTSPANAAPMSPASSSFGSNGY* |
| Ga0066388_1001994931 | 3300005332 | Tropical Forest Soil | MKKLIAALALMALIAVPTFTTSASAQVSPASSSFGSNGY* |
| Ga0066388_1002206052 | 3300005332 | Tropical Forest Soil | MKALIAGLALATLIAVPTFAQPANAAPMSPASSSFGSNGY* |
| Ga0066388_1002950904 | 3300005332 | Tropical Forest Soil | MKALITALALATLVAAPILAQSAGAAPVSPASSSFGSNGY* |
| Ga0066388_1014499755 | 3300005332 | Tropical Forest Soil | RIMKALIAALALATVIAASIFAQPANAAPVSPANSSFGSNGY* |
| Ga0066388_1017247381 | 3300005332 | Tropical Forest Soil | WRRIMKALIAALALAILIAAPTFAPPANAAPMSPASSSFGSNGY* |
| Ga0066388_1017282803 | 3300005332 | Tropical Forest Soil | MKALIASLALATLIAAPTFAQPANAAPMSPASSSFGSNGY* |
| Ga0066388_1018241493 | 3300005332 | Tropical Forest Soil | MKALIAALALATLIAVPTFAPPANAAPVSPASSSFGSNGY* |
| Ga0066388_1018504682 | 3300005332 | Tropical Forest Soil | MKALIAALALATLIAVPTFAPPAHAAPMSPSSSSFGSNGY* |
| Ga0066388_1021087701 | 3300005332 | Tropical Forest Soil | MKMLIATLALAALIAVPTFTTPVQAAPMSPASSSFGSNGY* |
| Ga0066388_1023050652 | 3300005332 | Tropical Forest Soil | MKMFIAALALATLIAIPTSAPANAAPVSPASSSFGSNGY* |
| Ga0066388_1024830393 | 3300005332 | Tropical Forest Soil | MKALIAALALAALIAAPTFAHPVNAAPMSPASSSFGSNGY* |
| Ga0066388_1029286821 | 3300005332 | Tropical Forest Soil | MKALIVALALATLIAAPTFARPANSAPVSPASSSFGSNGY* |
| Ga0066388_1033947541 | 3300005332 | Tropical Forest Soil | MKMLIAALALAALIAVPTFTTPVQAAPMSPASSSFGSNGY* |
| Ga0066388_1035005642 | 3300005332 | Tropical Forest Soil | MKALIAALALTTLIAVSTFAPTANAAPMSPGSSSFGSNGY* |
| Ga0066388_1036228311 | 3300005332 | Tropical Forest Soil | MKSLIAALALATLIAAPTFAQPANAAPMSPASSSFGSNGY* |
| Ga0066388_1051233711 | 3300005332 | Tropical Forest Soil | MKALIAALALATLIAVPTFAQLANAAPVSPASSSFGSNGY* |
| Ga0066388_1052299782 | 3300005332 | Tropical Forest Soil | MKALIAAFVLATLVAMPTFATTANAAPVSPSNSSFGSNGY* |
| Ga0066388_1054393041 | 3300005332 | Tropical Forest Soil | MKALIAALALATLIAAPTFAHPANAAPVSPASSSFGSNGY* |
| Ga0066388_1057939351 | 3300005332 | Tropical Forest Soil | MKALIAALALATLIAVPTFAHPVNAAPVSPASSAFGGNGY* |
| Ga0066388_1061814281 | 3300005332 | Tropical Forest Soil | MKALIAALALATLIAIPTLTPSANAAPMSPASSSFGSNGY* |
| Ga0066388_1063248371 | 3300005332 | Tropical Forest Soil | MKALIAALALATLLAAPTLARPANAAPVSPASSSFGSNGY* |
| Ga0066388_1068596131 | 3300005332 | Tropical Forest Soil | MKMFFAALALAALIAAPTLTQSVQAAPMSPASSSFGSNGY* |
| Ga0066388_1072670141 | 3300005332 | Tropical Forest Soil | TTVQIWRPTMKTLIVALALAMLIAVPTSAANAAPVSPASSSFGGNGY* |
| Ga0066388_1078406922 | 3300005332 | Tropical Forest Soil | MKSLIAALALVALIAIPTLTTSVQAAPVSPASSSFGSNGY* |
| Ga0070687_1011640591 | 3300005343 | Switchgrass Rhizosphere | MKALIAAIALATLIAVPTFAQPANAAPVSPASSSFGSNGY* |
| Ga0070668_1017125541 | 3300005347 | Switchgrass Rhizosphere | MKKIIAALALAALISIPTFNAAAYAAPVSPASSSFGSNGY* |
| Ga0008090_100922612 | 3300005363 | Tropical Rainforest Soil | MKTLIAALALAMLIAVPTFTQSANAAPTSPASSSFGSNGY* |
| Ga0008090_102168093 | 3300005363 | Tropical Rainforest Soil | MKALIAALALATLIAVPTFAPSANAAPVSPASSSFGSNGY* |
| Ga0008090_102535122 | 3300005363 | Tropical Rainforest Soil | MKSLIAAFALLALIAVPTLTTPVQAAPVSPASSSFGSNGY* |
| Ga0070714_1008062062 | 3300005435 | Agricultural Soil | MKKIIAALALAALISIPTFNAAANAAPVSPASSSFGSNGY* |
| Ga0070713_1000076025 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MKALIAALALATLIAMPTLAPSASAAPMSPASSSFGSNGY* |
| Ga0070713_1005779713 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | SVMKKLIAALALFALIAVPTFATSASAQVSPASSSFGSNGY* |
| Ga0070710_112598461 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MKALIAALALATLIAIPTFAPSASAAPMSPASSSFGSNGY* |
| Ga0070711_1014557073 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MKKLIAALALFALIAVPTFATSASAQVSPASSSFGSNGY* |
| Ga0070705_1009169582 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MKNIIAALVLAALISIPTFNAAANAAPVSPASSSFGSNGY* |
| Ga0070708_1002908904 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MKALITALALAALLAVPILVQPAGAAPMSPASSSFGSNGY* |
| Ga0070708_1004262103 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MKVLIAAFALATLIAIPTFAQLANAAPVSPASSSFGSNGY* |
| Ga0070708_1015045412 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MKALIAALALAALIAIPTFATSATAAPMSPSSSSFGSNGY* |
| Ga0066686_100316736 | 3300005446 | Soil | MKTLMAALALATLVADPILVQPASAAPMSPASSSFGSNGY* |
| Ga0070706_1000057102 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MKVLFAALALAALISVPTFTPPANAAPMSPASSSFGSNGY* |
| Ga0070706_1010346972 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MKTLIAALALATLIAVPTFTPANAAPMSPASSSFGSNGY* |
| Ga0070707_1002684292 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MNALIAALALATLIAVPTFTQPANAAPVSPASSSFGSNGY* |
| Ga0070698_1002037583 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MKSLIAALALAALIAVPTFAPSANAAPVSPSSSAFGGNGY* |
| Ga0070698_1004030312 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MKALIAALALAALIAIPTFAPSATAAPMSPSSSSFGSNGY* |
| Ga0070698_1006720901 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MVQIWRPTMKTLIAALALAMLIGATTSAANAAPVSPASSSFGGNGY* |
| Ga0070699_1000042917 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MKVLFAALALAALIAVPTFTPPANAAPVSPASSSFGSNGY* |
| Ga0070699_1001085751 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MKALITALALATLIAVPTFTQPANAAPVSPASSSFGSNGY* |
| Ga0070697_1001742962 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MKALVAALALATLIAMPAFTQSANAAPMSPSSSSFGSNGY* |
| Ga0070697_1008356221 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MKTLIAALALVTLIAVPTFAPPANAAPMSPASSSFGSNGY* |
| Ga0066701_106339792 | 3300005552 | Soil | MKALVAALALATLIAMPTFTQSANAAPMSPSSSSFGSNGY* |
| Ga0066695_100364772 | 3300005553 | Soil | MKALIAALALAALLAVPTFAPPANAAPMSPGSSSFGSNGY* |
| Ga0066700_100471851 | 3300005559 | Soil | MKTLIAALALATLVAVPILVQPASAAPMSPASSSFGS |
| Ga0066702_109617322 | 3300005575 | Soil | MKTLIAALALAMLIAVPAFAPSANAAPMSPASSSFGGNGY* |
| Ga0070702_1002835643 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | RCVMKNIIAALVLAALISIPTFNAAANAAPVSPASSSFGSNGY* |
| Ga0066905_1000068528 | 3300005713 | Tropical Forest Soil | MKALIAALALAVLIAVPTFAQFANAAPMSPASSSFGSNGY* |
| Ga0066905_1000434243 | 3300005713 | Tropical Forest Soil | MKALIAALALATVIAASIFAQPANAAPVSPANSSFGSNGY* |
| Ga0066905_1001686222 | 3300005713 | Tropical Forest Soil | MKTFIAALALAMLIAVTTSAANAAPVSPASSSFGGNGY* |
| Ga0066905_1001940413 | 3300005713 | Tropical Forest Soil | MKTLIAALALAMLIALPTSAANAAPVSPASSSFGGNGY* |
| Ga0066905_1003638414 | 3300005713 | Tropical Forest Soil | MKALVAALALATLIAAPTFAHPANAAPMSPASSSFGSNGY* |
| Ga0066905_1005024111 | 3300005713 | Tropical Forest Soil | MKALIAALAFATLIVAPTFARPANAAPVSPASSSFGSNGY* |
| Ga0066905_1005139643 | 3300005713 | Tropical Forest Soil | MKPLIAALALVTLIAVPTFAQPASAAPASPASSSFGSNGY* |
| Ga0066905_1005611392 | 3300005713 | Tropical Forest Soil | MKTLIAALALAVLIAVPTFTQGANAAPTSPASSSFGSNGY* |
| Ga0066905_1006909152 | 3300005713 | Tropical Forest Soil | MKALIAALALATLIAAPTFAQPANAAPMSPASSSFGSNGY* |
| Ga0066905_1008400752 | 3300005713 | Tropical Forest Soil | MKAFIAALALATLIAIPTLTPSANAAPMSPASSSFGSNGY* |
| Ga0066905_1009831112 | 3300005713 | Tropical Forest Soil | YKRRCVMKKIIAALALAALISIPTFNAAANAAPVSPASSSFGSNGY* |
| Ga0066905_1011183411 | 3300005713 | Tropical Forest Soil | RDVMKMLFAALALAALIALPTFTPPANAAPVSPASSSFGSNGY* |
| Ga0066905_1014690812 | 3300005713 | Tropical Forest Soil | LIAALALATLIAAPTFAQPANAAPMSPASSSFGSNGY* |
| Ga0066905_1019870602 | 3300005713 | Tropical Forest Soil | MKTLMAALVLASLIAVPILAQPADAAPMSPASSSFGSNGY* |
| Ga0066905_1022736772 | 3300005713 | Tropical Forest Soil | MKMLIAALAFAALIAVPTLTTPVQAAPMSPASSSFGSNGYNRANLRSAT |
| Ga0068861_1012757581 | 3300005719 | Switchgrass Rhizosphere | NIIAALALAALISIPTFNAAANAAPVSPASSSFGSNGY* |
| Ga0066903_1001096915 | 3300005764 | Tropical Forest Soil | MKALIAALALATLIAVPTFAPPANAAPMSPASSSFGSNGY* |
| Ga0066903_1001252955 | 3300005764 | Tropical Forest Soil | MKALIAALALATLIAIPTFAPPANAAPMSPASSSFGSNGY* |
| Ga0066903_1003041002 | 3300005764 | Tropical Forest Soil | MKKLIAALALMALIAVPTFATSASAQVSPASPSFGSNGY* |
| Ga0066903_1003815114 | 3300005764 | Tropical Forest Soil | MKMLIAALALVALIAVPTLTTPVQAAPMSPASSSFGSNGY* |
| Ga0066903_1006063233 | 3300005764 | Tropical Forest Soil | MKTLIAALALAVLIAVPTFTPSANAAPMSPASGSFGSNGY* |
| Ga0066903_1008870722 | 3300005764 | Tropical Forest Soil | MKALIAALALATLIAMPMLASSATAAPVSPASSSFGSNDTDIF* |
| Ga0066903_1013373113 | 3300005764 | Tropical Forest Soil | MKALIAALALATLIAVPAFAPPVNAAPMSPASSSFGSNGY* |
| Ga0066903_1015655172 | 3300005764 | Tropical Forest Soil | MKALITALALAALIAVPTFAQPANAALVSPSSSEFGTNGY* |
| Ga0066903_1015974853 | 3300005764 | Tropical Forest Soil | MKALIAALALAILIAMPTFASSTSAAPLSPISSSFGSNGY* |
| Ga0066903_1015979563 | 3300005764 | Tropical Forest Soil | MKGLVAALALAALIAVPTFAPPANAAPVSPASSSFGSNGY* |
| Ga0066903_1018046823 | 3300005764 | Tropical Forest Soil | MKMLFAALALAALIAIPTLTTPVQAAPMSPASSSFGSNGY* |
| Ga0066903_1027626762 | 3300005764 | Tropical Forest Soil | MKKLIAALALMALIAVPTFATSASAQISPASPSFGSNGY* |
| Ga0066903_1033276012 | 3300005764 | Tropical Forest Soil | MKTLIAALALALLIAVPTFTAPANAQVSPSSSSFGSNGY* |
| Ga0066903_1035735422 | 3300005764 | Tropical Forest Soil | MKALIAAVALATLIAAPTFARPANAAPVSPASSSFGSNGY* |
| Ga0066903_1039426651 | 3300005764 | Tropical Forest Soil | MKALIAALALATLIAAPTFAQPANAAPMSPASSSFGSN |
| Ga0066903_1045845253 | 3300005764 | Tropical Forest Soil | MKSLIAALALIALIAVPTLTTPVQAAPVSPASSSFGSNGY* |
| Ga0066903_1047791402 | 3300005764 | Tropical Forest Soil | MKMLFAALALAALIALPTFTPTANAAPVSPASSSFGSNGY* |
| Ga0066903_1063789782 | 3300005764 | Tropical Forest Soil | MKALIAALALATLIAVPTFAQPANAAPMSPASSSFGSNGY* |
| Ga0066903_1069290791 | 3300005764 | Tropical Forest Soil | DGYKSRRRIMKAFIAALALAALIALPTFTAPANAGPPPWSPDFGTNGY* |
| Ga0066903_1072307992 | 3300005764 | Tropical Forest Soil | ALIAALALAMLIAAPTFAQPANAAPMSPASSSFGSNGY* |
| Ga0066903_1085242151 | 3300005764 | Tropical Forest Soil | MKKLIAALALMALIAVPTFTTSASAQVSPASPSFGSNGY* |
| Ga0081455_1000238617 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MKTLIAALALAVLIAVPTFTQEANAQVSPASSSFGSNGY* |
| Ga0081455_1000266126 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MKVLIAALALAALIAGVAPPANAAPMSPASSSFGSNGY* |
| Ga0081538_102097533 | 3300005981 | Tabebuia Heterophylla Rhizosphere | MKKLIAVLALATLIAVPTFDQLGNAAPVSPASSSFGAMATKGW* |
| Ga0081540_10266255 | 3300005983 | Tabebuia Heterophylla Rhizosphere | MKRIIAALALAALISIPTFNAAANAAPVSPASSSFGSNGY* |
| Ga0066696_104922971 | 3300006032 | Soil | MKTLIAALALAMLIAVPTFALSANAAPMSPASSSFGGNGY* |
| Ga0075028_1004415292 | 3300006050 | Watersheds | MKALVVALALATLIAMPTFTQSASAAPMSPASSSFGSNGY* |
| Ga0075367_103501711 | 3300006178 | Populus Endosphere | VKNIIAALALAALISIPTLNAAANAAPVSPASSSFGSN |
| Ga0075367_110443051 | 3300006178 | Populus Endosphere | MKKIIAVLALAALISIPTFNAAANAAPVSPASSSFGSNGY* |
| Ga0074062_121273601 | 3300006606 | Soil | VRTWRSIMKTLVVALALATLIAMPTFTQSANAAPMSPASSSFGSNGY* |
| Ga0066665_102763081 | 3300006796 | Soil | WTIVHNMKVIMKKFIAALALVTLIAVPTFAQSANAATVSPASSSFGDNGY* |
| Ga0066665_105871441 | 3300006796 | Soil | MKKFIAAIALISLITIPTLTQTASAAPMSPASSSFGSNGY* |
| Ga0066659_103456201 | 3300006797 | Soil | RIMKVLIAAFALATLIAIPTFAQLANAAPVSPASSSFGSNGY* |
| Ga0066659_108316632 | 3300006797 | Soil | MKKFIAAIALISLITIPTLTQTASAAPVSPASSSFGSNGY* |
| Ga0075428_1000384929 | 3300006844 | Populus Rhizosphere | MKVLIAALALAALIAGPTFAPAANAAPMSPASSSFGSNGY* |
| Ga0075428_1003390331 | 3300006844 | Populus Rhizosphere | MKALIAALALTALIAVPTFAPTANAAPMSPASSSFGSNGY* |
| Ga0075421_1001514556 | 3300006845 | Populus Rhizosphere | MKAFIAALALATLIAIPMLAQPASAAPVSPASSSFGSNGY* |
| Ga0075421_1004398133 | 3300006845 | Populus Rhizosphere | MKVLIAALALAALIAGPTFVPSANAAPMSPANSSFGSNGY* |
| Ga0075433_119540562 | 3300006852 | Populus Rhizosphere | MKALIAALALAALIAIPTFAPSATAAPISPSSSSFGSNGY* |
| Ga0075425_1011574451 | 3300006854 | Populus Rhizosphere | AALALATLIAIPMLAQPASAAPMSPASSSFGSNGY* |
| Ga0075434_1007770981 | 3300006871 | Populus Rhizosphere | MKALIAALALVTLIAAPTFAPPARAAPVSPASSSFGSNGY* |
| Ga0075424_1007237002 | 3300006904 | Populus Rhizosphere | MKALIAALALAALIAIPTFFAPSATAAPMSPSSSSFGSNGY* |
| Ga0075424_1010725632 | 3300006904 | Populus Rhizosphere | MVQTWRRVMKVLFAALALAALISAPTFTPPANAAPMSPASSSFGSNGY* |
| Ga0099791_102325461 | 3300007255 | Vadose Zone Soil | MVQIWRRVMKTLIAALALAMLIAVPTFAPVANAAPVSPASSSFGGNGY* |
| Ga0099795_106175112 | 3300007788 | Vadose Zone Soil | MKKLFAVLALVAMIAVPTFATPASANVSPASSSFGDNGY* |
| Ga0099795_106524321 | 3300007788 | Vadose Zone Soil | MKALIAALALATLIAAPAFAHPANAAPMSPASSSFGSNGY* |
| Ga0066710_1015008561 | 3300009012 | Grasslands Soil | MKKFIAAIALISLITIPTLTQTASAAPVSPASSSFGSNGY |
| Ga0099829_106480241 | 3300009038 | Vadose Zone Soil | MKKLIAALALVTLIAVPTFTQSANAADVSPASSSFGENGY* |
| Ga0099828_100289931 | 3300009089 | Vadose Zone Soil | MKALIAALALATLIAVPTFARPANAAPVSPSSSSFGSNGY* |
| Ga0099827_100800254 | 3300009090 | Vadose Zone Soil | MKRLIVALALMTAIAVPTFAQTANAALVSPSSSAFGDNGY* |
| Ga0075418_102927692 | 3300009100 | Populus Rhizosphere | MKKIIAALALAALISIPTFNAAAIAAPVSPASSSFGSNGY* |
| Ga0066709_1023385011 | 3300009137 | Grasslands Soil | MKTFIAALALAMLIAVPTFAPSANAAPMSPASSSFGGNGY* |
| Ga0114129_101736463 | 3300009147 | Populus Rhizosphere | MKVLIAALALAALIAGPTFAPSANAAPMSPANSSFGSNGY* |
| Ga0105243_124886282 | 3300009148 | Miscanthus Rhizosphere | MKNIIAALALAALISIPTFNVAANAAPVSPASSSFGSNGY* |
| Ga0075423_107384603 | 3300009162 | Populus Rhizosphere | MKKLIAALALFALIAGPTFATSASAQVSPASSSFGSNGY |
| Ga0126374_110336142 | 3300009792 | Tropical Forest Soil | MKPLIAALALVTLIAVPTFAKPASAAPVSPASSSFGSNGY* |
| Ga0126380_120291652 | 3300010043 | Tropical Forest Soil | MKKLIVVLALVTLIAAPTFAQSANAAPMSPASSSFGGNGY* |
| Ga0126384_100977361 | 3300010046 | Tropical Forest Soil | MKALIAALALAALIALPTFAPPANAGPPPWSPEFGTNGW* |
| Ga0126384_101416362 | 3300010046 | Tropical Forest Soil | MKMLIAALALAALIAVPTFTNPVQAAPMSPASSSFGSNGY* |
| Ga0126384_115597592 | 3300010046 | Tropical Forest Soil | KALIAALALATLIAAPTFAQPANAAPMSPASSSFGSNGYLIGLPP* |
| Ga0126382_100146521 | 3300010047 | Tropical Forest Soil | MKSLIAALALAALIAVPTLTTPVQAAPVSPASSSFGSNGY* |
| Ga0126382_103027542 | 3300010047 | Tropical Forest Soil | MKMLFAALALAALIAVPTLTSPANAAPMSPASSSFGSNGY* |
| Ga0126382_105270191 | 3300010047 | Tropical Forest Soil | MKMLIAALAFAALIAVPTLTTPVQAAPMSPASSSFGS |
| Ga0126370_110048972 | 3300010358 | Tropical Forest Soil | MKALIAALAFAALIAVPTFAQPANAAPVSPSSSSFGSNGY* |
| Ga0126376_123492291 | 3300010359 | Tropical Forest Soil | MKTLIAALALAMLIGATTSAANAAPVSPASSSFGGNGY* |
| Ga0126378_102186444 | 3300010361 | Tropical Forest Soil | MKTFIAALALALLIAVPTFTHSANAAPTSPASSSFGSNGY* |
| Ga0126381_1008566751 | 3300010376 | Tropical Forest Soil | MLFAALALAALIALPTFTPPANAAPVSPASSSFGSNGY* |
| Ga0126383_102572023 | 3300010398 | Tropical Forest Soil | MKALIAALALATLIAVPTFAPPASAAPMSPASSSFGSNGY* |
| Ga0126383_110010873 | 3300010398 | Tropical Forest Soil | WRRIMKSLIAALVLATLIAAPTFAHPANAAPMSPASSSFGSNGY* |
| Ga0126383_116861632 | 3300010398 | Tropical Forest Soil | MTALIAALALATLIAAPTFARPANAAPVSPASSSFGSN |
| Ga0126383_120316073 | 3300010398 | Tropical Forest Soil | KKLIVILALVTLIAAPTFAQSANAAPMSPASSSFGSNGY* |
| Ga0124850_10184202 | 3300010863 | Tropical Forest Soil | MKAFIAALALATLIAAPTFAQPANAAPMSPASSSFGSNGY* |
| Ga0137392_108989111 | 3300011269 | Vadose Zone Soil | MKALIAALALAALIAIPTFAPSATAAPMSPASSSFGSNGY* |
| Ga0137391_105836343 | 3300011270 | Vadose Zone Soil | LIAALALATLIAAPTFAHPANAAPMSPASSSFGSNGY* |
| Ga0137393_107544702 | 3300011271 | Vadose Zone Soil | MKKLIAALALITLIAVPTLTLPASAADVSPSSSSFGENGY* |
| Ga0137364_109764392 | 3300012198 | Vadose Zone Soil | MKTLIAALALAALIAIPTFTPPANAAPVSPASSSFGSNGY* |
| Ga0137365_106457893 | 3300012201 | Vadose Zone Soil | QIWRPTMKTLIAALALAMLIAVPTFAPSANAAPMSPASSSFGGNGY* |
| Ga0137363_101268201 | 3300012202 | Vadose Zone Soil | MVQIWRRVMKTLIAALALAMLIAVPSFAPVANAAPVSPASSSFGGNGY* |
| Ga0137363_104540461 | 3300012202 | Vadose Zone Soil | MKTLIAALALAMLIAVPTFAPPASAAPVSPASSSFGGNGY* |
| Ga0137363_107539113 | 3300012202 | Vadose Zone Soil | MVQIWRPTMKTLIAALALAMLIAVPTFAPVANAAPVSPASSSFGGNGY* |
| Ga0137363_109939061 | 3300012202 | Vadose Zone Soil | MKALIAALALATLIAVPTFAQSANAAPMSPASSSFG |
| Ga0137399_106003513 | 3300012203 | Vadose Zone Soil | VQIWRPTMKTLIAALALAMLIAVPTFAPPASAAPVSPASSSFGGNGY* |
| Ga0137362_104922142 | 3300012205 | Vadose Zone Soil | MKKFIAALALVTLIAVPTFAQSANAATVSPASSSFGDNGY* |
| Ga0137362_116037101 | 3300012205 | Vadose Zone Soil | MKALIAALALATLIAAPTFAHPANAAPMSPASSSFGS |
| Ga0137380_113483291 | 3300012206 | Vadose Zone Soil | MKTLIAALALATLVAVPILVQPASAAPMSPASSSFGSNGY |
| Ga0137381_100782241 | 3300012207 | Vadose Zone Soil | MKALITALALATLVAIPILLQPASAAPMSPASSSFGSNGY* |
| Ga0137376_100746083 | 3300012208 | Vadose Zone Soil | MKVLIAALALAALIAGPTFAPPANAAPMSPANSSFGSNGY* |
| Ga0137377_103523551 | 3300012211 | Vadose Zone Soil | MKALIAALALATLIAIPMLAQPASAAPVSPASSSFGSNGY* |
| Ga0137377_104104693 | 3300012211 | Vadose Zone Soil | MKALIAALALATLIAVPTLPANAAPMSPASSSFGSNGY* |
| Ga0137377_105575822 | 3300012211 | Vadose Zone Soil | MKRLTAVLAVIAVPMFAQSASAAPVSPASSSFGSNGY |
| Ga0137384_106052413 | 3300012357 | Vadose Zone Soil | MKALIAAVALATLIAAPTFAHPANAAPMSPASSSFGSN |
| Ga0137368_103023892 | 3300012358 | Vadose Zone Soil | MKTLIAALALAALIAVPTFTQPANAAPVSPASSSFGSNGY* |
| Ga0137368_108430871 | 3300012358 | Vadose Zone Soil | MKTLIAALALAALIAVPTFTQPANAAPTSPASSSFGSNGY* |
| Ga0137360_101230751 | 3300012361 | Vadose Zone Soil | MKSLIAALALATLIAVPMFAQSASVAPVSPASSSFGGNGY* |
| Ga0137361_110276581 | 3300012362 | Vadose Zone Soil | KSLIVALALAALIAVPTFAPSANAAPVSPASPAFGSNGY* |
| Ga0137395_100437612 | 3300012917 | Vadose Zone Soil | MKALVAALALATLIAMPTFTQSANAAPMSPASSSFGSNGY* |
| Ga0137394_106102452 | 3300012922 | Vadose Zone Soil | MKTLIAALALAALIAVPTFTQPANAAPISPSSSSFGSNGY* |
| Ga0137410_113975741 | 3300012944 | Vadose Zone Soil | MKKLMTALALFALIAVPTFATSASAQVSPASSSFGSNGY* |
| Ga0126375_100865702 | 3300012948 | Tropical Forest Soil | MKALIAALALATLIAVPTFAQLANAAPVSPASFSFGSNGY* |
| Ga0126375_110249111 | 3300012948 | Tropical Forest Soil | MKALIAALALATLIAAPTFARPANAAPVSPASSSFGSNG |
| Ga0126375_116066331 | 3300012948 | Tropical Forest Soil | TLRDVMKMLFAALALAALIALPTFTPPANAAPVSPASSSFGSNGY* |
| Ga0164302_103143391 | 3300012961 | Soil | ALALATLIAAPTFAHPANAAPMSPASSSFGSNGY* |
| Ga0126369_122107271 | 3300012971 | Tropical Forest Soil | MKALIAALALATLIAAPTFARPANAAPVSPASSSFGSN |
| Ga0134087_104428621 | 3300012977 | Grasslands Soil | TTIQIWRPTMKTLIAALALAMLIAVPAFAPSANAAPMSPASSSFGGNGY* |
| Ga0164307_114246331 | 3300012987 | Soil | MKALIAALALATLIAMPSFAPSASAAPVSPASSSFGSNGY* |
| Ga0164305_101592311 | 3300012989 | Soil | MKNIIAALALAALMSIPTFNVAANAAPVSPASSSFGSNGY* |
| Ga0157378_122358432 | 3300013297 | Miscanthus Rhizosphere | MKNIIAALALAALISIPTFNAAAYAAPVSPASSSFGSNGY* |
| Ga0157378_128666111 | 3300013297 | Miscanthus Rhizosphere | AAIALATLIAVPTFAQPANAAPVSPASSSFGSNGY* |
| Ga0163162_104842742 | 3300013306 | Switchgrass Rhizosphere | MKKISAALALAALISIPTFNAAAYAAPVSPASSSFGSNGY* |
| Ga0132258_103975003 | 3300015371 | Arabidopsis Rhizosphere | MKTLIAALALATLIAIPTFAPANAAPVSPASSSFGSNGY* |
| Ga0132257_1044707321 | 3300015373 | Arabidopsis Rhizosphere | RIMKALIAAIALATLIAVPTFAQPANAAPVSPASSSFGSNGY* |
| Ga0182036_111065142 | 3300016270 | Soil | AALALATLIAAPTFAQPANAAPMSPASSSFGSNGY |
| Ga0182041_100642025 | 3300016294 | Soil | MKALIAAFALATLIAVPTFAQLANAAPVSPASSSFGSNGY |
| Ga0182033_113715342 | 3300016319 | Soil | MKALVAALALATLIAMPTFTQSASAAPMSPASSSF |
| Ga0182040_102455081 | 3300016387 | Soil | TWRRIMKALIAALALATLMAAPTFAQPANAAPMSPASSSFGSNGY |
| Ga0182037_102450101 | 3300016404 | Soil | MVQTWRRIMKALIAALALATLIAAPTFAQPANAAPMSPASSSFGSNGY |
| Ga0182038_116750611 | 3300016445 | Soil | MKALIAALALVTLIAVPTFAPPANAAPMSPASSSFGSNG |
| Ga0066667_104256001 | 3300018433 | Grasslands Soil | MKTLIAALALAMLIAVPTFAPSANAAPMSPASSSFGGNGY |
| Ga0066667_114038221 | 3300018433 | Grasslands Soil | MKALIAALALATLIAMTTLAPSASAAPMSPASSSFGSNGY |
| Ga0193728_12801721 | 3300019890 | Soil | MKKIIAALALAALISIPTFNAAANAAPVSPASSSFGSNGY |
| Ga0210399_107632011 | 3300020581 | Soil | MKALIAALALATLIAAPTFAHPANAAPMSPASSSFGSNGY |
| Ga0210406_100596185 | 3300021168 | Soil | MKNIIAALALAALISIPTFNVAANAAPVSPASSSFG |
| Ga0210406_102672411 | 3300021168 | Soil | YYEDMWRRIMKALIAALALATLIAMPTLAPSASAAPMSPASSSFGSNGY |
| Ga0210408_100193666 | 3300021178 | Soil | MKTLIAALALVTLIAVPTFAPPANAAPMSPASSSFGSNGY |
| Ga0210387_103238651 | 3300021405 | Soil | WKRIMKALIAAIALVTLIAVPTFAQPANAAPVSPASSSFGSNGY |
| Ga0213879_100048142 | 3300021439 | Bulk Soil | MKALIAALALATLIALPTFAPPANAAPMSPASSSFGSNGY |
| Ga0126371_100806482 | 3300021560 | Tropical Forest Soil | MKALIAALALATVIAAPLFALPANAAPVSPASSSFGSNGY |
| Ga0126371_100932551 | 3300021560 | Tropical Forest Soil | CVMKMFIAALALATLIAIPTSAPANAAPVSPASSSFGSNGY |
| Ga0126371_100997145 | 3300021560 | Tropical Forest Soil | MKALIAALALATLIAAPTFAQPANAAPMSPASSSFGSNGY |
| Ga0126371_101849463 | 3300021560 | Tropical Forest Soil | MKTFIAALALAMLIAVTTSAANAAPVSPASSSFGGNGY |
| Ga0126371_103604222 | 3300021560 | Tropical Forest Soil | MKTLIAALALATLIAIPTFAPPANAAPMSPASSSFGSNGY |
| Ga0126371_119247651 | 3300021560 | Tropical Forest Soil | MKALIAALALATLIAVPTFAPLANAAPMSPASSSFGSNGY |
| Ga0126371_133299251 | 3300021560 | Tropical Forest Soil | LIAALALAMLIAAPTFAQPANAAPMSPASSSFGSNGY |
| Ga0179589_105381251 | 3300024288 | Vadose Zone Soil | MRRGIETWKRIMKALVAALALAMLTFTQSANAAPMSASSSSFGSNGY |
| Ga0137417_13615594 | 3300024330 | Vadose Zone Soil | MKKLFAVLALVAMIVVPTLAQTANAAPVSPASSSFGDNGY |
| Ga0207692_104845752 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MKALIAALALATLIAMPTLAPRASAAPMSPASSSFGSNGY |
| Ga0207684_100379272 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MKSLIAALALTALIAVPTFAPSANAAPVSPSSSAFGGNGY |
| Ga0207684_101310031 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MKVLFAALALAALISVPTFTPPANAAPMSPASSSFGSNGY |
| Ga0207646_101997121 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MKPLIAALALVTLIAVPTFAPPANAAPMSPASSSFGSNGY |
| Ga0207646_102062364 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MNALIAALALATLIAVPTFTQPANAAPVSPASSSFGSNGY |
| Ga0207664_106480191 | 3300025929 | Agricultural Soil | MKKIIAALALAALISIPTFNAAAYAAPVSPASSSFGS |
| Ga0209438_11554772 | 3300026285 | Grasslands Soil | AALALAMLIAIPTFAPVANAAPMSPASSSFGGNGY |
| Ga0209240_10008435 | 3300026304 | Grasslands Soil | MKALITALALATLLAVPILVQPAGAAPMSPASSSFGSNGY |
| Ga0209240_10015236 | 3300026304 | Grasslands Soil | MKALVAALALATLIAIPTFTQPASAAPMSPASSSFGSNGY |
| Ga0209240_10018763 | 3300026304 | Grasslands Soil | MKTLIAALALAMLIAIPTFAPVANAAPMSPASSSFGGNGY |
| Ga0209240_12743691 | 3300026304 | Grasslands Soil | RIMKALIAALALATLIAAPTFAHPANAAPMSPASSSFGSNGY |
| Ga0209239_10069375 | 3300026310 | Grasslands Soil | MKALIAALALATLIAVPTLPANAAPMSPASSSFGSNGY |
| Ga0209239_10120505 | 3300026310 | Grasslands Soil | MKALVAALALATLIAMPTFTQSASAAPMSPASSSFGSNGY |
| Ga0209239_10130285 | 3300026310 | Grasslands Soil | MKTLIAALALATLIAVPTFTQPANAAPMSPASSSFGSNGY |
| Ga0209801_11368952 | 3300026326 | Soil | MKALIAALALVTLIAVPTFAPSANAAPMSPASSSFGSNGY |
| Ga0209377_13206442 | 3300026334 | Soil | MKTLIAALALATLVAVPILVQPASAAPMSPASSSFGSN |
| Ga0209159_12436211 | 3300026343 | Soil | RTTVQTWRRIMKALVAALALATLIAMPTFTQSASAAPMSPASSSFGSNGY |
| Ga0257146_10891072 | 3300026374 | Soil | MKALIAALGLATLIAVPTLAQPANAAPVSPASSSFGSN |
| Ga0209058_10162559 | 3300026536 | Soil | MKTLIAALALATLVADPILVQPASAAPMSPASSSFGSNGY |
| Ga0209156_104438522 | 3300026547 | Soil | MKMFIAALALAALIAIPTSAPANAAPVSPASSSFGSNGY |
| Ga0208525_10397731 | 3300027288 | Soil | LVVALALATLIATPTFTQSASAAPMSPASSSFGSNGY |
| Ga0209814_102436442 | 3300027873 | Populus Rhizosphere | MKKFIAALALISLIAIPTLTQTANAAPMSPASSSFGSNGY |
| Ga0209465_100052395 | 3300027874 | Tropical Forest Soil | MKALIAALALATLIAVPTFAPPANAAPVSPASSSFGSNGY |
| Ga0209465_100061394 | 3300027874 | Tropical Forest Soil | MKSLIAALALVALIAIPTLTTSVQAAPVSPASSSFGSNGY |
| Ga0209465_102016543 | 3300027874 | Tropical Forest Soil | TMVQTWRRIMKALIAALALVTLIAAPTFAQPANAAPMSPASSSFGSNGY |
| Ga0209590_106133251 | 3300027882 | Vadose Zone Soil | MKALIAALALATLVAVPTFAQPANAAPVSPSSSSFGSNGY |
| Ga0209382_100432559 | 3300027909 | Populus Rhizosphere | MKVLIAALALAALIAGPTFVPSANAAPMSPANSSFGSNGY |
| Ga0209382_122486212 | 3300027909 | Populus Rhizosphere | MKALIAALALATLIAMPTLAPSASAAPMSPASSSFGSNGY |
| Ga0307292_104662221 | 3300028811 | Soil | MKALIAALALATLIAVPTFAPSASAAPVSPASSSFGSNGY |
| Ga0307278_100134936 | 3300028878 | Soil | MKALIAALALATLIAVPTFAQPANAAPVSPASSSFGSNGY |
| Ga0307278_100267983 | 3300028878 | Soil | MKTLIAALALAALIAVPTFTQPANAAPISPSSSSFGSNGY |
| Ga0307278_104060541 | 3300028878 | Soil | RIMKTLIAALALAALIAVPTFTQPANAAPISPSSSSFGSNGY |
| Ga0307308_103610042 | 3300028884 | Soil | IMKALIAALALATLIAVPTFAPSASAAPVSPASSSFGSNGY |
| Ga0318516_100036306 | 3300031543 | Soil | MKMLFAALALAALIAVPTFTPPANAAPVSAASSSFGSNGY |
| Ga0318516_100588182 | 3300031543 | Soil | MKMLFAALALAALIAVPTFTAPANAAPVSPASSSFGSNGY |
| Ga0318516_100914664 | 3300031543 | Soil | IAALALATLIAAPTFAQPANAAPMSPASSSFGSNGY |
| Ga0318516_101096783 | 3300031543 | Soil | MKMFIAALALAALIAVPTFTTPVQAAPMSPASSSFGSNGY |
| Ga0318516_105391201 | 3300031543 | Soil | RCIMKALIAALALATLIAVPTFAQLANAAPVSPASSSFGSNGY |
| Ga0318534_105843011 | 3300031544 | Soil | MKSLIAALALAALIAVPTFTQPVNAAPVSPASSSFGCY |
| Ga0318534_108325421 | 3300031544 | Soil | MKMLIAALALATLIAVPTFTTPVQAAPMSPASSSFGS |
| Ga0318541_100090112 | 3300031545 | Soil | MKMLIAALALATLIAVPTFTTPVQAAPMSPASSSFGSNGY |
| Ga0318541_100936851 | 3300031545 | Soil | MKSLIAALALIALIAVPTLTTPVQAAPVSPASSSF |
| Ga0318541_104450772 | 3300031545 | Soil | IMKAFIAALALATLIAAPTFAQPANAAPMSPASSSFGSNGY |
| Ga0318571_103942962 | 3300031549 | Soil | MKALIAALALATLIAVPMFAQPANAPPVPPASSSFG |
| Ga0318528_100264654 | 3300031561 | Soil | MKSLIAALALIALIAVPTLTTPVQAAPVSPASSSFGSNGY |
| Ga0310915_100295707 | 3300031573 | Soil | MKGLVAALALAALIAVPTFAPPVNAAPVSPASSSFGSNGY |
| Ga0310915_100553824 | 3300031573 | Soil | MKALIAALALATLIVAPTFAQPANAAPMSPASSSFGSNGY |
| Ga0310915_101495162 | 3300031573 | Soil | MKALIAALALATLIAVPTFAQPANAASMSPASSSFGSNGY |
| Ga0310915_109387032 | 3300031573 | Soil | MKALIAALALTTLIAAPTFARPANAAPVSPASSSFGSNGY |
| Ga0318555_100385472 | 3300031640 | Soil | MKTLIAALALAVLIAVPTFTQSANAAPTSPASSSFGSNGY |
| Ga0318555_103294031 | 3300031640 | Soil | MKVLVAALALAALIAMPTFTQSASAAPMSPASSSFGSNGY |
| Ga0318555_106220302 | 3300031640 | Soil | RIMKALIAALALATLIVAPTFAQPANAAPMSPASSSFGSNGY |
| Ga0318542_100094342 | 3300031668 | Soil | MKSLIAALALIALIAVPTFTTPVQAAPVSPASSSFGSNGY |
| Ga0318542_105605661 | 3300031668 | Soil | MKALVAALALATLIAMPTFTQSASAAPMSPASSSFG |
| Ga0318574_107212731 | 3300031680 | Soil | IAALALATLIVAPTFAQPANAAPMSPASSSFGSNGY |
| Ga0318560_101120403 | 3300031682 | Soil | MKALIAALALATLIAVPTFAPPANAAPPASSSFGSNGY |
| Ga0318560_107520302 | 3300031682 | Soil | MKTLIAALALATLIAAPTFAQPANAAPMSPASSSFGSNGY |
| Ga0306917_100329543 | 3300031719 | Soil | MKALIAALALATLIAVPTFAQLANAAPVSPASSSFGSNGY |
| Ga0306917_106602342 | 3300031719 | Soil | MKTLIAALALAVLIAVPTFTQSANAAPTSPASSSFGSNG |
| Ga0306917_109117222 | 3300031719 | Soil | ALIAALALATLIAAPTFAQPANAAPMSPASSSFGSNGY |
| Ga0307469_102745624 | 3300031720 | Hardwood Forest Soil | MKALIAALALATLIAAPTFTHPANAAPMSPASSSFGSNGY |
| Ga0318500_102939362 | 3300031724 | Soil | RTMVQTWRCIMKALIAAFALATLIAVPTFAQLANAAPVSPASSSFGSNGY |
| Ga0318500_102988992 | 3300031724 | Soil | MKTLIAALALATLIAAPTFTHPANAAPVSPASSSFGSNGY |
| Ga0318500_104622082 | 3300031724 | Soil | MKMLIAALALATLIAVPTFTTPVQAAPMSPASSSFGSNG |
| Ga0306918_100682015 | 3300031744 | Soil | MKSLIAALALAALIAVPTFTQPVNAAPVSPASSSFGSNGY |
| Ga0306918_101552592 | 3300031744 | Soil | MKTLIAALALALLIAVPTFTAPANAQVSPSSSSFGSNGY |
| Ga0318502_1000158010 | 3300031747 | Soil | MKMLFAALALAALIAVPTFTPPANAAPVSPASSSFGSNGY |
| Ga0318509_107597041 | 3300031768 | Soil | WRRIMKALIAALALATLIAAPTFAHPANAAPMSPASSSFGSNGY |
| Ga0318521_100040284 | 3300031770 | Soil | MKALIAALALATLIAAPTFARPANAAPVSPASSSFGSNGY |
| Ga0318546_104559911 | 3300031771 | Soil | QTWRRIMKALIAALALATLIAAPTFAQPANAAPMSPASSSFGSNGY |
| Ga0318546_105270582 | 3300031771 | Soil | IMKALIAALALATLIAVPTFAQLANAAPVSPASSSFGSNGY |
| Ga0318508_10203741 | 3300031780 | Soil | YRRRIMKALIAALALATLIAVPTFAPPANAAPVSPASSSFGSNGY |
| Ga0318508_11699452 | 3300031780 | Soil | MKMLIAALALATLIAVPTFTTPVQAAPMSPASSSFGSN |
| Ga0318547_102801131 | 3300031781 | Soil | TWRRIMKALIAALALATLIAAPTFAQPANAAPMSPASSSFGSNGY |
| Ga0318552_103011981 | 3300031782 | Soil | AALALATLIAVPTFTTPVQAAPMSPASSSFGSNGY |
| Ga0318503_100005555 | 3300031794 | Soil | MKMLFAALALAALITVPTFTPPANAAPVSAASSSFGSNGY |
| Ga0318497_100098025 | 3300031805 | Soil | MKALIAALALATLIAAPTFARPANAAPMSPASSSFGSNGY |
| Ga0318497_107224292 | 3300031805 | Soil | MKSLIAALALIALIAIPTLTTPVQAAPVSPASSSFGSNGY |
| Ga0318567_100474835 | 3300031821 | Soil | RRIMKALIAALALATLIVAPTFAQPANAAPMSPASSSFGSNGY |
| Ga0318567_104000411 | 3300031821 | Soil | MKSLIAALALIALIAVPTLTIPVQAAPVSPASSSF |
| Ga0318567_104004101 | 3300031821 | Soil | MKVLVAALALATLIAMPTFTQSASAAPMSPASSSFGSNGY |
| Ga0310917_100041961 | 3300031833 | Soil | MKMFIAALALAALIAVPTFTTPVQAAPMSPASSSFG |
| Ga0310917_100218938 | 3300031833 | Soil | WRRIMKALIAALALVTLIAVPTFAPPANAAPMSPASSSFGSNGY |
| Ga0310917_102338253 | 3300031833 | Soil | MKALIAALALAILIAAPTFAPPANAAPMSPASSSFGSNGY |
| Ga0310917_104816863 | 3300031833 | Soil | MKALIAALALATLIAAPTFAQPANAAPMSPASSSF |
| Ga0318511_100678474 | 3300031845 | Soil | VQTWRRIMKALIAALALATLIVAPTFAQPANAAPMSPASSSFGSNGY |
| Ga0318527_100068685 | 3300031859 | Soil | MKPLIAAHALVTLIAVPTFAQPASAAPVSPASSSFGSNGY |
| Ga0306919_100933792 | 3300031879 | Soil | MKGLVAALALAALIAVPTFAPPANAAPVSPASSSFGSNGY |
| Ga0306925_1001421110 | 3300031890 | Soil | MKALIAALAMTTLIAVSTFAPTANAAPMSPASSSFGSNGY |
| Ga0318551_100062324 | 3300031896 | Soil | MKLLFAALALAALIAVPTFTAPANAAPVSPASSSFGSNGY |
| Ga0306923_100755243 | 3300031910 | Soil | MKSLIAALALIALIAVPTLTIPVQAAPVSPASSSFGSNGY |
| Ga0306921_100845373 | 3300031912 | Soil | MKAFIAALALATLIAAPTFAQPANAAPMSPASSSFGSNGY |
| Ga0306921_104343122 | 3300031912 | Soil | MKALIAALALATLIAIPMLAQPASAAPMSPASSSFGSNGY |
| Ga0310916_103456164 | 3300031942 | Soil | MKALIAALALATLIAAPTFAQPANAAPMSPASSSFGS |
| Ga0310913_112864432 | 3300031945 | Soil | MKTLIAALALVTLIAVPTFAPPANAAPMSPASSSFGSNG |
| Ga0306926_102007131 | 3300031954 | Soil | MKALIAALALATLIAIPMLAQPASAAPMSPASPSFGSNGY |
| Ga0306926_125484121 | 3300031954 | Soil | TMVQTWRCIMKALIAALALATLIAVPTFAQLANAAPVSPASSSFGSNGY |
| Ga0318530_100068372 | 3300031959 | Soil | MKMLFAALALAALIAVPTFTPPANAAPASPASSSFGSNGY |
| Ga0318531_102775703 | 3300031981 | Soil | MKALIAALALATLIAAPTFAQPANAAPMSPASSSFGSNG |
| Ga0318531_105579762 | 3300031981 | Soil | RIMKALIAALALATLIAAPTFAQPANAAPMSPASSSFGSNGY |
| Ga0318507_100333551 | 3300032025 | Soil | MKMLIAALALAALIAVPTFTTPVQAAPMSPASSSFGSNGY |
| Ga0310911_101018493 | 3300032035 | Soil | MKAFIAALALATLIAIPTLTPSANAAPMSPASSSFGSN |
| Ga0310911_102606551 | 3300032035 | Soil | MKALIAALALATLIVAPTFAQPANAAPMSPASSSFGSN |
| Ga0318549_103321112 | 3300032041 | Soil | KALIAALALATLIAAPTFAQPANAAPMSPASSSFGSNGY |
| Ga0318532_102501322 | 3300032051 | Soil | RIMKAFIAALALATLIAAPTFAQPANAAPMSPASSSFGSNGY |
| Ga0318575_103649282 | 3300032055 | Soil | WRGIMKALIAALALATLIAAPTFTQPANAAPMSPASSSFGSNGY |
| Ga0318533_101878204 | 3300032059 | Soil | VTMVQTWRRIMKALIAALALVTLIAAPTFAQPANAAPMSPASSSFGSNGY |
| Ga0318513_101000401 | 3300032065 | Soil | TWRRIMKALIAALALATLIVAPTFAQPANAAPMSPASSSFGSNGY |
| Ga0318514_105121722 | 3300032066 | Soil | VMKMLIAALALATLIAVPTFTTPVQAAPMSPASSSFGSNGY |
| Ga0318540_104642521 | 3300032094 | Soil | MKALIAALALATLIAVPTFAPPANAAPMSPASSSFG |
| Ga0306920_1031541652 | 3300032261 | Soil | MKALIAALALVTLIAVPTFAPPANAAPMSPASSSF |
| Ga0310914_107118112 | 3300033289 | Soil | TLIAALALALLIAVPTFTAPANAQVSPSSSSFGSNGY |
| ⦗Top⦘ |