


| Basic Information | |
|---|---|
| Family ID | F006589 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 369 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MLKELLEKKVNSIINTNDLTDMQVWGVMCGIGFISAFIIMWII |
| Number of Associated Samples | 216 |
| Number of Associated Scaffolds | 369 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 16.03 % |
| % of genes near scaffold ends (potentially truncated) | 38.75 % |
| % of genes from short scaffolds (< 2000 bps) | 79.95 % |
| Associated GOLD sequencing projects | 177 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.47 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (29.539 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (35.772 % of family members) |
| Environment Ontology (ENVO) | Unclassified (83.198 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (93.496 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 57.75% β-sheet: 0.00% Coil/Unstructured: 42.25% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 369 Family Scaffolds |
|---|---|---|
| PF03237 | Terminase_6N | 32.52 |
| PF00476 | DNA_pol_A | 0.54 |
| PF06321 | P_gingi_FimA | 0.27 |
| PF10263 | SprT-like | 0.27 |
| COG ID | Name | Functional Category | % Frequency in 369 Family Scaffolds |
|---|---|---|---|
| COG0749 | DNA polymerase I, 3'-5' exonuclease and polymerase domains | Replication, recombination and repair [L] | 0.54 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 46.88 % |
| Unclassified | root | N/A | 29.54 % |
| unclassified Hyphomonas | no rank | unclassified Hyphomonas | 23.58 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000101|DelMOSum2010_c10008458 | Not Available | 6859 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10051153 | All Organisms → Viruses → Predicted Viral | 2063 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10062383 | All Organisms → Viruses → Predicted Viral | 1782 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10068240 | Not Available | 1655 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10087223 | Not Available | 1352 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10091503 | unclassified Hyphomonas → Hyphomonas sp. | 1300 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10094286 | All Organisms → Viruses → Predicted Viral | 1268 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10116656 | Not Available | 1062 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10119939 | unclassified Hyphomonas → Hyphomonas sp. | 1037 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10191490 | Not Available | 697 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10223424 | Not Available | 613 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10239442 | unclassified Hyphomonas → Hyphomonas sp. | 579 | Open in IMG/M |
| 3300000115|DelMOSum2011_c10041819 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1908 | Open in IMG/M |
| 3300000115|DelMOSum2011_c10048354 | Not Available | 1706 | Open in IMG/M |
| 3300000115|DelMOSum2011_c10075904 | All Organisms → Viruses → Predicted Viral | 1188 | Open in IMG/M |
| 3300000115|DelMOSum2011_c10080114 | unclassified Hyphomonas → Hyphomonas sp. | 1138 | Open in IMG/M |
| 3300000115|DelMOSum2011_c10117140 | Not Available | 840 | Open in IMG/M |
| 3300000115|DelMOSum2011_c10195268 | unclassified Hyphomonas → Hyphomonas sp. | 567 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10015834 | All Organisms → Viruses → Predicted Viral | 3781 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10019456 | All Organisms → Viruses → Predicted Viral | 3336 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10059848 | All Organisms → Viruses → Predicted Viral | 1608 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10084513 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1245 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10139128 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 848 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10186389 | Not Available | 676 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10203255 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 633 | Open in IMG/M |
| 3300000117|DelMOWin2010_c10011920 | All Organisms → Viruses → Predicted Viral | 4865 | Open in IMG/M |
| 3300000117|DelMOWin2010_c10034906 | Not Available | 2397 | Open in IMG/M |
| 3300000947|BBAY92_10108867 | unclassified Hyphomonas → Hyphomonas sp. | 735 | Open in IMG/M |
| 3300000949|BBAY94_10110134 | Not Available | 753 | Open in IMG/M |
| 3300000973|BBAY93_10090848 | unclassified Hyphomonas → Hyphomonas sp. | 779 | Open in IMG/M |
| 3300001450|JGI24006J15134_10049085 | Not Available | 1737 | Open in IMG/M |
| 3300001450|JGI24006J15134_10060158 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1506 | Open in IMG/M |
| 3300001450|JGI24006J15134_10063002 | Not Available | 1458 | Open in IMG/M |
| 3300001450|JGI24006J15134_10171774 | unclassified Hyphomonas → Hyphomonas sp. | 688 | Open in IMG/M |
| 3300001450|JGI24006J15134_10211987 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 582 | Open in IMG/M |
| 3300001460|JGI24003J15210_10001842 | Not Available | 9307 | Open in IMG/M |
| 3300001460|JGI24003J15210_10006106 | Not Available | 5084 | Open in IMG/M |
| 3300001460|JGI24003J15210_10039327 | unclassified Hyphomonas → Hyphomonas sp. | 1656 | Open in IMG/M |
| 3300001460|JGI24003J15210_10049224 | unclassified Hyphomonas → Hyphomonas sp. | 1415 | Open in IMG/M |
| 3300001460|JGI24003J15210_10120820 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 715 | Open in IMG/M |
| 3300001460|JGI24003J15210_10159694 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 567 | Open in IMG/M |
| 3300001472|JGI24004J15324_10034479 | All Organisms → Viruses → Predicted Viral | 1614 | Open in IMG/M |
| 3300001472|JGI24004J15324_10066257 | unclassified Hyphomonas → Hyphomonas sp. | 1020 | Open in IMG/M |
| 3300001589|JGI24005J15628_10017076 | All Organisms → Viruses → Predicted Viral | 3210 | Open in IMG/M |
| 3300001589|JGI24005J15628_10051011 | All Organisms → Viruses → Predicted Viral | 1597 | Open in IMG/M |
| 3300001589|JGI24005J15628_10103486 | unclassified Hyphomonas → Hyphomonas sp. | 951 | Open in IMG/M |
| 3300001720|JGI24513J20088_1001000 | All Organisms → Viruses → Predicted Viral | 4379 | Open in IMG/M |
| 3300001853|JGI24524J20080_1001123 | All Organisms → Viruses → Predicted Viral | 4901 | Open in IMG/M |
| 3300001853|JGI24524J20080_1006001 | All Organisms → Viruses → Predicted Viral | 1620 | Open in IMG/M |
| 3300001853|JGI24524J20080_1021661 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 658 | Open in IMG/M |
| 3300001967|GOS2242_1004869 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1801 | Open in IMG/M |
| 3300002483|JGI25132J35274_1044925 | Not Available | 967 | Open in IMG/M |
| 3300002483|JGI25132J35274_1057250 | unclassified Hyphomonas → Hyphomonas sp. | 833 | Open in IMG/M |
| 3300002488|JGI25128J35275_1002327 | All Organisms → Viruses | 5534 | Open in IMG/M |
| 3300003894|Ga0063241_1009387 | All Organisms → cellular organisms → Bacteria | 5816 | Open in IMG/M |
| 3300004029|Ga0055442_10317529 | unclassified Hyphomonas → Hyphomonas sp. | 538 | Open in IMG/M |
| 3300004097|Ga0055584_102129948 | unclassified Hyphomonas → Hyphomonas sp. | 573 | Open in IMG/M |
| 3300004448|Ga0065861_1121398 | Not Available | 657 | Open in IMG/M |
| 3300004457|Ga0066224_1054695 | unclassified Hyphomonas → Hyphomonas sp. | 947 | Open in IMG/M |
| 3300004829|Ga0068515_101140 | All Organisms → cellular organisms → Bacteria | 3429 | Open in IMG/M |
| 3300004829|Ga0068515_111552 | unclassified Hyphomonas → Hyphomonas sp. | 1107 | Open in IMG/M |
| 3300005057|Ga0068511_1048841 | Not Available | 690 | Open in IMG/M |
| 3300005514|Ga0066866_10081074 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1201 | Open in IMG/M |
| 3300005522|Ga0066861_10208593 | Not Available | 669 | Open in IMG/M |
| 3300005837|Ga0078893_10279838 | All Organisms → cellular organisms → Bacteria | 3915 | Open in IMG/M |
| 3300006025|Ga0075474_10003328 | Not Available | 6701 | Open in IMG/M |
| 3300006026|Ga0075478_10055825 | All Organisms → Viruses → Predicted Viral | 1290 | Open in IMG/M |
| 3300006026|Ga0075478_10141951 | Not Available | 752 | Open in IMG/M |
| 3300006027|Ga0075462_10080915 | Not Available | 1018 | Open in IMG/M |
| 3300006029|Ga0075466_1016467 | Not Available | 2448 | Open in IMG/M |
| 3300006029|Ga0075466_1047891 | All Organisms → Viruses → Predicted Viral | 1270 | Open in IMG/M |
| 3300006029|Ga0075466_1065904 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1034 | Open in IMG/M |
| 3300006029|Ga0075466_1075815 | Not Available | 944 | Open in IMG/M |
| 3300006029|Ga0075466_1081894 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae | 899 | Open in IMG/M |
| 3300006484|Ga0070744_10024781 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1777 | Open in IMG/M |
| 3300006484|Ga0070744_10161367 | unclassified Hyphomonas → Hyphomonas sp. | 642 | Open in IMG/M |
| 3300006735|Ga0098038_1006826 | All Organisms → Viruses → Predicted Viral | 4606 | Open in IMG/M |
| 3300006735|Ga0098038_1030055 | All Organisms → Viruses → Predicted Viral | 2029 | Open in IMG/M |
| 3300006735|Ga0098038_1085096 | Not Available | 1105 | Open in IMG/M |
| 3300006735|Ga0098038_1223822 | unclassified Hyphomonas → Hyphomonas sp. | 601 | Open in IMG/M |
| 3300006736|Ga0098033_1144436 | unclassified Hyphomonas → Hyphomonas sp. | 668 | Open in IMG/M |
| 3300006737|Ga0098037_1041863 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae | 1667 | Open in IMG/M |
| 3300006737|Ga0098037_1051794 | Not Available | 1477 | Open in IMG/M |
| 3300006737|Ga0098037_1064623 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1301 | Open in IMG/M |
| 3300006737|Ga0098037_1068738 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1255 | Open in IMG/M |
| 3300006737|Ga0098037_1270468 | unclassified Hyphomonas → Hyphomonas sp. | 541 | Open in IMG/M |
| 3300006749|Ga0098042_1018282 | Not Available | 2087 | Open in IMG/M |
| 3300006752|Ga0098048_1027412 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 1872 | Open in IMG/M |
| 3300006752|Ga0098048_1043983 | All Organisms → Viruses → Predicted Viral | 1417 | Open in IMG/M |
| 3300006752|Ga0098048_1077312 | All Organisms → Viruses → Predicted Viral | 1020 | Open in IMG/M |
| 3300006752|Ga0098048_1113478 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 816 | Open in IMG/M |
| 3300006789|Ga0098054_1004496 | All Organisms → cellular organisms → Bacteria | 6194 | Open in IMG/M |
| 3300006789|Ga0098054_1049573 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 1609 | Open in IMG/M |
| 3300006789|Ga0098054_1120928 | unclassified Hyphomonas → Hyphomonas sp. | 974 | Open in IMG/M |
| 3300006789|Ga0098054_1130333 | unclassified Hyphomonas → Hyphomonas sp. | 933 | Open in IMG/M |
| 3300006789|Ga0098054_1147733 | unclassified Hyphomonas → Hyphomonas sp. | 869 | Open in IMG/M |
| 3300006789|Ga0098054_1303767 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 570 | Open in IMG/M |
| 3300006793|Ga0098055_1231303 | unclassified Hyphomonas → Hyphomonas sp. | 698 | Open in IMG/M |
| 3300006793|Ga0098055_1408918 | Not Available | 502 | Open in IMG/M |
| 3300006802|Ga0070749_10205767 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1126 | Open in IMG/M |
| 3300006810|Ga0070754_10055250 | All Organisms → Viruses → Predicted Viral | 2081 | Open in IMG/M |
| 3300006810|Ga0070754_10179503 | unclassified Hyphomonas → Hyphomonas sp. | 997 | Open in IMG/M |
| 3300006916|Ga0070750_10018037 | Not Available | 3605 | Open in IMG/M |
| 3300006916|Ga0070750_10345684 | unclassified Hyphomonas → Hyphomonas sp. | 629 | Open in IMG/M |
| 3300006919|Ga0070746_10290686 | Not Available | 753 | Open in IMG/M |
| 3300006919|Ga0070746_10502043 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 532 | Open in IMG/M |
| 3300006920|Ga0070748_1145428 | unclassified Hyphomonas → Hyphomonas sp. | 884 | Open in IMG/M |
| 3300006921|Ga0098060_1021518 | Not Available | 2002 | Open in IMG/M |
| 3300006921|Ga0098060_1049729 | Not Available | 1241 | Open in IMG/M |
| 3300006921|Ga0098060_1218090 | Not Available | 519 | Open in IMG/M |
| 3300006921|Ga0098060_1231670 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 501 | Open in IMG/M |
| 3300006922|Ga0098045_1134825 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium TMED211 | 573 | Open in IMG/M |
| 3300006924|Ga0098051_1060371 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1039 | Open in IMG/M |
| 3300006924|Ga0098051_1104637 | Not Available | 759 | Open in IMG/M |
| 3300006928|Ga0098041_1075064 | unclassified Hyphomonas → Hyphomonas sp. | 1091 | Open in IMG/M |
| 3300006928|Ga0098041_1107100 | unclassified Hyphomonas → Hyphomonas sp. | 902 | Open in IMG/M |
| 3300006928|Ga0098041_1274809 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 536 | Open in IMG/M |
| 3300006929|Ga0098036_1282693 | unclassified Hyphomonas → Hyphomonas sp. | 500 | Open in IMG/M |
| 3300006947|Ga0075444_10270508 | unclassified Hyphomonas → Hyphomonas sp. | 663 | Open in IMG/M |
| 3300007276|Ga0070747_1140139 | Not Available | 874 | Open in IMG/M |
| 3300007276|Ga0070747_1199212 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 706 | Open in IMG/M |
| 3300007345|Ga0070752_1185918 | unclassified Hyphomonas → Hyphomonas sp. | 835 | Open in IMG/M |
| 3300007538|Ga0099851_1057342 | All Organisms → Viruses → Predicted Viral | 1523 | Open in IMG/M |
| 3300007640|Ga0070751_1337184 | unclassified Hyphomonas → Hyphomonas sp. | 555 | Open in IMG/M |
| 3300007725|Ga0102951_1070872 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1004 | Open in IMG/M |
| 3300007963|Ga0110931_1192628 | unclassified Hyphomonas → Hyphomonas sp. | 609 | Open in IMG/M |
| 3300007973|Ga0105746_1311859 | unclassified Hyphomonas → Hyphomonas sp. | 546 | Open in IMG/M |
| 3300007992|Ga0105748_10198254 | unclassified Hyphomonas → Hyphomonas sp. | 834 | Open in IMG/M |
| 3300008050|Ga0098052_1057826 | unclassified Hyphomonas → Hyphomonas sp. | 1650 | Open in IMG/M |
| 3300008050|Ga0098052_1398934 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 511 | Open in IMG/M |
| 3300009001|Ga0102963_1400416 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 538 | Open in IMG/M |
| 3300009080|Ga0102815_10467275 | Not Available | 704 | Open in IMG/M |
| 3300009172|Ga0114995_10737703 | Not Available | 539 | Open in IMG/M |
| 3300009420|Ga0114994_10343787 | unclassified Hyphomonas → Hyphomonas sp. | 991 | Open in IMG/M |
| 3300009433|Ga0115545_1034387 | All Organisms → Viruses → Predicted Viral | 2021 | Open in IMG/M |
| 3300009433|Ga0115545_1227175 | unclassified Hyphomonas → Hyphomonas sp. | 631 | Open in IMG/M |
| 3300009435|Ga0115546_1054416 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium TMED211 | 1533 | Open in IMG/M |
| 3300009472|Ga0115554_1114393 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1138 | Open in IMG/M |
| 3300009472|Ga0115554_1262040 | Not Available | 689 | Open in IMG/M |
| 3300009498|Ga0115568_10076606 | All Organisms → Viruses → Predicted Viral | 1697 | Open in IMG/M |
| 3300009507|Ga0115572_10146220 | Not Available | 1389 | Open in IMG/M |
| 3300009512|Ga0115003_10392989 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 816 | Open in IMG/M |
| 3300009512|Ga0115003_10714778 | Not Available | 583 | Open in IMG/M |
| 3300009593|Ga0115011_10177682 | unclassified Hyphomonas → Hyphomonas sp. | 1560 | Open in IMG/M |
| 3300009593|Ga0115011_10229822 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae | 1383 | Open in IMG/M |
| 3300009677|Ga0115104_10177211 | unclassified Hyphomonas → Hyphomonas sp. | 882 | Open in IMG/M |
| 3300009677|Ga0115104_10235806 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 727 | Open in IMG/M |
| 3300009705|Ga0115000_10433079 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 834 | Open in IMG/M |
| 3300010150|Ga0098056_1026801 | All Organisms → Viruses → Predicted Viral | 2032 | Open in IMG/M |
| 3300010150|Ga0098056_1177242 | unclassified Hyphomonas → Hyphomonas sp. | 716 | Open in IMG/M |
| 3300010153|Ga0098059_1064400 | Not Available | 1465 | Open in IMG/M |
| 3300010153|Ga0098059_1170453 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 853 | Open in IMG/M |
| 3300011129|Ga0151672_118499 | unclassified Hyphomonas → Hyphomonas sp. | 791 | Open in IMG/M |
| 3300011252|Ga0151674_1005095 | Not Available | 664 | Open in IMG/M |
| 3300011258|Ga0151677_1005628 | All Organisms → Viruses → Predicted Viral | 1674 | Open in IMG/M |
| 3300011258|Ga0151677_1046879 | unclassified Hyphomonas → Hyphomonas sp. | 789 | Open in IMG/M |
| 3300012919|Ga0160422_11105602 | Not Available | 514 | Open in IMG/M |
| 3300017697|Ga0180120_10294638 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 650 | Open in IMG/M |
| 3300017708|Ga0181369_1019462 | All Organisms → Viruses → Predicted Viral | 1660 | Open in IMG/M |
| 3300017708|Ga0181369_1063644 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 806 | Open in IMG/M |
| 3300017708|Ga0181369_1119083 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 537 | Open in IMG/M |
| 3300017709|Ga0181387_1076797 | unclassified Hyphomonas → Hyphomonas sp. | 674 | Open in IMG/M |
| 3300017713|Ga0181391_1013904 | Not Available | 2048 | Open in IMG/M |
| 3300017713|Ga0181391_1080229 | Not Available | 746 | Open in IMG/M |
| 3300017714|Ga0181412_1027207 | All Organisms → Viruses → Predicted Viral | 1558 | Open in IMG/M |
| 3300017714|Ga0181412_1088174 | Not Available | 739 | Open in IMG/M |
| 3300017719|Ga0181390_1047471 | All Organisms → Viruses → Predicted Viral | 1272 | Open in IMG/M |
| 3300017720|Ga0181383_1057828 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1041 | Open in IMG/M |
| 3300017720|Ga0181383_1125168 | unclassified Hyphomonas → Hyphomonas sp. | 690 | Open in IMG/M |
| 3300017724|Ga0181388_1046060 | unclassified Hyphomonas → Hyphomonas sp. | 1057 | Open in IMG/M |
| 3300017724|Ga0181388_1175731 | Not Available | 507 | Open in IMG/M |
| 3300017727|Ga0181401_1091608 | Not Available | 781 | Open in IMG/M |
| 3300017728|Ga0181419_1018580 | Not Available | 1966 | Open in IMG/M |
| 3300017728|Ga0181419_1165092 | Not Available | 527 | Open in IMG/M |
| 3300017730|Ga0181417_1127141 | Not Available | 616 | Open in IMG/M |
| 3300017730|Ga0181417_1174323 | Not Available | 517 | Open in IMG/M |
| 3300017732|Ga0181415_1037933 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1105 | Open in IMG/M |
| 3300017732|Ga0181415_1043936 | Not Available | 1021 | Open in IMG/M |
| 3300017737|Ga0187218_1144231 | Not Available | 564 | Open in IMG/M |
| 3300017738|Ga0181428_1051363 | Not Available | 960 | Open in IMG/M |
| 3300017738|Ga0181428_1163964 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 519 | Open in IMG/M |
| 3300017738|Ga0181428_1169558 | Not Available | 510 | Open in IMG/M |
| 3300017739|Ga0181433_1016738 | All Organisms → Viruses → Predicted Viral | 1973 | Open in IMG/M |
| 3300017740|Ga0181418_1091942 | Not Available | 737 | Open in IMG/M |
| 3300017742|Ga0181399_1009015 | All Organisms → Viruses → Predicted Viral | 2961 | Open in IMG/M |
| 3300017742|Ga0181399_1051117 | unclassified Hyphomonas → Hyphomonas sp. | 1079 | Open in IMG/M |
| 3300017744|Ga0181397_1149852 | unclassified Hyphomonas → Hyphomonas sp. | 597 | Open in IMG/M |
| 3300017746|Ga0181389_1137852 | Not Available | 655 | Open in IMG/M |
| 3300017748|Ga0181393_1092759 | unclassified Hyphomonas → Hyphomonas sp. | 784 | Open in IMG/M |
| 3300017749|Ga0181392_1095054 | Not Available | 893 | Open in IMG/M |
| 3300017750|Ga0181405_1049067 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1114 | Open in IMG/M |
| 3300017750|Ga0181405_1064213 | Not Available | 953 | Open in IMG/M |
| 3300017751|Ga0187219_1035247 | Not Available | 1728 | Open in IMG/M |
| 3300017751|Ga0187219_1078540 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1034 | Open in IMG/M |
| 3300017752|Ga0181400_1038362 | All Organisms → Viruses → Predicted Viral | 1519 | Open in IMG/M |
| 3300017756|Ga0181382_1029126 | All Organisms → Viruses → Predicted Viral | 1680 | Open in IMG/M |
| 3300017758|Ga0181409_1011455 | All Organisms → Viruses → Predicted Viral | 2946 | Open in IMG/M |
| 3300017759|Ga0181414_1053278 | unclassified Hyphomonas → Hyphomonas sp. | 1082 | Open in IMG/M |
| 3300017760|Ga0181408_1022322 | unclassified Hyphomonas → Hyphomonas sp. | 1744 | Open in IMG/M |
| 3300017760|Ga0181408_1103430 | unclassified Hyphomonas → Hyphomonas sp. | 741 | Open in IMG/M |
| 3300017762|Ga0181422_1024660 | Not Available | 1967 | Open in IMG/M |
| 3300017763|Ga0181410_1121047 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 748 | Open in IMG/M |
| 3300017763|Ga0181410_1160688 | Not Available | 628 | Open in IMG/M |
| 3300017764|Ga0181385_1085963 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium TMED211 | 966 | Open in IMG/M |
| 3300017764|Ga0181385_1160315 | unclassified Hyphomonas → Hyphomonas sp. | 682 | Open in IMG/M |
| 3300017768|Ga0187220_1014341 | All Organisms → Viruses → Predicted Viral | 2385 | Open in IMG/M |
| 3300017770|Ga0187217_1219944 | Not Available | 625 | Open in IMG/M |
| 3300017771|Ga0181425_1112281 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 871 | Open in IMG/M |
| 3300017773|Ga0181386_1007097 | All Organisms → Viruses → Predicted Viral | 3890 | Open in IMG/M |
| 3300017773|Ga0181386_1121186 | unclassified Hyphomonas → Hyphomonas sp. | 809 | Open in IMG/M |
| 3300017775|Ga0181432_1101244 | Not Available | 858 | Open in IMG/M |
| 3300017786|Ga0181424_10177581 | Not Available | 907 | Open in IMG/M |
| 3300017786|Ga0181424_10348854 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium TMED211 | 609 | Open in IMG/M |
| 3300017824|Ga0181552_10080347 | All Organisms → Viruses → Predicted Viral | 1845 | Open in IMG/M |
| 3300017824|Ga0181552_10459948 | unclassified Hyphomonas → Hyphomonas sp. | 603 | Open in IMG/M |
| 3300017950|Ga0181607_10026472 | All Organisms → Viruses → Predicted Viral | 4264 | Open in IMG/M |
| 3300017950|Ga0181607_10280999 | Not Available | 943 | Open in IMG/M |
| 3300019751|Ga0194029_1002099 | All Organisms → Viruses → Predicted Viral | 2568 | Open in IMG/M |
| 3300020165|Ga0206125_10074875 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1517 | Open in IMG/M |
| 3300020165|Ga0206125_10244808 | Not Available | 684 | Open in IMG/M |
| 3300020173|Ga0181602_10084895 | All Organisms → Viruses → Predicted Viral | 1595 | Open in IMG/M |
| 3300020175|Ga0206124_10224996 | Not Available | 734 | Open in IMG/M |
| 3300020188|Ga0181605_10035070 | All Organisms → Viruses → Predicted Viral | 2986 | Open in IMG/M |
| 3300020238|Ga0211492_1060158 | unclassified Hyphomonas → Hyphomonas sp. | 694 | Open in IMG/M |
| 3300020385|Ga0211677_10001747 | Not Available | 16450 | Open in IMG/M |
| 3300020388|Ga0211678_10265608 | unclassified Hyphomonas → Hyphomonas sp. | 705 | Open in IMG/M |
| 3300020410|Ga0211699_10461252 | unclassified Hyphomonas → Hyphomonas sp. | 505 | Open in IMG/M |
| 3300020413|Ga0211516_10315944 | Not Available | 700 | Open in IMG/M |
| 3300020416|Ga0211644_10490289 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium TMED211 | 507 | Open in IMG/M |
| 3300020428|Ga0211521_10097268 | unclassified Hyphomonas → Hyphomonas sp. | 1426 | Open in IMG/M |
| 3300020469|Ga0211577_10025700 | All Organisms → Viruses → Predicted Viral | 4530 | Open in IMG/M |
| 3300020469|Ga0211577_10200524 | Not Available | 1314 | Open in IMG/M |
| 3300020474|Ga0211547_10551825 | unclassified Hyphomonas → Hyphomonas sp. | 574 | Open in IMG/M |
| 3300020478|Ga0211503_10003766 | Not Available | 12033 | Open in IMG/M |
| 3300021347|Ga0213862_10028748 | Not Available | 2046 | Open in IMG/M |
| 3300021347|Ga0213862_10161829 | Not Available | 787 | Open in IMG/M |
| 3300021365|Ga0206123_10076243 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1651 | Open in IMG/M |
| 3300021371|Ga0213863_10081158 | All Organisms → Viruses → Predicted Viral | 1591 | Open in IMG/M |
| 3300021373|Ga0213865_10211239 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 953 | Open in IMG/M |
| 3300021375|Ga0213869_10253515 | unclassified Hyphomonas → Hyphomonas sp. | 768 | Open in IMG/M |
| 3300021378|Ga0213861_10262236 | unclassified Hyphomonas → Hyphomonas sp. | 906 | Open in IMG/M |
| 3300021389|Ga0213868_10185070 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1260 | Open in IMG/M |
| 3300021389|Ga0213868_10208154 | All Organisms → Viruses | 1168 | Open in IMG/M |
| 3300021389|Ga0213868_10540681 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium TMED211 | 619 | Open in IMG/M |
| 3300021957|Ga0222717_10002393 | All Organisms → Viruses | 14568 | Open in IMG/M |
| 3300021957|Ga0222717_10004059 | Not Available | 10857 | Open in IMG/M |
| 3300021957|Ga0222717_10019032 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4623 | Open in IMG/M |
| 3300021957|Ga0222717_10028268 | All Organisms → Viruses → Predicted Viral | 3719 | Open in IMG/M |
| 3300021957|Ga0222717_10113450 | Not Available | 1684 | Open in IMG/M |
| 3300021957|Ga0222717_10292365 | unclassified Hyphomonas → Hyphomonas sp. | 932 | Open in IMG/M |
| 3300021958|Ga0222718_10006745 | All Organisms → Viruses | 9086 | Open in IMG/M |
| 3300021958|Ga0222718_10132308 | All Organisms → Viruses → Predicted Viral | 1429 | Open in IMG/M |
| 3300021958|Ga0222718_10262702 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 911 | Open in IMG/M |
| 3300021958|Ga0222718_10386080 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 703 | Open in IMG/M |
| 3300022053|Ga0212030_1034622 | All Organisms → Viruses | 707 | Open in IMG/M |
| 3300022061|Ga0212023_1025740 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 807 | Open in IMG/M |
| 3300022065|Ga0212024_1004286 | All Organisms → Viruses → Predicted Viral | 1840 | Open in IMG/M |
| 3300022068|Ga0212021_1004317 | All Organisms → Viruses | 2068 | Open in IMG/M |
| 3300022068|Ga0212021_1053981 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 817 | Open in IMG/M |
| 3300022072|Ga0196889_1025594 | All Organisms → Viruses → Predicted Viral | 1212 | Open in IMG/M |
| 3300022072|Ga0196889_1038437 | Not Available | 952 | Open in IMG/M |
| 3300022072|Ga0196889_1056782 | unclassified Hyphomonas → Hyphomonas sp. | 751 | Open in IMG/M |
| 3300022074|Ga0224906_1003793 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 6587 | Open in IMG/M |
| 3300022074|Ga0224906_1007366 | All Organisms → Viruses → Predicted Viral | 4465 | Open in IMG/M |
| 3300022074|Ga0224906_1145536 | Not Available | 671 | Open in IMG/M |
| 3300022074|Ga0224906_1186582 | unclassified Hyphomonas → Hyphomonas sp. | 571 | Open in IMG/M |
| 3300022164|Ga0212022_1003000 | All Organisms → Viruses → Predicted Viral | 2009 | Open in IMG/M |
| 3300022164|Ga0212022_1018698 | Not Available | 1027 | Open in IMG/M |
| 3300022178|Ga0196887_1003148 | All Organisms → Viruses | 6408 | Open in IMG/M |
| 3300022178|Ga0196887_1003708 | All Organisms → Viruses | 5777 | Open in IMG/M |
| 3300022187|Ga0196899_1038687 | All Organisms → Viruses | 1627 | Open in IMG/M |
| 3300022907|Ga0255775_1108867 | Not Available | 1198 | Open in IMG/M |
| (restricted) 3300022931|Ga0233433_10253101 | unclassified Hyphomonas → Hyphomonas sp. | 744 | Open in IMG/M |
| 3300024301|Ga0233451_10085157 | All Organisms → Viruses → Predicted Viral | 1636 | Open in IMG/M |
| 3300024344|Ga0209992_10051447 | Not Available | 1970 | Open in IMG/M |
| 3300024346|Ga0244775_10222922 | Not Available | 1577 | Open in IMG/M |
| 3300025045|Ga0207901_1036932 | unclassified Hyphomonas → Hyphomonas sp. | 657 | Open in IMG/M |
| 3300025048|Ga0207905_1000169 | Not Available | 18509 | Open in IMG/M |
| 3300025048|Ga0207905_1001757 | All Organisms → Viruses → Predicted Viral | 4579 | Open in IMG/M |
| 3300025048|Ga0207905_1008358 | Not Available | 1851 | Open in IMG/M |
| 3300025048|Ga0207905_1029495 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 893 | Open in IMG/M |
| 3300025070|Ga0208667_1004045 | All Organisms → Viruses → Predicted Viral | 4255 | Open in IMG/M |
| 3300025070|Ga0208667_1014179 | All Organisms → Viruses → Predicted Viral | 1709 | Open in IMG/M |
| 3300025070|Ga0208667_1050081 | unclassified Hyphomonas → Hyphomonas sp. | 678 | Open in IMG/M |
| 3300025070|Ga0208667_1073109 | unclassified Hyphomonas → Hyphomonas sp. | 514 | Open in IMG/M |
| 3300025071|Ga0207896_1003053 | All Organisms → Viruses | 3156 | Open in IMG/M |
| 3300025083|Ga0208791_1069635 | unclassified Hyphomonas → Hyphomonas sp. | 583 | Open in IMG/M |
| 3300025084|Ga0208298_1074557 | unclassified Hyphomonas → Hyphomonas sp. | 636 | Open in IMG/M |
| 3300025085|Ga0208792_1003526 | All Organisms → Viruses → Predicted Viral | 4264 | Open in IMG/M |
| 3300025086|Ga0208157_1012218 | All Organisms → Viruses → Predicted Viral | 2804 | Open in IMG/M |
| 3300025099|Ga0208669_1010234 | All Organisms → Viruses | 2640 | Open in IMG/M |
| 3300025099|Ga0208669_1012955 | All Organisms → Viruses → Predicted Viral | 2279 | Open in IMG/M |
| 3300025099|Ga0208669_1020132 | unclassified Hyphomonas → Hyphomonas sp. | 1726 | Open in IMG/M |
| 3300025101|Ga0208159_1016745 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1837 | Open in IMG/M |
| 3300025101|Ga0208159_1018931 | unclassified Hyphomonas → Hyphomonas sp. | 1690 | Open in IMG/M |
| 3300025102|Ga0208666_1070631 | All Organisms → Viruses | 921 | Open in IMG/M |
| 3300025103|Ga0208013_1005018 | Not Available | 4749 | Open in IMG/M |
| 3300025103|Ga0208013_1009275 | All Organisms → Viruses → Predicted Viral | 3217 | Open in IMG/M |
| 3300025103|Ga0208013_1086987 | unclassified Hyphomonas → Hyphomonas sp. | 801 | Open in IMG/M |
| 3300025108|Ga0208793_1091929 | All Organisms → Viruses | 861 | Open in IMG/M |
| 3300025108|Ga0208793_1106904 | Not Available | 778 | Open in IMG/M |
| 3300025108|Ga0208793_1185747 | Not Available | 529 | Open in IMG/M |
| 3300025110|Ga0208158_1023246 | unclassified Hyphomonas → Hyphomonas sp. | 1612 | Open in IMG/M |
| 3300025110|Ga0208158_1072002 | Not Available | 830 | Open in IMG/M |
| 3300025110|Ga0208158_1119308 | All Organisms → Viruses | 612 | Open in IMG/M |
| 3300025120|Ga0209535_1028179 | All Organisms → cellular organisms → Bacteria | 2697 | Open in IMG/M |
| 3300025120|Ga0209535_1045316 | Not Available | 1924 | Open in IMG/M |
| 3300025120|Ga0209535_1104594 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1004 | Open in IMG/M |
| 3300025120|Ga0209535_1117738 | Not Available | 911 | Open in IMG/M |
| 3300025128|Ga0208919_1040550 | All Organisms → Viruses → Predicted Viral | 1637 | Open in IMG/M |
| 3300025132|Ga0209232_1014684 | All Organisms → Viruses → Predicted Viral | 3148 | Open in IMG/M |
| 3300025132|Ga0209232_1046278 | All Organisms → Viruses → Predicted Viral | 1607 | Open in IMG/M |
| 3300025132|Ga0209232_1080169 | Not Available | 1132 | Open in IMG/M |
| 3300025132|Ga0209232_1118050 | unclassified Hyphomonas → Hyphomonas sp. | 878 | Open in IMG/M |
| 3300025133|Ga0208299_1206881 | unclassified Hyphomonas → Hyphomonas sp. | 578 | Open in IMG/M |
| 3300025137|Ga0209336_10048983 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1321 | Open in IMG/M |
| 3300025138|Ga0209634_1095227 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1331 | Open in IMG/M |
| 3300025141|Ga0209756_1297858 | unclassified Hyphomonas → Hyphomonas sp. | 570 | Open in IMG/M |
| 3300025151|Ga0209645_1060218 | Not Available | 1306 | Open in IMG/M |
| 3300025151|Ga0209645_1079348 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1094 | Open in IMG/M |
| 3300025151|Ga0209645_1182396 | Not Available | 630 | Open in IMG/M |
| 3300025151|Ga0209645_1197883 | unclassified Hyphomonas → Hyphomonas sp. | 595 | Open in IMG/M |
| 3300025621|Ga0209504_1078567 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 913 | Open in IMG/M |
| 3300025630|Ga0208004_1009730 | All Organisms → Viruses → Predicted Viral | 3254 | Open in IMG/M |
| 3300025641|Ga0209833_1053344 | Not Available | 1351 | Open in IMG/M |
| 3300025652|Ga0208134_1148608 | Not Available | 593 | Open in IMG/M |
| 3300025652|Ga0208134_1177574 | Not Available | 513 | Open in IMG/M |
| 3300025694|Ga0209406_1043454 | All Organisms → Viruses → Predicted Viral | 1738 | Open in IMG/M |
| 3300025694|Ga0209406_1083786 | Not Available | 1109 | Open in IMG/M |
| 3300025712|Ga0209305_1218606 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 552 | Open in IMG/M |
| 3300025759|Ga0208899_1005692 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 7567 | Open in IMG/M |
| 3300025769|Ga0208767_1027180 | All Organisms → Viruses → Predicted Viral | 3026 | Open in IMG/M |
| 3300025806|Ga0208545_1081109 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 885 | Open in IMG/M |
| 3300025810|Ga0208543_1097295 | unclassified Hyphomonas → Hyphomonas sp. | 703 | Open in IMG/M |
| 3300025816|Ga0209193_1051018 | unclassified Hyphomonas → Hyphomonas sp. | 1148 | Open in IMG/M |
| 3300025821|Ga0209600_1191466 | unclassified Hyphomonas → Hyphomonas sp. | 542 | Open in IMG/M |
| 3300025849|Ga0209603_1271741 | unclassified Hyphomonas → Hyphomonas sp. | 606 | Open in IMG/M |
| 3300025890|Ga0209631_10052570 | Not Available | 2641 | Open in IMG/M |
| 3300025892|Ga0209630_10389711 | unclassified Hyphomonas → Hyphomonas sp. | 606 | Open in IMG/M |
| 3300026183|Ga0209932_1034793 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1263 | Open in IMG/M |
| 3300027077|Ga0208941_1000736 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 7602 | Open in IMG/M |
| 3300027687|Ga0209710_1060767 | All Organisms → Viruses → Predicted Viral | 1654 | Open in IMG/M |
| 3300027779|Ga0209709_10064811 | Not Available | 2042 | Open in IMG/M |
| 3300027791|Ga0209830_10187632 | Not Available | 971 | Open in IMG/M |
| 3300027813|Ga0209090_10325564 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 756 | Open in IMG/M |
| 3300027827|Ga0209035_10104234 | All Organisms → Viruses → Predicted Viral | 1404 | Open in IMG/M |
| 3300027883|Ga0209713_10893939 | Not Available | 556 | Open in IMG/M |
| 3300027906|Ga0209404_10213611 | unclassified Hyphomonas → Hyphomonas sp. | 1202 | Open in IMG/M |
| 3300027906|Ga0209404_10385896 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 910 | Open in IMG/M |
| 3300028125|Ga0256368_1079185 | Not Available | 559 | Open in IMG/M |
| 3300029309|Ga0183683_1003061 | All Organisms → cellular organisms → Bacteria | 5924 | Open in IMG/M |
| 3300029448|Ga0183755_1088965 | Not Available | 636 | Open in IMG/M |
| 3300029448|Ga0183755_1108747 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 527 | Open in IMG/M |
| 3300029787|Ga0183757_1007902 | All Organisms → Viruses → Predicted Viral | 3257 | Open in IMG/M |
| 3300031519|Ga0307488_10062147 | All Organisms → Viruses | 2843 | Open in IMG/M |
| 3300031519|Ga0307488_10099375 | All Organisms → Viruses | 2126 | Open in IMG/M |
| 3300031519|Ga0307488_10268524 | All Organisms → Viruses → Predicted Viral | 1115 | Open in IMG/M |
| 3300031569|Ga0307489_10235756 | All Organisms → Viruses → Predicted Viral | 1153 | Open in IMG/M |
| 3300031637|Ga0302138_10126491 | All Organisms → Viruses | 898 | Open in IMG/M |
| 3300031659|Ga0307986_10146107 | Not Available | 1102 | Open in IMG/M |
| 3300031675|Ga0302122_10027000 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2808 | Open in IMG/M |
| 3300031774|Ga0315331_10039233 | All Organisms → Viruses | 3514 | Open in IMG/M |
| 3300031851|Ga0315320_10470938 | Not Available | 854 | Open in IMG/M |
| 3300032011|Ga0315316_10320995 | Not Available | 1299 | Open in IMG/M |
| 3300032032|Ga0315327_10333645 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 951 | Open in IMG/M |
| 3300032073|Ga0315315_10590431 | All Organisms → Viruses → Predicted Viral | 1025 | Open in IMG/M |
| 3300032073|Ga0315315_10989660 | Not Available | 755 | Open in IMG/M |
| 3300032088|Ga0315321_10158541 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1509 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 35.77% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 15.18% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 11.38% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 7.32% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 4.88% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 4.06% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 2.98% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 2.44% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 2.17% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 1.90% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 1.08% |
| Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 1.08% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 1.08% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.81% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.81% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 0.81% |
| Macroalgal Surface | Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface | 0.81% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.54% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.54% |
| Marine Water | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine Water | 0.54% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 0.54% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.27% |
| Marine Water | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Water | 0.27% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Seawater | 0.27% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 0.27% |
| Marine Surface Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine Surface Water | 0.27% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.27% |
| Sea-Ice Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine | 0.27% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.27% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.27% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.27% |
| Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 0.27% |
| Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water | 0.27% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
| 3300000115 | Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011 | Environmental | Open in IMG/M |
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
| 3300000947 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY92 | Host-Associated | Open in IMG/M |
| 3300000949 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY94 | Host-Associated | Open in IMG/M |
| 3300000973 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY93 | Host-Associated | Open in IMG/M |
| 3300001450 | Marine viral communities from the Pacific Ocean - LP-53 | Environmental | Open in IMG/M |
| 3300001460 | Marine viral communities from the Pacific Ocean - LP-28 | Environmental | Open in IMG/M |
| 3300001472 | Marine viral communities from the Pacific Ocean - LP-32 | Environmental | Open in IMG/M |
| 3300001589 | Marine viral communities from the Pacific Ocean - LP-40 | Environmental | Open in IMG/M |
| 3300001720 | Marine viral communities from the Pacific Ocean - LP-36 | Environmental | Open in IMG/M |
| 3300001853 | Marine viral communities from the Subarctic Pacific Ocean - LP-49 | Environmental | Open in IMG/M |
| 3300001967 | Marine microbial communities from Devil's Crown, Floreana Island, Equador - GS027 | Environmental | Open in IMG/M |
| 3300002483 | Marine viral communities from the Pacific Ocean - ETNP_6_30 | Environmental | Open in IMG/M |
| 3300002488 | Marine viral communities from the Pacific Ocean - ETNP_2_60 | Environmental | Open in IMG/M |
| 3300003894 | Marine microbial communities from the northern Gulf of Mexico hypoxic zone - Cultivation independent assessment | Environmental | Open in IMG/M |
| 3300004029 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Bullhead_CordB_D2 | Environmental | Open in IMG/M |
| 3300004097 | Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaG | Environmental | Open in IMG/M |
| 3300004448 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
| 3300004457 | Marine viral communities from Newfoundland, Canada MC-1 | Environmental | Open in IMG/M |
| 3300004829 | Marine water microbial communities from the Pohang Bay, Korea with extracellular vesicles - Pohang-EVs | Environmental | Open in IMG/M |
| 3300005057 | Marine water microbial communities from the East Sea, Korea with extracellular vesicles - East-Sea-0.2um | Environmental | Open in IMG/M |
| 3300005514 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F12-01SV263 | Environmental | Open in IMG/M |
| 3300005522 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F10-02SV257 | Environmental | Open in IMG/M |
| 3300005837 | Exploring phylogenetic diversity in Port Hacking ocean in Sydney, Australia - Port Hacking PH4 TJ4-TJ18 | Environmental | Open in IMG/M |
| 3300006025 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006026 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006027 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006029 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
| 3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
| 3300006736 | Marine viral communities from the Subarctic Pacific Ocean - 1_ETSP_OMZ_AT15124 metaG | Environmental | Open in IMG/M |
| 3300006737 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG | Environmental | Open in IMG/M |
| 3300006749 | Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006789 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG | Environmental | Open in IMG/M |
| 3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300006921 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG | Environmental | Open in IMG/M |
| 3300006922 | Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG | Environmental | Open in IMG/M |
| 3300006924 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG | Environmental | Open in IMG/M |
| 3300006928 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG | Environmental | Open in IMG/M |
| 3300006929 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG | Environmental | Open in IMG/M |
| 3300006947 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNA | Environmental | Open in IMG/M |
| 3300007276 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 | Environmental | Open in IMG/M |
| 3300007345 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007640 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 | Environmental | Open in IMG/M |
| 3300007725 | Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_B_H2O_MG | Environmental | Open in IMG/M |
| 3300007963 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (version 2) | Environmental | Open in IMG/M |
| 3300007973 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um | Environmental | Open in IMG/M |
| 3300007992 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461AB_0.2um | Environmental | Open in IMG/M |
| 3300008050 | Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaG | Environmental | Open in IMG/M |
| 3300009001 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG | Environmental | Open in IMG/M |
| 3300009080 | Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.759 | Environmental | Open in IMG/M |
| 3300009172 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 | Environmental | Open in IMG/M |
| 3300009420 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 | Environmental | Open in IMG/M |
| 3300009433 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 | Environmental | Open in IMG/M |
| 3300009435 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413 | Environmental | Open in IMG/M |
| 3300009472 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110404 | Environmental | Open in IMG/M |
| 3300009498 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120426 | Environmental | Open in IMG/M |
| 3300009507 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 | Environmental | Open in IMG/M |
| 3300009512 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 | Environmental | Open in IMG/M |
| 3300009593 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome | Environmental | Open in IMG/M |
| 3300009677 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_70_C50_10m_0.8um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009705 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128 | Environmental | Open in IMG/M |
| 3300010150 | Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaG | Environmental | Open in IMG/M |
| 3300010153 | Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaG | Environmental | Open in IMG/M |
| 3300011129 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_4, 0.02 | Environmental | Open in IMG/M |
| 3300011252 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_4, permeate | Environmental | Open in IMG/M |
| 3300011258 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_1, permeate | Environmental | Open in IMG/M |
| 3300012919 | Marine microbial communities from the Central Pacific Ocean - Fk160115 60m metaG | Environmental | Open in IMG/M |
| 3300017697 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2) | Environmental | Open in IMG/M |
| 3300017708 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_04 viral metaG | Environmental | Open in IMG/M |
| 3300017709 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 10 SPOT_SRF_2010-04-27 | Environmental | Open in IMG/M |
| 3300017713 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 | Environmental | Open in IMG/M |
| 3300017714 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15 | Environmental | Open in IMG/M |
| 3300017719 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 | Environmental | Open in IMG/M |
| 3300017720 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 | Environmental | Open in IMG/M |
| 3300017724 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 11 SPOT_SRF_2010-05-17 | Environmental | Open in IMG/M |
| 3300017727 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 24 SPOT_SRF_2011-07-20 | Environmental | Open in IMG/M |
| 3300017728 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 42 SPOT_SRF_2013-04-24 | Environmental | Open in IMG/M |
| 3300017730 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 40 SPOT_SRF_2013-02-13 | Environmental | Open in IMG/M |
| 3300017732 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 38 SPOT_SRF_2012-12-11 | Environmental | Open in IMG/M |
| 3300017737 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 (version 2) | Environmental | Open in IMG/M |
| 3300017738 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 51 SPOT_SRF_2014-02-12 | Environmental | Open in IMG/M |
| 3300017739 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 | Environmental | Open in IMG/M |
| 3300017740 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 41 SPOT_SRF_2013-03-13 | Environmental | Open in IMG/M |
| 3300017742 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 22 SPOT_SRF_2011-05-21 | Environmental | Open in IMG/M |
| 3300017744 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 20 SPOT_SRF_2011-02-23 | Environmental | Open in IMG/M |
| 3300017746 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 12 SPOT_SRF_2010-06-29 | Environmental | Open in IMG/M |
| 3300017748 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 16 SPOT_SRF_2010-10-21 | Environmental | Open in IMG/M |
| 3300017749 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 | Environmental | Open in IMG/M |
| 3300017750 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 28 SPOT_SRF_2011-11-29 | Environmental | Open in IMG/M |
| 3300017751 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 (version 2) | Environmental | Open in IMG/M |
| 3300017752 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 23 SPOT_SRF_2011-06-22 | Environmental | Open in IMG/M |
| 3300017756 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 | Environmental | Open in IMG/M |
| 3300017758 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 32 SPOT_SRF_2012-05-30 | Environmental | Open in IMG/M |
| 3300017759 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 37 SPOT_SRF_2012-11-28 | Environmental | Open in IMG/M |
| 3300017760 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 31 SPOT_SRF_2012-02-16 | Environmental | Open in IMG/M |
| 3300017762 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 45 SPOT_SRF_2013-07-18 | Environmental | Open in IMG/M |
| 3300017763 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 33 SPOT_SRF_2012-06-20 | Environmental | Open in IMG/M |
| 3300017764 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 8 SPOT_SRF_2010-02-11 | Environmental | Open in IMG/M |
| 3300017768 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 (version 2) | Environmental | Open in IMG/M |
| 3300017770 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 (version 2) | Environmental | Open in IMG/M |
| 3300017771 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 48 SPOT_SRF_2013-11-13 | Environmental | Open in IMG/M |
| 3300017773 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 9 SPOT_SRF_2010-03-24 | Environmental | Open in IMG/M |
| 3300017775 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 55 SPOT_SRF_2014-07-17 | Environmental | Open in IMG/M |
| 3300017786 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18 | Environmental | Open in IMG/M |
| 3300017824 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017950 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019751 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW18Oct16_MG | Environmental | Open in IMG/M |
| 3300020165 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160331_1 | Environmental | Open in IMG/M |
| 3300020173 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041408US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020175 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160321_2 | Environmental | Open in IMG/M |
| 3300020188 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041411US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020238 | Marine microbial communities from Tara Oceans - TARA_B000000475 (ERX556004-ERR599068) | Environmental | Open in IMG/M |
| 3300020385 | Marine microbial communities from Tara Oceans - TARA_B100001059 (ERX556045-ERR598965) | Environmental | Open in IMG/M |
| 3300020388 | Marine microbial communities from Tara Oceans - TARA_B100001063 (ERX555965-ERR599064) | Environmental | Open in IMG/M |
| 3300020410 | Marine microbial communities from Tara Oceans - TARA_B100000519 (ERX555959-ERR599148) | Environmental | Open in IMG/M |
| 3300020413 | Marine microbial communities from Tara Oceans - TARA_S200000501 (ERX555962-ERR599092) | Environmental | Open in IMG/M |
| 3300020416 | Marine microbial communities from Tara Oceans - TARA_B100001109 (ERX556137-ERR599039) | Environmental | Open in IMG/M |
| 3300020428 | Marine microbial communities from Tara Oceans - TARA_E500000331 (ERX556032-ERR599094) | Environmental | Open in IMG/M |
| 3300020469 | Marine microbial communities from Tara Oceans - TARA_B100001093 (ERX555967-ERR599052) | Environmental | Open in IMG/M |
| 3300020474 | Marine prokaryotic communities collected during Tara Oceans survey from station TARA_151 - TARA_B100001564 (ERX555957-ERR598976) | Environmental | Open in IMG/M |
| 3300020478 | Marine microbial communities from Tara Oceans - TARA_B100000029 (ERX556025-ERR599111) | Environmental | Open in IMG/M |
| 3300021347 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO266 | Environmental | Open in IMG/M |
| 3300021365 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160316_1 | Environmental | Open in IMG/M |
| 3300021371 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO497 | Environmental | Open in IMG/M |
| 3300021373 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO282 | Environmental | Open in IMG/M |
| 3300021375 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO132 | Environmental | Open in IMG/M |
| 3300021378 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO131 | Environmental | Open in IMG/M |
| 3300021389 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO127 | Environmental | Open in IMG/M |
| 3300021957 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18D | Environmental | Open in IMG/M |
| 3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
| 3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
| 3300022053 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v2) | Environmental | Open in IMG/M |
| 3300022061 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v2) | Environmental | Open in IMG/M |
| 3300022065 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v2) | Environmental | Open in IMG/M |
| 3300022068 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (v2) | Environmental | Open in IMG/M |
| 3300022072 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v3) | Environmental | Open in IMG/M |
| 3300022074 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2) | Environmental | Open in IMG/M |
| 3300022164 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v2) | Environmental | Open in IMG/M |
| 3300022178 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v3) | Environmental | Open in IMG/M |
| 3300022187 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3) | Environmental | Open in IMG/M |
| 3300022907 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011511BT metaG | Environmental | Open in IMG/M |
| 3300022931 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_100_MG | Environmental | Open in IMG/M |
| 3300024301 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011504CT (spades assembly) | Environmental | Open in IMG/M |
| 3300024344 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300025045 | Marine viral communities from the Pacific Ocean - LP-46 (SPAdes) | Environmental | Open in IMG/M |
| 3300025048 | Marine viral communities from the Subarctic Pacific Ocean - LP-49 (SPAdes) | Environmental | Open in IMG/M |
| 3300025070 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025071 | Marine viral communities from the Pacific Ocean - LP-36 (SPAdes) | Environmental | Open in IMG/M |
| 3300025083 | Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025084 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025085 | Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025086 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025099 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025101 | Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025102 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025103 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025108 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025110 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025120 | Marine viral communities from the Pacific Ocean - LP-28 (SPAdes) | Environmental | Open in IMG/M |
| 3300025128 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025132 | Marine viral communities from the Pacific Ocean - ETNP_2_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300025133 | Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025137 | Marine viral communities from the Pacific Ocean - LP-32 (SPAdes) | Environmental | Open in IMG/M |
| 3300025138 | Marine viral communities from the Pacific Ocean - LP-40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025141 | Marine viral communities from the Pacific Ocean - ETNP_6_85 (SPAdes) | Environmental | Open in IMG/M |
| 3300025151 | Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025621 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100511 (SPAdes) | Environmental | Open in IMG/M |
| 3300025630 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025641 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110506 (SPAdes) | Environmental | Open in IMG/M |
| 3300025652 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (SPAdes) | Environmental | Open in IMG/M |
| 3300025694 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120426 (SPAdes) | Environmental | Open in IMG/M |
| 3300025712 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110321 (SPAdes) | Environmental | Open in IMG/M |
| 3300025759 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes) | Environmental | Open in IMG/M |
| 3300025769 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes) | Environmental | Open in IMG/M |
| 3300025806 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025816 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 (SPAdes) | Environmental | Open in IMG/M |
| 3300025821 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110421 (SPAdes) | Environmental | Open in IMG/M |
| 3300025849 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 (SPAdes) | Environmental | Open in IMG/M |
| 3300025890 | Pelagic Microbial community sample from North Sea - COGITO 998_met_08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025892 | Pelagic Microbial community sample from North Sea - COGITO 998_met_01 (SPAdes) | Environmental | Open in IMG/M |
| 3300026183 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300027077 | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - C0912_C27A4_35 (SPAdes) | Environmental | Open in IMG/M |
| 3300027687 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300027779 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300027791 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300027813 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300027827 | Marine microbial communities from the Southern Atlantic Ocean, analyzing organic carbon cycling - AAIW_A/KNORR_S2/LV (SPAdes) | Environmental | Open in IMG/M |
| 3300027883 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean- Svalbard ARC20M Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300027906 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300028125 | Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - SB | Environmental | Open in IMG/M |
| 3300029309 | Marine viral communities collected during Tara Oceans survey from station TARA_100 - TARA_R100001440 | Environmental | Open in IMG/M |
| 3300029448 | Marine viral communities collected during Tara Oceans survey from station TARA_023 - TARA_E500000082 | Environmental | Open in IMG/M |
| 3300029787 | Marine viral communities collected during Tara Oceans survey from station TARA_018 - TARA_A100000172 | Environmental | Open in IMG/M |
| 3300031519 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2 | Environmental | Open in IMG/M |
| 3300031569 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 1.2 | Environmental | Open in IMG/M |
| 3300031637 | Marine microbial communities from Western Arctic Ocean, Canada - CBN3_32.1 | Environmental | Open in IMG/M |
| 3300031659 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #82 | Environmental | Open in IMG/M |
| 3300031675 | Marine microbial communities from Western Arctic Ocean, Canada - CB21_SCM | Environmental | Open in IMG/M |
| 3300031774 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 34915 | Environmental | Open in IMG/M |
| 3300031851 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 21515 | Environmental | Open in IMG/M |
| 3300032011 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 3416 | Environmental | Open in IMG/M |
| 3300032032 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 32315 | Environmental | Open in IMG/M |
| 3300032073 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 3416 | Environmental | Open in IMG/M |
| 3300032088 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 21515 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2010_100084584 | 3300000101 | Marine | MLKELLEKKVNSMINTNDLTDMQVWGVMGLIGFISAFIVMWII* |
| DelMOSum2010_100511533 | 3300000101 | Marine | MLKELLEKKVNSLINTNDLTDMQVWGVMCAIGFISALIIMWII* |
| DelMOSum2010_100623833 | 3300000101 | Marine | MLKELLEKXVNSIXDANELTDMQVWGCWCGIGFVSACIVMWII* |
| DelMOSum2010_100682404 | 3300000101 | Marine | MLKELLEKRVNSIIDANELTDMQVWGCWCGIGFVCALIVMWII* |
| DelMOSum2010_100872232 | 3300000101 | Marine | MLKELLEKQVNXIIDANELTDMQVWGCWCGIGFVCALIVMWII* |
| DelMOSum2010_100915033 | 3300000101 | Marine | MLKELLEKKVNSIIETNDLTDMQVWGVMCAIGFISAFIVMWII* |
| DelMOSum2010_100942862 | 3300000101 | Marine | MLKELLEKKVNSIINTNDLTDMQVWGVMCGIGFISAFIVMWII* |
| DelMOSum2010_101166561 | 3300000101 | Marine | MLKELLEKKVNSMINTNDLTDMQVWGVMCGIGFISAFIIMWII* |
| DelMOSum2010_101199393 | 3300000101 | Marine | MLKELLEKQVNSIIDANELTDMQVWGCWCGIGFICALIVMWII* |
| DelMOSum2010_101914903 | 3300000101 | Marine | MLKELVEKKVNSLINTNELTDMQVWGVMCSIGFISAFIIMWII* |
| DelMOSum2010_102234244 | 3300000101 | Marine | MLNLLKEQLEKRVNSIINTNDLTDMQVWGVMCSIG |
| DelMOSum2010_102394422 | 3300000101 | Marine | MLKELLEKKVNSIIETNDLTDMQVWGVMCGIGFISAFIIMWII* |
| DelMOSum2011_100418193 | 3300000115 | Marine | MLKELLEKKVNSIIETNDLTDMQVWGVWCGIGFISAFIIMWII* |
| DelMOSum2011_100483543 | 3300000115 | Marine | MKDKIEKKINSIINTNDLTDMQVWGIWYGIGFISAFVIMWII* |
| DelMOSum2011_100759041 | 3300000115 | Marine | MLKELLEKKVNSLINTNELTDMQVWGVMCGIGFISAFI |
| DelMOSum2011_100801141 | 3300000115 | Marine | MLKELLEKKVNSLINTNELTDMQVWGVMCGIGFILALIIMWII* |
| DelMOSum2011_101171401 | 3300000115 | Marine | MLKELLEKKVNSXINTNDLTDMQVWGVMCGIGFISAFIVMWII* |
| DelMOSum2011_101952682 | 3300000115 | Marine | MLKELLEKKVNSIINTNDLTDMQVWGVMCGIGFISAFIIMWII* |
| DelMOSpr2010_100158347 | 3300000116 | Marine | MLKELLEKKVNSIVDANELTDMQVWGCWCGIGFVSACIVMWII* |
| DelMOSpr2010_100194563 | 3300000116 | Marine | KLMLKELLEKQVNSIIDANELTDMQVWGCWCSIGFVCALIVMWII* |
| DelMOSpr2010_100598483 | 3300000116 | Marine | MLKELLEKQVNSIIDANELTDMQVWGCWCSIGFVCALIVMWII* |
| DelMOSpr2010_100845133 | 3300000116 | Marine | MLKELLEKKVNSIIETNDLTDMQVWGVWCGIGFISAFIVMWII* |
| DelMOSpr2010_101391281 | 3300000116 | Marine | MLKELLEKQVNSIIDANELTDMQVWGCWCGIGFICALIVIWII* |
| DelMOSpr2010_101863891 | 3300000116 | Marine | VNSIIDANELTDMQVWGCWCGIGFVCALIVMWII* |
| DelMOSpr2010_102032552 | 3300000116 | Marine | MLKELLEKKINSMINTNDLTDMQVWGVMGLIGFISAFIVMWII* |
| DelMOWin2010_100119204 | 3300000117 | Marine | MLKELLEKQVNNIIDANELTDMQVWGCWCGIGFVCALIVMWII* |
| DelMOWin2010_100349063 | 3300000117 | Marine | MLNLLKEQLEKRVNSIINTNDLTDMQVWGIWCGIGFISAFIIMWII* |
| BBAY92_101088671 | 3300000947 | Macroalgal Surface | VNSMIETNDLTDMQVWGVMCGIGFISAIIIMWII* |
| BBAY94_101101342 | 3300000949 | Macroalgal Surface | KQMLKELLEKKVNSIINTNDLTDMQVWGIWCGIGFISAFIIMWII* |
| BBAY93_100908483 | 3300000973 | Macroalgal Surface | PRGKQMLKELLEKRVNSMIETNDLTDMQVWGVMCGIGFISAIIIMWII* |
| JGI24006J15134_100490855 | 3300001450 | Marine | MLKELLEKKVNSMINTNDLTDMQVWGVMCAIGFISAFIVMWXI* |
| JGI24006J15134_100601581 | 3300001450 | Marine | KQVNSIIDANELTDMQVWGCWCGIGFICALIVTWII* |
| JGI24006J15134_100630021 | 3300001450 | Marine | KQQRGKLMLKELLEKQVNSIIDANELTDMQVWGCWCGIGFVCALIVMWII* |
| JGI24006J15134_101717741 | 3300001450 | Marine | LKELLEKQVNSIIDANELTDMQVWGCWCGIGFICALIVIWII* |
| JGI24006J15134_102119872 | 3300001450 | Marine | MLKELLEKKVNSIIEANELTDMEVWGCWCGVGFVCALIVMWII* |
| JGI24003J15210_1000184219 | 3300001460 | Marine | MLKELLEKQVNSIIDANELTDMQVWGCWCGIGFVCALIVIWII* |
| JGI24003J15210_100061067 | 3300001460 | Marine | MLKELLEKKVNSMINTNDLTDMQVWGVMCSIGFISAFIVMWII* |
| JGI24003J15210_100393271 | 3300001460 | Marine | RRGNQMLKELLEKKVNSMINTNDLTDMQVWGVMCGIGFISAFIVMWII* |
| JGI24003J15210_100492243 | 3300001460 | Marine | MLKELLEKKINSMINTNDLTDMXVWGVMGLIGFISAFIVMWII* |
| JGI24003J15210_101208204 | 3300001460 | Marine | MLKELLEKKVNSMINANDLTDMQVWGVMCGIGFISAFIVMWII* |
| JGI24003J15210_101596942 | 3300001460 | Marine | MLNLLKEQLEKLVNSIINTNDLTDMQVWGVMGLIGFISAFIVMWII* |
| JGI24004J15324_100344791 | 3300001472 | Marine | KQVNSIIDANELTDMQVWGCWCGIGFVCALIVMWII* |
| JGI24004J15324_100662573 | 3300001472 | Marine | NQMLKELLEKKVNSMINTNDLTDMQVWGVMCGIGFISAFIVMWII* |
| JGI24005J15628_100170763 | 3300001589 | Marine | KQVNSIIDANELTDMQVWGCWCGIGFICALIVMWII* |
| JGI24005J15628_100510111 | 3300001589 | Marine | GKLMLKELLEKQVNSIIDANELTDMQVWGCWCGIGFVCALIVMWII* |
| JGI24005J15628_101034861 | 3300001589 | Marine | LEKQVNSIIDANELTDMQVWGCWCGIGFVCALIVIWII* |
| JGI24513J20088_10010003 | 3300001720 | Marine | MLKELLEKQVNSIIXANELTDMQVWGCWCGIGFVCALIVMWII* |
| JGI24524J20080_10011233 | 3300001853 | Marine | MLKELLEKKVNSMINTNDLTDMQVWGVMGLIGFISAFIIMWII* |
| JGI24524J20080_10060013 | 3300001853 | Marine | LEKQVNSIIDANELTDMQVWGCWCGIGFICALIVMWII* |
| JGI24524J20080_10216612 | 3300001853 | Marine | MLKELLEKKVNSIIEANELTDMEVWGCWCGVGFVCALIVTWII* |
| GOS2242_10048695 | 3300001967 | Marine | LRGKQMLKELLEKKVNSLINTNELTDMQVWGVMCGIGFILALIIMWII* |
| JGI25132J35274_10449252 | 3300002483 | Marine | MLKELLEKKVNSMIETNDLTDMQVWGVMCGVGFISAFIIMWVI* |
| JGI25132J35274_10572503 | 3300002483 | Marine | MLKELLEKRVNSIIETNDLTDMQVWGVMCGIGFISAFIIMWII* |
| JGI25128J35275_10023271 | 3300002488 | Marine | MLKELLEKKVNSLINTNELTDMQVWGIMCGIGFISAFIIMWII* |
| Ga0063241_10093876 | 3300003894 | Marine | MLKELLEKRVNSIIETNDLTDMQVWGIWCGIGFVSAFILMWVV* |
| Ga0055442_103175291 | 3300004029 | Natural And Restored Wetlands | MLKELLEKRVNSIIETNDLTDMQVWGVWCGIGFISAFIVMWII* |
| Ga0055584_1021299482 | 3300004097 | Pelagic Marine | MLKELLEKKVNSMINTNDLTDMQVWGVMCGIGFISAFIVMWII* |
| Ga0065861_11213982 | 3300004448 | Marine | MLKELLEKQVNSIIDANELTDMQVWGCWCGIGFVCALIVMWII* |
| Ga0066224_10546953 | 3300004457 | Marine | LKELLEKKVNSIIDANELTDMQVWGCWCGIGFISACIVIWII* |
| Ga0068515_1011403 | 3300004829 | Marine Water | MLKELLEKRVNSIIETNDLTDMQVWGIWCGIGFISALIILWII* |
| Ga0068515_1115522 | 3300004829 | Marine Water | MLKELLEKRVNSIIETNDLTDMQVWGVWCGIGFISAFIIMWII* |
| Ga0068511_10488413 | 3300005057 | Marine Water | KQMLKELLEKKVNSLINTNELTDMQVWGVMCSIGFISAFIIMWII* |
| Ga0066866_100810744 | 3300005514 | Marine | MLKELLEKRVNSIIETNDLTDMQIWGIWCGIGFISAFIVMWII* |
| Ga0066861_102085934 | 3300005522 | Marine | MLKELLEKRVNSIIETNDLTDMQVWGMWCGIGFISA |
| Ga0078893_102798384 | 3300005837 | Marine Surface Water | MLKELLEKKVNSMIETNDLTDMQVWGVMCGVGFISAFIIMWII* |
| Ga0075474_100033288 | 3300006025 | Aqueous | MLKELLEKKVNSLINTNELTDMQVWGVMCGIGFISAFIIMWII* |
| Ga0075478_100558253 | 3300006026 | Aqueous | MLKELLEKRVNSIIETNDLTDMQVWGIWCGIGFISALIVLWII* |
| Ga0075478_101419511 | 3300006026 | Aqueous | QRNKQRRGKQMLNLLKEQLEKRVNSIINTNDLTDMQVWGVMCSIGFISAFIIMWII* |
| Ga0075462_100809153 | 3300006027 | Aqueous | MLNLLKEQLEKRVNSIINTNDLTDMQVWGVMCSIGFISAFIIMWII* |
| Ga0075466_10164677 | 3300006029 | Aqueous | MLKELLEKQVNSIIDANELTDMQVWGCCCFIGFISACIVMWII* |
| Ga0075466_10478915 | 3300006029 | Aqueous | MLKELLEKKVNSLINTNELTDMQVWGVMCGIGFISAFIVMWII* |
| Ga0075466_10659042 | 3300006029 | Aqueous | MLKELLEKKVNSIINTNDLTDMQVWGIWCGIGFISAFIIMWII* |
| Ga0075466_10758151 | 3300006029 | Aqueous | MLKELLEKKVNSMINTNDLTDMQVWGIMCGIGFISAFIVMWII* |
| Ga0075466_10818941 | 3300006029 | Aqueous | MLKELLEKKVNSIINTNDLTDMQVWGVMCSIGFISAFIIMWII* |
| Ga0070744_100247813 | 3300006484 | Estuarine | MLKELLEKQVNSIIDANELTDMQVWGCWCGIGFICALIVMWLI* |
| Ga0070744_101613672 | 3300006484 | Estuarine | MLKELLEKKVNSMINTNDLTDMQVWGVMCAIGFISAFIVMWAI* |
| Ga0098038_10068268 | 3300006735 | Marine | MLKELLEKKVNSLINTNELTDMQVWSVMCGIGFISAFIIMWII* |
| Ga0098038_10300554 | 3300006735 | Marine | MLKELLEKKVNSMIETNDLTDMQVWGVMCGIGFVSAFIIMWVV* |
| Ga0098038_10850963 | 3300006735 | Marine | MLKEILEKKVNSLINTNELTDMQVWGVMCGIGFILALIIMWII* |
| Ga0098038_12238222 | 3300006735 | Marine | MLKELLEKRVNSLINTNELTDMQVWGVMCGIGFILALIIMWII* |
| Ga0098033_11444363 | 3300006736 | Marine | MLKELLEKRVNSIIETNDLTDMQVWGIWCGIGFISAFIVMWIV* |
| Ga0098037_10418633 | 3300006737 | Marine | MKDKIEKKINSIIETNDLTDMQVWGVWCGIGFISAFIIMWIV* |
| Ga0098037_10517942 | 3300006737 | Marine | MLKELLEKKVNSMIETNDLTDMQVWGVMCAIGFISALIIIWII* |
| Ga0098037_10646233 | 3300006737 | Marine | MKDKIEKKINSMINTNDLTDMQVWGIMCGIGFISACIIMWII* |
| Ga0098037_10687383 | 3300006737 | Marine | MLKELLEKKVNSLINTSELTDMQVWGIWCGVGFILALIIMWII* |
| Ga0098037_12704682 | 3300006737 | Marine | MKDKIEKKINSMIETNDLTDMQVWGVWCGIGFILAFIIMWII* |
| Ga0098042_10182823 | 3300006749 | Marine | MLKELVEKKVNSLINTNELTDMQVWGVMCGIGFISAFIIMWII* |
| Ga0098048_10274123 | 3300006752 | Marine | MKDKIEKKINSIIETNDLTDMQVWGAWCGIGFISAFIIMWIV* |
| Ga0098048_10439835 | 3300006752 | Marine | MKDKIEKTINSMIETNDLTDMQVWGVWCGIGFILAFIIMWII* |
| Ga0098048_10773123 | 3300006752 | Marine | MLKEQLEKRINSIIETNDLTDLQVWGVICGIGFISSFIIMWII* |
| Ga0098048_11134781 | 3300006752 | Marine | IGKQMLKDLLEKRVNSMIETNDLTDMQVWGMWCGIGFISAFIVMWII* |
| Ga0098054_100449614 | 3300006789 | Marine | MLKELLEKKVNSLINTNELTDMQVWGVMCSIGFISAFIIMWII* |
| Ga0098054_10495733 | 3300006789 | Marine | MLKEQLEKRLNSIIETNDLTDLQVWGSCFGIGFISAFILMWII* |
| Ga0098054_11209281 | 3300006789 | Marine | KRVNSIIETNDLTDMQVWGIWCGIGFISAFIVMWIV* |
| Ga0098054_11303333 | 3300006789 | Marine | MLKELLEKRVNSIINTNDLTDMQVWGVMCGIGFISAFIIMWII* |
| Ga0098054_11477332 | 3300006789 | Marine | MLKELLEKKVNSMINTNDLTDMQVWGVMCGIGFISAFIIMWIV* |
| Ga0098054_13037672 | 3300006789 | Marine | MLKELLEKRVNSIIETNDLTDMQVWGMWCGIGFISAFIVMWII* |
| Ga0098055_12313032 | 3300006793 | Marine | MLKELLEKRVNSIINTNDLTDMQVWGVMCGIGFISALIIMWIV* |
| Ga0098055_14089181 | 3300006793 | Marine | RVNSIIETNDLTDMQVWGMWCGIGFISAFIVMWII* |
| Ga0070749_102057671 | 3300006802 | Aqueous | RGKQMLKELLEKKVNSLINTNELTDMQVWGVMCAIGFISALIIMWII* |
| Ga0070754_100552507 | 3300006810 | Aqueous | MLKELLEKQVNSIIDANELTDMQVWGCWLGTGFICALIVMWVI* |
| Ga0070754_101795033 | 3300006810 | Aqueous | MLKELLEKKVNSIIETNDLTDMQVWGVWCGIGFIPAFIVMWII* |
| Ga0070750_100180378 | 3300006916 | Aqueous | MKDRIEKRINNIIETNDLTDMQVWSVWCGIGFISAFIIMWII* |
| Ga0070750_103456843 | 3300006916 | Aqueous | MLKELLEKKVNSIIETNDLTDMQVWGVWCGIGFISAFIIMWVV* |
| Ga0070746_102906861 | 3300006919 | Aqueous | KELLEKQVNSIIDANELTDMQVWGCWCGIGFVCALIVMWII* |
| Ga0070746_105020431 | 3300006919 | Aqueous | KQQRGKLMLKELLEKQVNSIIDANELTDMQVWGCWCSIGFVCALIVMWII* |
| Ga0070748_11454281 | 3300006920 | Aqueous | RGKQMLKELLEKKVNSIIETNELTDMQVWGVWCGIGFISAFIIMWVV* |
| Ga0098060_10215183 | 3300006921 | Marine | MLKELLEKKINSIIETNDLTDMQVWGMWCGIGFISAFIIMWII* |
| Ga0098060_10497292 | 3300006921 | Marine | MLKELLEKKVNSMIETNDLTDMQVWGVMCGIGFISALIIIWII* |
| Ga0098060_12180903 | 3300006921 | Marine | MLKELLEKRVNSIINTNDLTDMQVWGVMCGIGVILTLIIIWII* |
| Ga0098060_12316701 | 3300006921 | Marine | NKRNKTMKDKIEKKINSIIEINDLTDMQVWGIWCGIGFVCAFVIMWII* |
| Ga0098045_11348251 | 3300006922 | Marine | MLKELLEKKVNSLINTSELTDMQVWGIWCGVGFILALIIMWI |
| Ga0098051_10603713 | 3300006924 | Marine | NKTMKDKIEKKINSIINTNDLTDMQVWGIWYGIGFISAFVIMWII* |
| Ga0098051_11046371 | 3300006924 | Marine | MLKELLEKKVNSMINTNDLTDMQVWGVMCGIGFILALIIMWII* |
| Ga0098041_10750641 | 3300006928 | Marine | QMLKELLEKRVNSLINTNELTDMQVWGVMCGIGFILALIIMWII* |
| Ga0098041_11071001 | 3300006928 | Marine | RNKQRGKQMLKELLEKKVNSIIETNDLTDMQVWGVWCGIGFISAFIIMWIV* |
| Ga0098041_12748092 | 3300006928 | Marine | MLKELLEKKVNSLINTNELTDMQVWGIWCGVGFILALIIMWII* |
| Ga0098036_12826932 | 3300006929 | Marine | MLKELLEKKVNSMINTNELTDIQVWGVMCGIGFISAFIIMWII* |
| Ga0075444_102705082 | 3300006947 | Marine | MLKELLEKKVNSIIDANELTDMQVWGYWLVTGFICALIVMWII* |
| Ga0070747_11401391 | 3300007276 | Aqueous | LMLKELLEKQVNSIIDANELTDMQVWGCWCGIGFISACIVMWII* |
| Ga0070747_11992123 | 3300007276 | Aqueous | MLKELLEKQVNRIIDANELTDMQVWGCWCGIGFVCALIVMWLI* |
| Ga0070752_11859181 | 3300007345 | Aqueous | KLMLKELLEKQVNSIIDANELTDMQVWGCWCGIGFVCALIVMWII* |
| Ga0099851_10573423 | 3300007538 | Aqueous | MKDKIEKKINSIIETNDLTDMQVWGVWCGIGFISAFIIMWII* |
| Ga0070751_13371841 | 3300007640 | Aqueous | QRGKQMLKELLEKKVNSIIETNDLTDMQVWGVWCGIGFISAFIVMWII* |
| Ga0102951_10708721 | 3300007725 | Water | KQQKGKPMLKELLEKKVNSIIETNDLTDTQVWGVWCGIGFISAFIIMWII* |
| Ga0110931_11926283 | 3300007963 | Marine | MLKELLEKKVNSMINTNELTDMQVWGVMCGIGFILALIIMWII* |
| Ga0105746_13118591 | 3300007973 | Estuary Water | NKQQRGNQMLKELLEKKVNSMINTNDLTDMQVWGVMCGIGFISAFIVMWII* |
| Ga0105748_101982543 | 3300007992 | Estuary Water | RNKQQRGNQMLKELLEKKVNSMINTNDLTDMQVWGVMCGIGFISAFIVMWII* |
| Ga0098052_10578261 | 3300008050 | Marine | KRINSIIETNDLTDLQVWGVICGIGFISSFIIMWII* |
| Ga0098052_13989341 | 3300008050 | Marine | RNQLRGNQMLKEQLEKRLNSIIETNDLTDLQVWGSCFGIGFISAFILMWII* |
| Ga0102963_14004161 | 3300009001 | Pond Water | KELLEKRVNSIIETNDLTDMQVWGVWCGIGFISAFIVMWII* |
| Ga0102815_104672753 | 3300009080 | Estuarine | MLKEQLEKRLNSIIETNDLTDLQVWGSCFGIGFISAFILMWIV* |
| Ga0114995_107377031 | 3300009172 | Marine | RGKLMLKELLEKQVNSIIDANELTDMQVWGCWCGIGFICALIVIWII* |
| Ga0114994_103437871 | 3300009420 | Marine | LLEKQVNSIIDANELTDMQVWGCWCGIGFICALIVMWII* |
| Ga0115545_10343871 | 3300009433 | Pelagic Marine | RGKQMLKELLEKKVNSIINTNDLTDMQVWGIWCGIGFISAFIIMWII* |
| Ga0115545_12271751 | 3300009433 | Pelagic Marine | KVNSIIETNELTDIQVWGVWCGIGFISAFIIMWIV* |
| Ga0115546_10544161 | 3300009435 | Pelagic Marine | MLKELLEKKVNSIIETNDLTDMQVWGVMCGIGFISAFIVMW |
| Ga0115554_11143933 | 3300009472 | Pelagic Marine | MLKELLEKKVNSIIETNDLTDMQVWGVMCGIGFISAFIVMWII* |
| Ga0115554_12620403 | 3300009472 | Pelagic Marine | MLKELLEKQVNSIIDANELTDLQVWGCWCGIGFVCALIVMWII* |
| Ga0115568_100766061 | 3300009498 | Pelagic Marine | QMLKELLEKKVNSMINTNDLTDMQVWGIMCGIGFISAFIVMWII* |
| Ga0115572_101462201 | 3300009507 | Pelagic Marine | MLKELLEKKVNSMINTNDLTDMQVWGVMGLIGFISAFIVM |
| Ga0115003_103929891 | 3300009512 | Marine | GKLMLKELLEKQVNSIIDANELTDMQVWGCWCGIGFICALIVMWII* |
| Ga0115003_107147782 | 3300009512 | Marine | MLKELLEKKVNSIIEANELTDLQVWGYWCGIGAICALIVMWII* |
| Ga0115011_101776821 | 3300009593 | Marine | RVNSIIETNDLTDMQVWGMWCGIGFISAFIVMWIV* |
| Ga0115011_102298221 | 3300009593 | Marine | MLKELLEKRVNSIIETNDLTDMQVWGMWCGIGFISAFIIMWII* |
| Ga0115104_101772112 | 3300009677 | Marine | MKDKIEKKINSMINTNDLTDMQVWGIMCCIGFISACIIMWII* |
| Ga0115104_102358062 | 3300009677 | Marine | MLKELLEKKVNSIIETNDLTDMQVWGMWCGIGFISAFIVMWII* |
| Ga0115000_104330793 | 3300009705 | Marine | KLMLKELLEKQVNSIIDANELTDMQVWGCWCGIGFICALIVMWII* |
| Ga0098056_10268011 | 3300010150 | Marine | KQLRGKQMLKELLEKRVNSIIETNDLTDMQVWGMWCGIGFISAFIVMWII* |
| Ga0098056_11772421 | 3300010150 | Marine | RGKQMLKELLEKRVNSIIETNDLTDMQVWGIWCGIGFISAFIVMWIV* |
| Ga0098059_10644002 | 3300010153 | Marine | MKDKIEKKINSIIEINDLTDMQVWGIWCGIGFVCAFVIMWII* |
| Ga0098059_11704531 | 3300010153 | Marine | LQKNKQPRGKQMLKELLEKKVNSLINTNELTDMQVWGVMCGIGFILALIIMWII* |
| Ga0151672_1184991 | 3300011129 | Marine | KELLEKKVNSMINTNDLTDMQVWGVMCGIGFISAFIIMWII* |
| Ga0151674_10050952 | 3300011252 | Marine | VNSLINTNELTDMQVWGVMCGIGFILALIISWII* |
| Ga0151677_10056284 | 3300011258 | Marine | KKVNSMINTNDLTDMQVWGVMCGIGFISAFIIMWII* |
| Ga0151677_10468793 | 3300011258 | Marine | KQMLKELLEKKVNSIIDTNDLTDMQVWGVMCGIGFVSAFIIMWII* |
| Ga0160422_111056021 | 3300012919 | Seawater | MKDKIEKKINSIIETNDLTDMQVWGICCGIGFVCAFVIMWII* |
| Ga0180120_102946383 | 3300017697 | Freshwater To Marine Saline Gradient | MLKELLEKRVNSMIETNDLTDMQVWGVMCGIGFISALIIMWII |
| Ga0181369_10194623 | 3300017708 | Marine | LQRNKQRGKQMLKELLEKKVNSMIETNDLTDMQVWGVMCGIGFVSAFIIMWVV |
| Ga0181369_10636442 | 3300017708 | Marine | MLKELLEKKVNSIIETNDLTDMQVWGMWCGIGFISAFIIMWII |
| Ga0181369_11190832 | 3300017708 | Marine | MLKELLEKKINSIINTNDLTDMQVWGIWYGIGFISAFVIMWII |
| Ga0181387_10767971 | 3300017709 | Seawater | KKVNSMINTNELTDIQVWGVMCGIGFISAFIIMWII |
| Ga0181391_10139043 | 3300017713 | Seawater | MLKKLLEKKVNSLINTNELTDMQVWGVMCSIGFISAFIIMWII |
| Ga0181391_10802294 | 3300017713 | Seawater | MLKELLEKKINSLINTNELTDMQVWGVMCGIGVILTLIIIWII |
| Ga0181412_10272073 | 3300017714 | Seawater | MLKELLEKKVNSMINTNDLTDMQVWGVMCGIGFVSAFIIMWVV |
| Ga0181412_10881741 | 3300017714 | Seawater | QMLKELLEKKVNSLINTNELTDMQVWGVMCSIGFISAFIIMWII |
| Ga0181390_10474711 | 3300017719 | Seawater | EQMLKELLEKKVNSLINTNELTDMQVWGVMCGIGFILALIIMWII |
| Ga0181383_10578283 | 3300017720 | Seawater | MLKELLEKKVNSMINTNDLTDMQVWGVMGFIGFISAFIVMWII |
| Ga0181383_11251681 | 3300017720 | Seawater | QRGNLMLKELLEKKVNSMINTNDLTDMQVWGVMCGIGFISAFIVMWII |
| Ga0181388_10460603 | 3300017724 | Seawater | MKDKIEKKINSMINTNDLTDMQVWGIMCCIVFISACIIMWII |
| Ga0181388_11757314 | 3300017724 | Seawater | MLKELLEKQVNSIIDANELTDMQVWGCWCSIGFVCALIVMW |
| Ga0181401_10916082 | 3300017727 | Seawater | MLKELLEKKVNSIVEANELTDIQVWGCWCGIGFICAFIVMWIF |
| Ga0181419_10185802 | 3300017728 | Seawater | MLKELLEKKVNSLINTNDLTDMQVWGVMCSIGFISAFIVMWII |
| Ga0181419_11650922 | 3300017728 | Seawater | MLKELLEKKVNSMINTNDLTDMQVWGMWCGIGFISAFIIMWII |
| Ga0181417_11271411 | 3300017730 | Seawater | LQRNKQRGKQMLKELLEKKVNSMINTNDLTDMQVWGVMCSIGFISAFIVMWII |
| Ga0181417_11743233 | 3300017730 | Seawater | MKDKIEKRINSIIETNDLTDMQVWGAWCGIGFISA |
| Ga0181415_10379331 | 3300017732 | Seawater | KMKDKIEKKINSIIETNDLTDMQVWGIWCGIGFVCAFVIMWVI |
| Ga0181415_10439362 | 3300017732 | Seawater | MLKELLEKKINSIIETNDLTDIQVWGMWCGIGFISAFIIMWII |
| Ga0187218_11442311 | 3300017737 | Seawater | MLKELLEKKVNSMINTNDLTDMQVWGVMCAIGFISAFI |
| Ga0181428_10513631 | 3300017738 | Seawater | KKINSLINTNELTDMQVWGVMCGIGFILALIISWII |
| Ga0181428_11639641 | 3300017738 | Seawater | MKDKIEKKINSIIETNDLTDMQVWGIWCGIGFVCAFVIIWVI |
| Ga0181428_11695584 | 3300017738 | Seawater | MLKELLEKKVNSMINTNDLTDMQVWGVMCAIGFISAFIVMWAI |
| Ga0181433_10167382 | 3300017739 | Seawater | MLKELLEKRVNSLINTNELTDMQVWGVMCGIGFISAFIVMWII |
| Ga0181418_10919422 | 3300017740 | Seawater | MLKELLEKKVNSMINTNDLTDMQVWGVMCAIGFISAFIVMWIV |
| Ga0181399_10090151 | 3300017742 | Seawater | KVNSLINTNELTDMQVWGVMCGIGFILALIIMWII |
| Ga0181399_10511173 | 3300017742 | Seawater | MLKELLEKKVNSMINTNDLTDMQVWGVMCGIGFILALIIMWII |
| Ga0181397_11498521 | 3300017744 | Seawater | KEKVNSMINTNDLTDMQVWGVMGLIGFISAFIVMWII |
| Ga0181389_11378523 | 3300017746 | Seawater | MLKELLEKQVNSIIDANELTDMQVWGVMCAIGFISAFIVMWII |
| Ga0181393_10927591 | 3300017748 | Seawater | QRGKQMLKELLEKKINSIIETNDLTDMQVWGMWCGIGFISAFIIMWII |
| Ga0181392_10950543 | 3300017749 | Seawater | MLKELLDKKVNSMINTNELTDIQVWGVMCGIGFISAFIIMWII |
| Ga0181405_10490671 | 3300017750 | Seawater | QMLKELLEKKVNSLINTNELTDMQVWSVMCGIGFISAFIIMWII |
| Ga0181405_10642131 | 3300017750 | Seawater | MLKELLEKKVNSLINTNELTDMQVWSVMCGIGFISAFIIM |
| Ga0187219_10352473 | 3300017751 | Seawater | MLKELLEKKVNSLINTNELTDMQVWGVMCGIGFISAFIVMWII |
| Ga0187219_10785401 | 3300017751 | Seawater | QLRGKQMLKELLEKKVNSLINTNELTDMQVWGVMCGIGFILALIIMWII |
| Ga0181400_10383621 | 3300017752 | Seawater | RGKQMLKELLEKKVNSLINTNELTDMQVWSVMCGIGFISAFIIMWII |
| Ga0181382_10291262 | 3300017756 | Seawater | MLKELLEKKVNSIIETNDLTDMQVWSVMCGIGFISAFIIMWII |
| Ga0181409_10114551 | 3300017758 | Seawater | GEQMLKELLEKKVNSLINTNELTDMQVWGVMCGIGFILAFIIMWII |
| Ga0181414_10532783 | 3300017759 | Seawater | MIKELIEKKVNSIINTNDLTDMQVWGIWCGVGFVCAFIVMWII |
| Ga0181408_10223223 | 3300017760 | Seawater | MLKELLEKKVNSMINTNELTDIQVGGVMCGIGVISAFIIMWII |
| Ga0181408_11034302 | 3300017760 | Seawater | MLKELLEKKVNSMIETNDLTDMQVWGVMCGIDFVSAFIIMWVV |
| Ga0181422_10246608 | 3300017762 | Seawater | MKDKIEKKINSIIETNDLTDMQVWGIWCGIGFVCAFIIMWII |
| Ga0181410_11210473 | 3300017763 | Seawater | NNKRNKTMKDKIEKKINSIINTNDLTDMQVWGIWCGIGFISAFIIMWII |
| Ga0181410_11606883 | 3300017763 | Seawater | MLKELLEKKVNSMINTNDLTDMQVWGVMCAIGFISAFIVMWII |
| Ga0181385_10859635 | 3300017764 | Seawater | MLKELLEKKVNSMINTNELTDIQVWGVMCGIGFISAFIIM |
| Ga0181385_11603151 | 3300017764 | Seawater | QMLKELLEKKVNSMINTNELTDIQVWGVMCGIGFISAFIIMWII |
| Ga0187220_10143411 | 3300017768 | Seawater | RGKQMLKELLEKKVNSLINTNELTDMQVWGVMCGIGFILALIIMWII |
| Ga0187217_12199442 | 3300017770 | Seawater | LVKKIKRTTRKNKMLKKLLEKKVNSLINTNELTDMQVWGVMCSIGFISAFIIMWII |
| Ga0181425_11122811 | 3300017771 | Seawater | MLKELLEKRVNSLINTNELTDMQVWGVMCGIGFILAFIIMWII |
| Ga0181386_10070974 | 3300017773 | Seawater | MKDKIEKKINSMINTNDLTYMQVWGIMCCIGFISACIIMWII |
| Ga0181386_11211861 | 3300017773 | Seawater | KVNSMINTNDLTDMQVWGVMCAIGFISAFIVMWAI |
| Ga0181432_11012443 | 3300017775 | Seawater | MLKELLEKKVNNLIETNELTDMQVWGVWCGIGFISAFIIMWII |
| Ga0181424_101775811 | 3300017786 | Seawater | MLKELLEKKVNSMINTNDLTDMQVWGVMGLIGFISAFIF |
| Ga0181424_103488543 | 3300017786 | Seawater | MKDKIEKKINSIINTNDLTDMQVWGVMCGIGFISAFIIMWII |
| Ga0181552_100803474 | 3300017824 | Salt Marsh | MKDKIEKKINSIIETNDLTDMQVWGVWCGIGFISAFIIMWII |
| Ga0181552_104599482 | 3300017824 | Salt Marsh | MLKELLEKKVNSIIETNELTDMQVWGVWCGIGFISAFIIMWVV |
| Ga0181607_100264723 | 3300017950 | Salt Marsh | MLKELLEKKVNSIIETNDLTDMQVWGVWCGIGFISAFIIMWII |
| Ga0181607_102809993 | 3300017950 | Salt Marsh | MKDKIEKKINSIIETNDLTDMQVWGVWCGIGFISAFIIMWVV |
| Ga0194029_10020994 | 3300019751 | Freshwater | MLKELLEKRVNSIIETNDLTDMQVWGIWCGIGFISALIVLWII |
| Ga0206125_100748751 | 3300020165 | Seawater | NKQRRGKQMLKELLEKKVNSIINTNDLTDMQVWGVMCAIGFISAFIIMWII |
| Ga0206125_102448081 | 3300020165 | Seawater | MLKELLEKKVNSMINTNDLTDMQVWGVMCGIGFISAFIIMWII |
| Ga0181602_100848953 | 3300020173 | Salt Marsh | RTMKDKIEKKINSIIETNDLTDMQVWGVWCGIGFISAFIIMWVV |
| Ga0206124_102249964 | 3300020175 | Seawater | MLKELLEKKVNSMINTNDLTDMQVWGVMCGIGFISA |
| Ga0181605_100350704 | 3300020188 | Salt Marsh | MKDKIEKKINSIIETNDLTDMQVWGVWCGIGFISAFIKD |
| Ga0211492_10601582 | 3300020238 | Marine | MLKELLEKKVNSMIETNDLTDMQVWGVMCGIGFVSAFIIMWII |
| Ga0211677_100017472 | 3300020385 | Marine | MLKELLEKKVNSMINTNDLTDMQVWGVMCGIGVILTLIIIWII |
| Ga0211678_102656083 | 3300020388 | Marine | MLKELLEKRVNSLINTNELTDMQVWGVMCGIGFILALIIMWII |
| Ga0211699_104612522 | 3300020410 | Marine | MIKELIEKKVNTIIETNDLTDMQVWGIWCGIGFICAFIVMWII |
| Ga0211516_103159441 | 3300020413 | Marine | MIKELIERKVNSIINTNDLTDMQVWGIWCGIGFVCAFIVMWII |
| Ga0211644_104902892 | 3300020416 | Marine | MLKELLEKKVNSLINTSELTDMQVWGMWCGIGFISAFIVMWII |
| Ga0211521_100972683 | 3300020428 | Marine | MLKELLEKKVNSMINTNDLTDMQVWGVMCGIGFISAFIVMWII |
| Ga0211577_100257003 | 3300020469 | Marine | MKDKIEKKINSMINTNDLTDMQVWGIMCCIGFISACIIMWII |
| Ga0211577_102005243 | 3300020469 | Marine | MKDKIEKKINSIINTNDLTDMQVWGIWCGIGFISAFIIMWII |
| Ga0211547_105518252 | 3300020474 | Marine | MLKELLEKKVNSMINTNDLTDMQVWGIMCGIGFISAFIVMWII |
| Ga0211503_100037665 | 3300020478 | Marine | MLRDRLEKRVNSIIETNDLTDMQVWGIWCGIGFISALIIMWIV |
| Ga0213862_100287483 | 3300021347 | Seawater | MKDKIEKKINSIIETNDLTDMQVWGVWCGIGFISAFIIMWIV |
| Ga0213862_101618294 | 3300021347 | Seawater | MLKELLEKKVNSLINTNELTDMQVWGVMCGIGFISAFIIM |
| Ga0206123_100762433 | 3300021365 | Seawater | MLKELLEKKVNSLINTNDLTDMQVWGVMCATGFISAFIIMWII |
| Ga0213863_100811587 | 3300021371 | Seawater | MLKELVEKKVNSLINTNELTDMQVWGVMCSIGFISAFIIMWII |
| Ga0213865_102112393 | 3300021373 | Seawater | MKNKIEKKINSIIETNDLTDMQVWGVWCGIGFISAFIIMWII |
| Ga0213869_102535153 | 3300021375 | Seawater | MLKELLEKKVNSIIETNDLTDMQVWGVWCGIGFISAFIVMWII |
| Ga0213861_102622362 | 3300021378 | Seawater | MLKELLEKKVNSIINTNDLTDMQVWGVMCGIGFISAFIIMWII |
| Ga0213868_101850702 | 3300021389 | Seawater | MLKELLEKKVNSLINTNELTDMQVWGVMCGIGFISAFIIMWII |
| Ga0213868_102081545 | 3300021389 | Seawater | MKDKIEKKINSIIETNDLTDMQVWGIWSGIGFVCAFVIMWII |
| Ga0213868_105406811 | 3300021389 | Seawater | MLKELLEKKVNSMINTNDLTDMQVWGVMCGIGFISAFIIM |
| Ga0222717_100023935 | 3300021957 | Estuarine Water | MLKELLEKRVNSIIDANELTDMQVWGCWCGIGFVCALIVMWII |
| Ga0222717_100040596 | 3300021957 | Estuarine Water | MLKEQLEKRLNSIIETNDLTDLQVWGSCFGIGFISAFILMWIV |
| Ga0222717_100190329 | 3300021957 | Estuarine Water | MKDRIEKRINNIIETNDLTDMQVWGVWCGIGFISAFIIMWII |
| Ga0222717_100282688 | 3300021957 | Estuarine Water | MLKELLEKKVNSLINTNELTDMQVWGIMCGIGFISAFIIMWII |
| Ga0222717_101134503 | 3300021957 | Estuarine Water | MLKELLEKRVNSMIETNDLTDMQVWGVWCGIGFISAFIVMWII |
| Ga0222717_102923653 | 3300021957 | Estuarine Water | MLKELLEKRVNSIIETNDLTDMQVWGVWCGIGFISAFIVMWII |
| Ga0222718_1000674512 | 3300021958 | Estuarine Water | NKQQREKQMLKELLEKKVNSLINTNELTDMQVWGIMCGIGFISAFIIMWII |
| Ga0222718_101323083 | 3300021958 | Estuarine Water | MKDKIEKKINSIIETNDLTDMQVWGIWSGIGFVCAFVIMWVI |
| Ga0222718_102627023 | 3300021958 | Estuarine Water | MLKELLEKKVNSIIETNDLTDTQVWGVWCGIGFISAFIIMWII |
| Ga0222718_103860802 | 3300021958 | Estuarine Water | MLKELLEKKVNSIIETNDLTDIQVWGVMCGIGFISAFIIMWIV |
| Ga0222716_100210545 | 3300021959 | Estuarine Water | EQLEKRLNSIIETNDLTDLQVWGSCFGIGFISAFILMWIV |
| Ga0212030_10346223 | 3300022053 | Aqueous | EKKVNSIIETNDLTDMQVWGVWCGIGFISAFIIMWVV |
| Ga0212023_10257403 | 3300022061 | Aqueous | NKQPRGKQMLKELLEKRVNSIIETNDLTDMQVWGIWCGIGFISALIVLWVI |
| Ga0212024_10042863 | 3300022065 | Aqueous | MLNLLKEQLEKRVNSIINTNDLTDMQVWGVMCSIGFISAFIIMWII |
| Ga0212021_10043172 | 3300022068 | Aqueous | MLKELLEKKVNSLINTNDLTDMQVWGVMCAIGFISALIIMWII |
| Ga0212021_10539811 | 3300022068 | Aqueous | MKDRIEKRINNIIENNDLTDMQVWSVWCGIGFISAFIIMWII |
| Ga0196889_10255941 | 3300022072 | Aqueous | MLKELLEKKVNSIINTNDLTDMQVWGVMCSIGFISAFIIMWII |
| Ga0196889_10384373 | 3300022072 | Aqueous | MLKELLEKQVNSIIDANELTDMQVWGCWCGIGFVC |
| Ga0196889_10567823 | 3300022072 | Aqueous | MLKELLEKQVNSIIDANELTDMQVWGCWCGIGFVCALIVMWII |
| Ga0224906_100379314 | 3300022074 | Seawater | MLKELLEKKVNSLINTNDLTDMQVWGVMCAIGFISAFIIMWII |
| Ga0224906_10073664 | 3300022074 | Seawater | MKDKIEKKINSIIETNDLTDMQVWGVWCGIGFILAFIIMWII |
| Ga0224906_11455361 | 3300022074 | Seawater | MLKELLEKKVNSLINTNELTDMQVWSVMCGIGFISAFIIMWII |
| Ga0224906_11865823 | 3300022074 | Seawater | MIKELIERKVNSIINTNDLTDMQVWGIWCGVGFVCAFIVMWII |
| Ga0212022_10030008 | 3300022164 | Aqueous | MLKELLEKKVNSIINTNDLTDMQVWGIWCGIGFISAFIIMWII |
| Ga0212022_10186981 | 3300022164 | Aqueous | KMLKELLEKKVNSMINTNDLTDMQVWGVMCSIGFISAFIVMWII |
| Ga0196887_10031487 | 3300022178 | Aqueous | MLKELLEKQVNNIIDANELTDMQVWGCWCGIGFVCALIVMWII |
| Ga0196887_10037085 | 3300022178 | Aqueous | MLKELLEKKVNSMINTNDLTDMQVWGVMCSIGFISAFIVMWII |
| Ga0196899_10386871 | 3300022187 | Aqueous | MLKELLEKQVNSIIDANELTDMQVWGCWCGIGFICALIVMWII |
| Ga0255775_11088671 | 3300022907 | Salt Marsh | MLKELLEKKVNSIIETNDLTDMQVWGVWCGIGFISAFIIMWVV |
| (restricted) Ga0233433_102531013 | 3300022931 | Seawater | MLKELLEKKVNSMINTNDLTDMQVWGIMCGIGFISACIVMWII |
| Ga0233451_100851571 | 3300024301 | Salt Marsh | MLKELLEKKVNSIIETNDLTDMQVWGVWCGIGLYQHLLL |
| Ga0209992_100514473 | 3300024344 | Deep Subsurface | MLNLLKEQLEKRVNSIINTNDLTDMQVWGIWCGIGFISAFIIMWII |
| Ga0244775_102229222 | 3300024346 | Estuarine | MLKELLEKQVNSIIDANELTDMQVWGCWCGIGFICALIVMWLI |
| Ga0207901_10369323 | 3300025045 | Marine | KQQQQRGNPMLKELLEKKVNSIIETNDLTDLQVWGIWFATGFVSAFILIWLI |
| Ga0207905_10001695 | 3300025048 | Marine | MLKELLEKKVNSMINTNDLTDMQVWGVMGLIGFISAFIIMWII |
| Ga0207905_10017574 | 3300025048 | Marine | MLKELLEKKVNSIIEANELTDMEVWGCWCGVGFVCALIVTWII |
| Ga0207905_10083582 | 3300025048 | Marine | MLKELLEKQVNSIIDANELTDMQVWGCWCGIGFVCALIVIWII |
| Ga0207905_10294951 | 3300025048 | Marine | QRNKQPRGKQMLKELLEKKVNSMINTNDLTDMQVWGVMGLIGFISAFIVMWII |
| Ga0208667_10040454 | 3300025070 | Marine | MLKELLEKKVNSMIETNDLTDMQVWGVMCGIGFVSAFIIMWVV |
| Ga0208667_10141793 | 3300025070 | Marine | MKDKIEKTINSMIETNDLTDMQVWGVWCGIGFILAFIIMWII |
| Ga0208667_10500812 | 3300025070 | Marine | MKDKIEKKINSMIETNDLTDMQVWGVWCGIGFILAFIIMWII |
| Ga0208667_10731092 | 3300025070 | Marine | MLKEQLEKRINSIIETNDLTDLQVWGVICGIGFISSFIIMWII |
| Ga0207896_10030533 | 3300025071 | Marine | MLKELLEKKVNSMINTNDLTDMQVWGVMGLIGFISAFIVMWII |
| Ga0208791_10696352 | 3300025083 | Marine | MLKELLEKKVNSMINTNELTDIQVWGVMCGIGFISAFIIMWII |
| Ga0208298_10745573 | 3300025084 | Marine | MLKELLEKKVNSLINTNELTDMQVWGVMCGIGFILALIIMWII |
| Ga0208792_10035264 | 3300025085 | Marine | QQRGKQMLKELLEKKVNSMINTNDLTDMQVWGVMCGIGFISAFIIMWIV |
| Ga0208157_10122186 | 3300025086 | Marine | MKDKIEKKINSIINTNDLTDMQVWGIWYGIGFISAFVIMWII |
| Ga0208669_10102344 | 3300025099 | Marine | MLKELLEKKINSIIETNDLTDMQVWGMWCGIGFISAFIIMWII |
| Ga0208669_10129553 | 3300025099 | Marine | MLKELVEKKVNSLINTNELTDMQVWGVMCGIGFISAFIIMWII |
| Ga0208669_10201323 | 3300025099 | Marine | MKDKIEKKINSIIETNDLTDMQVWGAWCGIGFISAFIIMWIV |
| Ga0208159_10167452 | 3300025101 | Marine | MKDKIEKKINSMINTNDLTDMQVWGIMCGIGFISACIIMWII |
| Ga0208159_10189311 | 3300025101 | Marine | QLRGKQMLKELLEKRVNSLINTNELTDMQVWGVMCGIGFILALIIMWII |
| Ga0208666_10706311 | 3300025102 | Marine | MLKEILEKKVNSLINTNELTDMQVWGVMCGIGFILALIIMWII |
| Ga0208013_10050181 | 3300025103 | Marine | LKELLEKRVNSIIETNDLTDMQVWGMWCGIGFISAFIVMWII |
| Ga0208013_10092754 | 3300025103 | Marine | MLKEQLEKRLNSIIETNDLTDLQVWGSCFGIGFISAFILMWII |
| Ga0208013_10869874 | 3300025103 | Marine | MLKELLEKKVNSMINTNDLTDMQVWGVMCGIGFISAFIIMWIV |
| Ga0208793_10919293 | 3300025108 | Marine | MLKELLEKRVNSIINTNDLTDMQVWGVMCGIGFISAFIIMWII |
| Ga0208793_11069042 | 3300025108 | Marine | RVNSIIETNDLTDMQVWGMWCGIGFISAFIVMWII |
| Ga0208793_11857471 | 3300025108 | Marine | MLKELLEKRVNSIINTNDLTDMQVWGVMCGIGFISAFIIMWIV |
| Ga0208158_10232463 | 3300025110 | Marine | QMLKELLEKRVNSLINTNELTDMQVWGVMCGIGFILALIIMWII |
| Ga0208158_10720021 | 3300025110 | Marine | MLKELLEKKVNSLINTNELTDMQVWGVMCGIGFILALI |
| Ga0208158_11193081 | 3300025110 | Marine | RNKQRGKQMLKELLEKKVNSIIETNDLTDMQVWGVWCGIGFISAFIIMWIV |
| Ga0209535_10281793 | 3300025120 | Marine | MLKELLEKKINSMINTNDLTDMQVWGVMGLIGFISAFIVMWII |
| Ga0209535_10453162 | 3300025120 | Marine | MLKELLEKRVNSIIDANELTDLQVWGCWCGIGFVCALIVMWII |
| Ga0209535_11045943 | 3300025120 | Marine | NQQRGKQMLKELLEKKVNSIIEANELTDMEVWGCWCGVGFVCALIVMWII |
| Ga0209535_11177381 | 3300025120 | Marine | MLKELLEKKINSMINTNDLTDMQVWGVMGLIGFIS |
| Ga0208919_10405501 | 3300025128 | Marine | KQMLKELLEKKVNSLINTNELTDMQVWGVMCGIGFILALIIMWII |
| Ga0209232_10146841 | 3300025132 | Marine | QMLKELLEKKVNSLINTNELTDMQVWGVMCGIGFILALIIMWII |
| Ga0209232_10462781 | 3300025132 | Marine | QMLKELLEKKVNSLINTNELTDMQVWGVMCGIGFISAFIIMWII |
| Ga0209232_10801691 | 3300025132 | Marine | MLKELLEKRVNSIINTNDLTDMQVWGVMCGIGFISALIIMWIV |
| Ga0209232_11180502 | 3300025132 | Marine | MLKELLEKKVNSMIETNDLTDMQVWGVMCGVGFISAFIIMWVI |
| Ga0208299_12068813 | 3300025133 | Marine | RVNSIIETNDLTDMQVWGIWCGIGFISAFIVMWIV |
| Ga0209336_100489833 | 3300025137 | Marine | QVNNIIDANELTDMQVWGCWCGIGFICALIVMWII |
| Ga0209634_10952273 | 3300025138 | Marine | MLKELLEKQVNSIIDANELTDMQVWGCWCSIGFVCALIVMWII |
| Ga0209756_12978581 | 3300025141 | Marine | QRNKQRGKQMLKELLEKKVNSLINTNELTDMQVWGVMCGIGFISAFIIMWII |
| Ga0209645_10602183 | 3300025151 | Marine | RNKQQREKQMLKELLEKKVNSLINTNELTDMQVWGIMCGIGFISAFIIMWII |
| Ga0209645_10793483 | 3300025151 | Marine | MLKELLEKRVNSIIETNDLTDMQVWGIWCGIGFISALIIMWII |
| Ga0209645_11823961 | 3300025151 | Marine | MLKELLEKKVNSLINTSELTDMQVWGIWCGVGFILALI |
| Ga0209645_11978832 | 3300025151 | Marine | MLKELLEKRVNSIIETNDLTDMQVWGVMCGIGFISAFIIMWII |
| Ga0209504_10785673 | 3300025621 | Pelagic Marine | RNQQQEKLMLKELLEKKVNSIIDANELTDMQVWGCWCGIGFVCALIVVWII |
| Ga0208004_10097304 | 3300025630 | Aqueous | LQKNKQPRGKQMLKELLEKKVNSLINTNELTDMQVWGVMCGIGFISAFIIMWII |
| Ga0209833_10533441 | 3300025641 | Pelagic Marine | MQWLKNKLEKQVNSIVDTHDLTALQVWGCCFGIGFMSACIV |
| Ga0208134_11486083 | 3300025652 | Aqueous | MLKELLEKKVNSIINTNDLTDMQVWGVMCAIGFISAFIVMWII |
| Ga0208134_11775741 | 3300025652 | Aqueous | LMLKELLEKQVNSIIDANELTDMQVWGCWCGIGFISACIVMWII |
| Ga0209406_10434543 | 3300025694 | Pelagic Marine | QRRGKQMLKELLEKKVNSMINTNDLTDMQVWGIMCGIGFISAFIVMWII |
| Ga0209406_10837861 | 3300025694 | Pelagic Marine | MLKELLEKKVNSMINTNDLTDMQVWGIMCGIGFISAFII |
| Ga0209305_12186063 | 3300025712 | Pelagic Marine | MKDKIENKINSIIETNDLTDMQVWGVWCGIGFISAFIIMWII |
| Ga0208899_100569217 | 3300025759 | Aqueous | MKDRIEKRINNIIETNDLTDMQVWSVWCGIGFISAFIIMWII |
| Ga0208767_10271804 | 3300025769 | Aqueous | LLEKQVNNIIDANELTDMQVWGCWCGIGFVCALIVMWII |
| Ga0208545_10811092 | 3300025806 | Aqueous | MLKELLEKQVNSIIDANELTDMQVWGCWLGTGFICALIVMWVI |
| Ga0208543_10972952 | 3300025810 | Aqueous | MLKELLEKQVNSIIDANELTDIQVWGCWCGTGFICALIVMWII |
| Ga0209193_10510183 | 3300025816 | Pelagic Marine | MKDKIENKINSIIETNDLTDMQVWGVWCGIGFISAFIIMWIV |
| Ga0209600_11914661 | 3300025821 | Pelagic Marine | QMLKELLEKKVNSMINTNDLTDIQVWGVMCGIGFISAFIVMWII |
| Ga0209603_12717412 | 3300025849 | Pelagic Marine | MLKELLEKKVNSIIETNDLTDMQVWGVMCGIGFISAFIVMWII |
| Ga0209631_100525704 | 3300025890 | Pelagic Marine | DKIEKKINSIIETNDLTDMQVWGVWCGIGFISAFIIMWII |
| Ga0209630_103897113 | 3300025892 | Pelagic Marine | MLKELLEKKVNSIIETNELTDMQVWGVWCGIGFISAFIIMWIV |
| Ga0209932_10347933 | 3300026183 | Pond Water | MLKELLEKKINSIIETNDLTDMQVWGVWCGIGFISAFIIMWII |
| Ga0208941_100073613 | 3300027077 | Marine | MKDKIEKKINSIIETNDLTDMQVWGIWCGIGFVCAFVIMWVI |
| Ga0209710_10607671 | 3300027687 | Marine | RGKLMLKELLEKQVNSIIDANELTDMQVWGCWCGIGFICALIVMWII |
| Ga0209709_100648113 | 3300027779 | Marine | EKQVNSIIDANELTDMQVWGCWCGIGFVCALIVMWII |
| Ga0209830_101876322 | 3300027791 | Marine | MLKELLEKQVNSIIDANELTDMQVWGCWCGIGFTCALIVMWII |
| Ga0209090_103255641 | 3300027813 | Marine | LLEKQVNSIIDANELTDMQVWGCWCGIGFICALIVMWII |
| Ga0209035_101042342 | 3300027827 | Marine | MLKELLEKKVNSIIETNDLTDLQVWGVWCGIGFISAFIVMWII |
| Ga0209713_108939393 | 3300027883 | Marine | MLKELLEKQVNNIIDANELTDMQVWGYWCGIGFICALI |
| Ga0209404_102136111 | 3300027906 | Marine | KQMLKKLLEKRVNSIIETNDLTDMQVWGMWCGIGFISAFIIMWIV |
| Ga0209404_103858961 | 3300027906 | Marine | MLKELLEKRVNSIIETNDLTDMQVWGMWCGIGFISAFIVMWII |
| Ga0256368_10791851 | 3300028125 | Sea-Ice Brine | QQKGKLMLKELLEKQVNNIINANELTDMQVWGCWCGIGFICALIVMWII |
| Ga0183683_10030614 | 3300029309 | Marine | MLKELLEKKVNSMIETNDLTDMQVWGVMCGIGFISAFIVMWII |
| Ga0183755_10889651 | 3300029448 | Marine | MLKELLEKKVNSIIDTNDLTDLQVWGVWCGIGFISAFIVMWII |
| Ga0183755_11087471 | 3300029448 | Marine | MLKELLEKKVNSMINTNDLTDIQVWGIWCGIGFISAFIIMWII |
| Ga0183757_10079025 | 3300029787 | Marine | MLKELLEKKVNSMINTNDLTDMQVWGVMCGIGFISAIIVMWII |
| Ga0307488_100621473 | 3300031519 | Sackhole Brine | MLKELLEKKVNSIIEANELTDMEVWGCWYGVGFVCALIVMWII |
| Ga0307488_100993753 | 3300031519 | Sackhole Brine | MLKKLLEKQVNSIIDANELTDMQVWGCWCGIGFVCALIVMWII |
| Ga0307488_102685243 | 3300031519 | Sackhole Brine | MLKELLEKKVNSMINTNDLTDIQVWGVMCGIGFISAFIVMWII |
| Ga0307489_102357561 | 3300031569 | Sackhole Brine | INQQRGNPMLKELLEKKVNSMIEANELTDMQVWGCWCGIGFICALIVMWII |
| Ga0302138_101264913 | 3300031637 | Marine | QRGKLMLKELLEKQVNSIIDANELTDMQVWGCWCGIGFICALIVMWII |
| Ga0307986_101461073 | 3300031659 | Marine | MLKELLEKRVNSIIDANELTDMQVWGCWCGIGFGCALIVMWII |
| Ga0302122_100270004 | 3300031675 | Marine | EKQVNSIIDANELTDMQVWGCWCGIGFICALIVMWII |
| Ga0315331_100392333 | 3300031774 | Seawater | MLKELLEKKVNSLINTNDLTDMQVWGIMCGIGFISAFIIMWII |
| Ga0315320_104709384 | 3300031851 | Seawater | MKDKIEKKINSIIETNDLTDMQVWGIWCGIGFICSYIIMWII |
| Ga0315316_103209953 | 3300032011 | Seawater | MLKELLEKKVNSLINTNELTDMQVWGVMCSIGFISAFIIMWII |
| Ga0315327_103336453 | 3300032032 | Seawater | KNKQLRGKQMLKELLEKKVNSLINTNELTDMQVWGVMCGIGFILALIIMWII |
| Ga0315315_105904314 | 3300032073 | Seawater | MLKELLEKKVNSLINTNELTDMQVWGVMCSIGFIS |
| Ga0315315_109896602 | 3300032073 | Seawater | MLKELLEKKINSLINTNELTDMQVWGVMCGIGFILALIISWII |
| Ga0315321_101585411 | 3300032088 | Seawater | QRRGKQMLKELLEKKVNSLINTNDLTDMQVWGIMCGIGFISAFIIMWII |
| ⦗Top⦘ |