


| Basic Information | |
|---|---|
| Family ID | F006563 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 370 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MRDWISDWKKWSRAERCFAIALVILALALPLGLLIGGGRIGI |
| Number of Associated Samples | 215 |
| Number of Associated Scaffolds | 370 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 74.80 % |
| % of genes near scaffold ends (potentially truncated) | 32.16 % |
| % of genes from short scaffolds (< 2000 bps) | 89.46 % |
| Associated GOLD sequencing projects | 199 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.45 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (65.135 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (31.351 % of family members) |
| Environment Ontology (ENVO) | Unclassified (32.703 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (59.459 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.00% β-sheet: 0.00% Coil/Unstructured: 50.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 370 Family Scaffolds |
|---|---|---|
| PF00903 | Glyoxalase | 44.32 |
| PF03737 | RraA-like | 21.35 |
| PF12779 | WXXGXW | 1.62 |
| PF01161 | PBP | 1.35 |
| PF02152 | FolB | 1.08 |
| PF02705 | K_trans | 0.81 |
| PF00378 | ECH_1 | 0.81 |
| PF00809 | Pterin_bind | 0.81 |
| PF00561 | Abhydrolase_1 | 0.81 |
| PF00248 | Aldo_ket_red | 0.54 |
| PF05958 | tRNA_U5-meth_tr | 0.54 |
| PF08241 | Methyltransf_11 | 0.54 |
| PF12697 | Abhydrolase_6 | 0.54 |
| PF00108 | Thiolase_N | 0.27 |
| PF13186 | SPASM | 0.27 |
| PF13292 | DXP_synthase_N | 0.27 |
| PF13714 | PEP_mutase | 0.27 |
| PF13551 | HTH_29 | 0.27 |
| PF14497 | GST_C_3 | 0.27 |
| PF00296 | Bac_luciferase | 0.27 |
| PF01965 | DJ-1_PfpI | 0.27 |
| PF00465 | Fe-ADH | 0.27 |
| COG ID | Name | Functional Category | % Frequency in 370 Family Scaffolds |
|---|---|---|---|
| COG0684 | RNA degradosome component RraA (regulator of RNase E activity) | Translation, ribosomal structure and biogenesis [J] | 21.35 |
| COG1881 | Uncharacterized conserved protein, phosphatidylethanolamine-binding protein (PEBP) family | General function prediction only [R] | 1.35 |
| COG1539 | Dihydroneopterin aldolase | Coenzyme transport and metabolism [H] | 1.08 |
| COG3158 | K+ uptake protein Kup | Inorganic ion transport and metabolism [P] | 0.81 |
| COG2265 | tRNA/tmRNA/rRNA uracil-C5-methylase, TrmA/RlmC/RlmD family | Translation, ribosomal structure and biogenesis [J] | 0.54 |
| COG0183 | Acetyl-CoA acetyltransferase | Lipid transport and metabolism [I] | 0.27 |
| COG0337 | 3-dehydroquinate synthetase | Amino acid transport and metabolism [E] | 0.27 |
| COG0371 | Glycerol dehydrogenase or related enzyme, iron-containing ADH family | Energy production and conversion [C] | 0.27 |
| COG1454 | Alcohol dehydrogenase, class IV | Energy production and conversion [C] | 0.27 |
| COG1979 | Alcohol dehydrogenase YqhD, Fe-dependent ADH family | Energy production and conversion [C] | 0.27 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.27 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 65.14 % |
| Unclassified | root | N/A | 34.86 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2189573004|GZGWRS402H0WIN | Not Available | 515 | Open in IMG/M |
| 3300001867|JGI12627J18819_10290407 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
| 3300001867|JGI12627J18819_10323043 | Not Available | 623 | Open in IMG/M |
| 3300001867|JGI12627J18819_10388726 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100956755 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
| 3300002568|C688J35102_119905945 | All Organisms → cellular organisms → Bacteria | 810 | Open in IMG/M |
| 3300002914|JGI25617J43924_10160375 | All Organisms → cellular organisms → Bacteria | 765 | Open in IMG/M |
| 3300003219|JGI26341J46601_10001313 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 8039 | Open in IMG/M |
| 3300003219|JGI26341J46601_10059100 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium | 1181 | Open in IMG/M |
| 3300003368|JGI26340J50214_10008843 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 3232 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10367964 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300004080|Ga0062385_10172346 | Not Available | 1141 | Open in IMG/M |
| 3300004152|Ga0062386_100099710 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 2231 | Open in IMG/M |
| 3300004152|Ga0062386_100139568 | All Organisms → cellular organisms → Bacteria | 1885 | Open in IMG/M |
| 3300004152|Ga0062386_100510333 | Not Available | 977 | Open in IMG/M |
| 3300004152|Ga0062386_101334153 | Not Available | 597 | Open in IMG/M |
| 3300004633|Ga0066395_10096579 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1416 | Open in IMG/M |
| 3300004633|Ga0066395_10561290 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
| 3300004635|Ga0062388_100873221 | All Organisms → cellular organisms → Bacteria | 861 | Open in IMG/M |
| 3300005167|Ga0066672_10810845 | Not Available | 588 | Open in IMG/M |
| 3300005171|Ga0066677_10160614 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium | 1237 | Open in IMG/M |
| 3300005175|Ga0066673_10698458 | Not Available | 584 | Open in IMG/M |
| 3300005176|Ga0066679_10852763 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300005180|Ga0066685_10359924 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium | 1010 | Open in IMG/M |
| 3300005187|Ga0066675_10886029 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300005332|Ga0066388_100727989 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1595 | Open in IMG/M |
| 3300005332|Ga0066388_101422603 | Not Available | 1206 | Open in IMG/M |
| 3300005332|Ga0066388_102724918 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 902 | Open in IMG/M |
| 3300005332|Ga0066388_102774408 | All Organisms → cellular organisms → Bacteria | 895 | Open in IMG/M |
| 3300005332|Ga0066388_106294312 | Not Available | 599 | Open in IMG/M |
| 3300005363|Ga0008090_10021849 | All Organisms → cellular organisms → Bacteria | 2230 | Open in IMG/M |
| 3300005439|Ga0070711_100518724 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium | 985 | Open in IMG/M |
| 3300005439|Ga0070711_101331014 | Not Available | 624 | Open in IMG/M |
| 3300005467|Ga0070706_100338907 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1402 | Open in IMG/M |
| 3300005468|Ga0070707_102305703 | Not Available | 506 | Open in IMG/M |
| 3300005471|Ga0070698_100437548 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium | 1243 | Open in IMG/M |
| 3300005518|Ga0070699_100958987 | Not Available | 784 | Open in IMG/M |
| 3300005536|Ga0070697_100471358 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1096 | Open in IMG/M |
| 3300005557|Ga0066704_10557269 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium | 745 | Open in IMG/M |
| 3300005560|Ga0066670_10064468 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1948 | Open in IMG/M |
| 3300005568|Ga0066703_10458444 | Not Available | 763 | Open in IMG/M |
| 3300005574|Ga0066694_10158963 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1072 | Open in IMG/M |
| 3300005764|Ga0066903_100096675 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3962 | Open in IMG/M |
| 3300005764|Ga0066903_100693204 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1793 | Open in IMG/M |
| 3300005764|Ga0066903_100943951 | All Organisms → cellular organisms → Bacteria | 1568 | Open in IMG/M |
| 3300005764|Ga0066903_101105731 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium | 1461 | Open in IMG/M |
| 3300005764|Ga0066903_101670153 | Not Available | 1211 | Open in IMG/M |
| 3300005764|Ga0066903_101902740 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium | 1139 | Open in IMG/M |
| 3300005764|Ga0066903_102833611 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium | 941 | Open in IMG/M |
| 3300005764|Ga0066903_102920569 | Not Available | 927 | Open in IMG/M |
| 3300005764|Ga0066903_106097138 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 631 | Open in IMG/M |
| 3300005764|Ga0066903_107167581 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300005764|Ga0066903_107185509 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300005764|Ga0066903_108130793 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 537 | Open in IMG/M |
| 3300005921|Ga0070766_10009102 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 5077 | Open in IMG/M |
| 3300005983|Ga0081540_1043263 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2313 | Open in IMG/M |
| 3300005983|Ga0081540_1145740 | All Organisms → cellular organisms → Bacteria | 943 | Open in IMG/M |
| 3300006028|Ga0070717_11145566 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
| 3300006173|Ga0070716_100180258 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 1386 | Open in IMG/M |
| 3300006175|Ga0070712_100090276 | All Organisms → cellular organisms → Bacteria | 2243 | Open in IMG/M |
| 3300006175|Ga0070712_100344047 | All Organisms → cellular organisms → Bacteria | 1219 | Open in IMG/M |
| 3300006175|Ga0070712_101579210 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300006176|Ga0070765_100115416 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 2346 | Open in IMG/M |
| 3300006176|Ga0070765_100932669 | Not Available | 821 | Open in IMG/M |
| 3300006797|Ga0066659_11510637 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300006806|Ga0079220_10500536 | All Organisms → cellular organisms → Bacteria | 830 | Open in IMG/M |
| 3300007255|Ga0099791_10527295 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300007788|Ga0099795_10049346 | All Organisms → cellular organisms → Bacteria | 1527 | Open in IMG/M |
| 3300009012|Ga0066710_104324165 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300009088|Ga0099830_10458882 | All Organisms → cellular organisms → Bacteria | 1036 | Open in IMG/M |
| 3300009137|Ga0066709_101124627 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium | 1155 | Open in IMG/M |
| 3300009137|Ga0066709_103237407 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300009143|Ga0099792_10291036 | Not Available | 966 | Open in IMG/M |
| 3300009792|Ga0126374_10186969 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1297 | Open in IMG/M |
| 3300009792|Ga0126374_11521721 | Not Available | 550 | Open in IMG/M |
| 3300010043|Ga0126380_10870768 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
| 3300010046|Ga0126384_12318865 | Not Available | 518 | Open in IMG/M |
| 3300010048|Ga0126373_10050742 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 3686 | Open in IMG/M |
| 3300010048|Ga0126373_10507845 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1249 | Open in IMG/M |
| 3300010048|Ga0126373_10891475 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium | 953 | Open in IMG/M |
| 3300010048|Ga0126373_11156683 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium | 840 | Open in IMG/M |
| 3300010048|Ga0126373_11202418 | Not Available | 824 | Open in IMG/M |
| 3300010048|Ga0126373_11272657 | Not Available | 801 | Open in IMG/M |
| 3300010048|Ga0126373_11293663 | All Organisms → cellular organisms → Bacteria | 795 | Open in IMG/M |
| 3300010048|Ga0126373_11334351 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium | 783 | Open in IMG/M |
| 3300010048|Ga0126373_12939703 | Not Available | 531 | Open in IMG/M |
| 3300010154|Ga0127503_10186233 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
| 3300010154|Ga0127503_10684477 | Not Available | 533 | Open in IMG/M |
| 3300010154|Ga0127503_10709002 | Not Available | 688 | Open in IMG/M |
| 3300010154|Ga0127503_10934927 | Not Available | 665 | Open in IMG/M |
| 3300010154|Ga0127503_11227959 | Not Available | 672 | Open in IMG/M |
| 3300010343|Ga0074044_10291952 | All Organisms → cellular organisms → Bacteria | 1073 | Open in IMG/M |
| 3300010358|Ga0126370_10170110 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium | 1612 | Open in IMG/M |
| 3300010359|Ga0126376_10370894 | All Organisms → cellular organisms → Bacteria | 1277 | Open in IMG/M |
| 3300010359|Ga0126376_12208119 | Not Available | 595 | Open in IMG/M |
| 3300010360|Ga0126372_11922813 | Not Available | 637 | Open in IMG/M |
| 3300010360|Ga0126372_12761135 | Not Available | 543 | Open in IMG/M |
| 3300010361|Ga0126378_10282162 | All Organisms → cellular organisms → Bacteria | 1761 | Open in IMG/M |
| 3300010361|Ga0126378_10330771 | All Organisms → cellular organisms → Bacteria | 1631 | Open in IMG/M |
| 3300010361|Ga0126378_12972912 | Not Available | 540 | Open in IMG/M |
| 3300010366|Ga0126379_10309269 | All Organisms → cellular organisms → Bacteria | 1591 | Open in IMG/M |
| 3300010373|Ga0134128_10605704 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium | 1219 | Open in IMG/M |
| 3300010376|Ga0126381_100869781 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium | 1297 | Open in IMG/M |
| 3300010376|Ga0126381_101228038 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1083 | Open in IMG/M |
| 3300010376|Ga0126381_101245637 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium | 1075 | Open in IMG/M |
| 3300010376|Ga0126381_101552735 | All Organisms → cellular organisms → Bacteria | 956 | Open in IMG/M |
| 3300010376|Ga0126381_101940736 | Not Available | 849 | Open in IMG/M |
| 3300010376|Ga0126381_101965762 | All Organisms → cellular organisms → Bacteria | 843 | Open in IMG/M |
| 3300010376|Ga0126381_102606801 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
| 3300010376|Ga0126381_103222674 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
| 3300010376|Ga0126381_104091011 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300010376|Ga0126381_105005154 | Not Available | 508 | Open in IMG/M |
| 3300010398|Ga0126383_11681845 | Not Available | 724 | Open in IMG/M |
| 3300011120|Ga0150983_11688825 | Not Available | 686 | Open in IMG/M |
| 3300011120|Ga0150983_12678168 | Not Available | 603 | Open in IMG/M |
| 3300011120|Ga0150983_16313291 | Not Available | 556 | Open in IMG/M |
| 3300011269|Ga0137392_10592565 | All Organisms → cellular organisms → Bacteria | 920 | Open in IMG/M |
| 3300012199|Ga0137383_10478906 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium | 912 | Open in IMG/M |
| 3300012199|Ga0137383_11224284 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300012202|Ga0137363_10759841 | All Organisms → cellular organisms → Bacteria | 821 | Open in IMG/M |
| 3300012202|Ga0137363_10857228 | All Organisms → cellular organisms → Bacteria | 771 | Open in IMG/M |
| 3300012205|Ga0137362_11092286 | Not Available | 678 | Open in IMG/M |
| 3300012207|Ga0137381_10519692 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium | 1038 | Open in IMG/M |
| 3300012212|Ga0150985_103645336 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1600 | Open in IMG/M |
| 3300012212|Ga0150985_111512452 | Not Available | 801 | Open in IMG/M |
| 3300012285|Ga0137370_10550414 | Not Available | 710 | Open in IMG/M |
| 3300012351|Ga0137386_11079818 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300012359|Ga0137385_11404540 | Not Available | 561 | Open in IMG/M |
| 3300012361|Ga0137360_10721224 | All Organisms → cellular organisms → Bacteria | 856 | Open in IMG/M |
| 3300012362|Ga0137361_10737108 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 899 | Open in IMG/M |
| 3300012362|Ga0137361_11751865 | Not Available | 540 | Open in IMG/M |
| 3300012363|Ga0137390_10459551 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium | 1249 | Open in IMG/M |
| 3300012685|Ga0137397_11061421 | Not Available | 592 | Open in IMG/M |
| 3300012922|Ga0137394_10169106 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium | 1863 | Open in IMG/M |
| 3300012924|Ga0137413_11045901 | Not Available | 643 | Open in IMG/M |
| 3300012948|Ga0126375_11878510 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300012960|Ga0164301_10786771 | Not Available | 726 | Open in IMG/M |
| 3300012971|Ga0126369_10322413 | All Organisms → cellular organisms → Bacteria | 1555 | Open in IMG/M |
| 3300012971|Ga0126369_10411628 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1392 | Open in IMG/M |
| 3300012971|Ga0126369_11713628 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
| 3300012971|Ga0126369_11943128 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
| 3300012987|Ga0164307_11326008 | Not Available | 603 | Open in IMG/M |
| 3300015264|Ga0137403_10444930 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 1171 | Open in IMG/M |
| 3300015372|Ga0132256_100925532 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 988 | Open in IMG/M |
| 3300016270|Ga0182036_10143792 | All Organisms → cellular organisms → Bacteria | 1689 | Open in IMG/M |
| 3300016270|Ga0182036_10483967 | All Organisms → cellular organisms → Bacteria | 978 | Open in IMG/M |
| 3300016270|Ga0182036_10540357 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 928 | Open in IMG/M |
| 3300016270|Ga0182036_11741669 | Not Available | 527 | Open in IMG/M |
| 3300016319|Ga0182033_10009428 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 5428 | Open in IMG/M |
| 3300016319|Ga0182033_10246005 | All Organisms → cellular organisms → Bacteria | 1450 | Open in IMG/M |
| 3300016319|Ga0182033_11111508 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_58 | 706 | Open in IMG/M |
| 3300016319|Ga0182033_11832534 | Not Available | 551 | Open in IMG/M |
| 3300016341|Ga0182035_10153823 | All Organisms → cellular organisms → Bacteria | 1770 | Open in IMG/M |
| 3300016341|Ga0182035_10663325 | Not Available | 906 | Open in IMG/M |
| 3300016357|Ga0182032_10097987 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2062 | Open in IMG/M |
| 3300016357|Ga0182032_10279563 | Not Available | 1310 | Open in IMG/M |
| 3300016357|Ga0182032_10874108 | All Organisms → cellular organisms → Bacteria | 763 | Open in IMG/M |
| 3300016371|Ga0182034_10675690 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 876 | Open in IMG/M |
| 3300016371|Ga0182034_11911520 | Not Available | 524 | Open in IMG/M |
| 3300016387|Ga0182040_10403218 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 1074 | Open in IMG/M |
| 3300016422|Ga0182039_10245127 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1457 | Open in IMG/M |
| 3300017822|Ga0187802_10459713 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300017928|Ga0187806_1091057 | All Organisms → cellular organisms → Bacteria | 966 | Open in IMG/M |
| 3300017959|Ga0187779_10528357 | Not Available | 783 | Open in IMG/M |
| 3300017959|Ga0187779_10772881 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
| 3300017970|Ga0187783_10220582 | Not Available | 1390 | Open in IMG/M |
| 3300017975|Ga0187782_10920978 | Not Available | 678 | Open in IMG/M |
| 3300018058|Ga0187766_10293209 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 1052 | Open in IMG/M |
| 3300018058|Ga0187766_11152712 | Not Available | 559 | Open in IMG/M |
| 3300018086|Ga0187769_10027958 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3802 | Open in IMG/M |
| 3300018482|Ga0066669_10430577 | Not Available | 1127 | Open in IMG/M |
| 3300020579|Ga0210407_10000515 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 43652 | Open in IMG/M |
| 3300020579|Ga0210407_10318531 | Not Available | 1215 | Open in IMG/M |
| 3300020579|Ga0210407_10329414 | Not Available | 1194 | Open in IMG/M |
| 3300020579|Ga0210407_10358767 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1140 | Open in IMG/M |
| 3300020579|Ga0210407_10433952 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 1028 | Open in IMG/M |
| 3300020580|Ga0210403_10027245 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 4554 | Open in IMG/M |
| 3300020580|Ga0210403_10342213 | All Organisms → cellular organisms → Bacteria | 1224 | Open in IMG/M |
| 3300020580|Ga0210403_10783116 | Not Available | 759 | Open in IMG/M |
| 3300020581|Ga0210399_10685510 | All Organisms → cellular organisms → Bacteria | 843 | Open in IMG/M |
| 3300020581|Ga0210399_10740784 | Not Available | 806 | Open in IMG/M |
| 3300020581|Ga0210399_10771210 | All Organisms → cellular organisms → Bacteria | 787 | Open in IMG/M |
| 3300020583|Ga0210401_10809055 | Not Available | 797 | Open in IMG/M |
| 3300020583|Ga0210401_11292722 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300021168|Ga0210406_10520763 | Not Available | 938 | Open in IMG/M |
| 3300021168|Ga0210406_11049935 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300021168|Ga0210406_11356283 | Not Available | 510 | Open in IMG/M |
| 3300021170|Ga0210400_11114666 | Not Available | 638 | Open in IMG/M |
| 3300021178|Ga0210408_10735305 | Not Available | 775 | Open in IMG/M |
| 3300021178|Ga0210408_11238256 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300021180|Ga0210396_10669605 | Not Available | 898 | Open in IMG/M |
| 3300021362|Ga0213882_10091907 | All Organisms → cellular organisms → Bacteria | 1225 | Open in IMG/M |
| 3300021362|Ga0213882_10126705 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 1041 | Open in IMG/M |
| 3300021401|Ga0210393_10328661 | Not Available | 1244 | Open in IMG/M |
| 3300021401|Ga0210393_10340826 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1220 | Open in IMG/M |
| 3300021403|Ga0210397_11543676 | Not Available | 515 | Open in IMG/M |
| 3300021420|Ga0210394_10064753 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 3172 | Open in IMG/M |
| 3300021432|Ga0210384_11423582 | Not Available | 598 | Open in IMG/M |
| 3300021432|Ga0210384_11549850 | Not Available | 568 | Open in IMG/M |
| 3300021439|Ga0213879_10132904 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
| 3300021444|Ga0213878_10082394 | All Organisms → cellular organisms → Bacteria | 1290 | Open in IMG/M |
| 3300021444|Ga0213878_10091590 | Not Available | 1227 | Open in IMG/M |
| 3300021444|Ga0213878_10173761 | Not Available | 900 | Open in IMG/M |
| 3300021444|Ga0213878_10182202 | Not Available | 880 | Open in IMG/M |
| 3300021476|Ga0187846_10011039 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 4349 | Open in IMG/M |
| 3300021476|Ga0187846_10025380 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2720 | Open in IMG/M |
| 3300021476|Ga0187846_10107030 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1200 | Open in IMG/M |
| 3300021476|Ga0187846_10109113 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1187 | Open in IMG/M |
| 3300021559|Ga0210409_10584081 | Not Available | 985 | Open in IMG/M |
| 3300021559|Ga0210409_11354956 | Not Available | 587 | Open in IMG/M |
| 3300021560|Ga0126371_10009688 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 8678 | Open in IMG/M |
| 3300021560|Ga0126371_10124562 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2607 | Open in IMG/M |
| 3300021560|Ga0126371_10295427 | All Organisms → cellular organisms → Bacteria | 1746 | Open in IMG/M |
| 3300021560|Ga0126371_10328443 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1661 | Open in IMG/M |
| 3300021560|Ga0126371_10503727 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 1359 | Open in IMG/M |
| 3300021560|Ga0126371_10748804 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 1124 | Open in IMG/M |
| 3300021560|Ga0126371_10977786 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 989 | Open in IMG/M |
| 3300021560|Ga0126371_11230595 | All Organisms → cellular organisms → Bacteria | 884 | Open in IMG/M |
| 3300021560|Ga0126371_11338514 | Not Available | 849 | Open in IMG/M |
| 3300021560|Ga0126371_11809139 | Not Available | 732 | Open in IMG/M |
| 3300021560|Ga0126371_12146608 | Not Available | 673 | Open in IMG/M |
| 3300021560|Ga0126371_13724329 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300022508|Ga0222728_1083495 | Not Available | 584 | Open in IMG/M |
| 3300022709|Ga0222756_1088785 | Not Available | 515 | Open in IMG/M |
| 3300022724|Ga0242665_10172243 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_1_20CM_3_64_12 | 697 | Open in IMG/M |
| 3300022724|Ga0242665_10221463 | Not Available | 632 | Open in IMG/M |
| 3300022726|Ga0242654_10356408 | Not Available | 552 | Open in IMG/M |
| 3300022726|Ga0242654_10450693 | Not Available | 502 | Open in IMG/M |
| 3300025905|Ga0207685_10740442 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300025910|Ga0207684_10631306 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 913 | Open in IMG/M |
| 3300025915|Ga0207693_10268057 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 1338 | Open in IMG/M |
| 3300025916|Ga0207663_10380715 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 1075 | Open in IMG/M |
| 3300026312|Ga0209153_1090456 | All Organisms → cellular organisms → Bacteria | 1139 | Open in IMG/M |
| 3300026322|Ga0209687_1206748 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300026330|Ga0209473_1055895 | All Organisms → cellular organisms → Bacteria | 1710 | Open in IMG/M |
| 3300026537|Ga0209157_1139338 | Not Available | 1103 | Open in IMG/M |
| 3300026551|Ga0209648_10165852 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1727 | Open in IMG/M |
| 3300026895|Ga0207758_1030253 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300027070|Ga0208365_1049480 | Not Available | 564 | Open in IMG/M |
| 3300027330|Ga0207777_1087990 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300027521|Ga0209524_1106884 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300027537|Ga0209419_1003948 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2205 | Open in IMG/M |
| 3300027655|Ga0209388_1204416 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300027698|Ga0209446_1001293 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 5921 | Open in IMG/M |
| 3300027698|Ga0209446_1002240 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 4722 | Open in IMG/M |
| 3300027703|Ga0207862_1018659 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2067 | Open in IMG/M |
| 3300027767|Ga0209655_10032891 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 1736 | Open in IMG/M |
| 3300027775|Ga0209177_10109698 | All Organisms → cellular organisms → Bacteria | 887 | Open in IMG/M |
| 3300027783|Ga0209448_10193760 | Not Available | 675 | Open in IMG/M |
| 3300027812|Ga0209656_10008551 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 6508 | Open in IMG/M |
| 3300027824|Ga0209040_10223548 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 961 | Open in IMG/M |
| 3300027824|Ga0209040_10240748 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 913 | Open in IMG/M |
| 3300027829|Ga0209773_10271408 | Not Available | 708 | Open in IMG/M |
| 3300027874|Ga0209465_10393119 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
| 3300027882|Ga0209590_11036893 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300028047|Ga0209526_10468155 | Not Available | 826 | Open in IMG/M |
| 3300029636|Ga0222749_10242164 | All Organisms → cellular organisms → Bacteria | 915 | Open in IMG/M |
| 3300029636|Ga0222749_10452999 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
| 3300030967|Ga0075399_11475113 | Not Available | 612 | Open in IMG/M |
| 3300030969|Ga0075394_11529682 | Not Available | 581 | Open in IMG/M |
| 3300031057|Ga0170834_103328611 | Not Available | 715 | Open in IMG/M |
| 3300031057|Ga0170834_106759271 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 1033 | Open in IMG/M |
| 3300031122|Ga0170822_12445495 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1948 | Open in IMG/M |
| 3300031128|Ga0170823_15462280 | Not Available | 658 | Open in IMG/M |
| 3300031446|Ga0170820_14773496 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2692 | Open in IMG/M |
| 3300031469|Ga0170819_11697353 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1534 | Open in IMG/M |
| 3300031543|Ga0318516_10008016 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 4971 | Open in IMG/M |
| 3300031543|Ga0318516_10031717 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 2794 | Open in IMG/M |
| 3300031543|Ga0318516_10072161 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 1916 | Open in IMG/M |
| 3300031543|Ga0318516_10115692 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1526 | Open in IMG/M |
| 3300031543|Ga0318516_10146788 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 1354 | Open in IMG/M |
| 3300031543|Ga0318516_10305341 | All Organisms → cellular organisms → Bacteria | 919 | Open in IMG/M |
| 3300031543|Ga0318516_10453318 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
| 3300031543|Ga0318516_10526122 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 678 | Open in IMG/M |
| 3300031543|Ga0318516_10597269 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300031543|Ga0318516_10870078 | Not Available | 508 | Open in IMG/M |
| 3300031544|Ga0318534_10555175 | Not Available | 654 | Open in IMG/M |
| 3300031561|Ga0318528_10010872 | All Organisms → cellular organisms → Bacteria | 4132 | Open in IMG/M |
| 3300031561|Ga0318528_10033428 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 2539 | Open in IMG/M |
| 3300031561|Ga0318528_10408204 | Not Available | 729 | Open in IMG/M |
| 3300031564|Ga0318573_10228560 | Not Available | 990 | Open in IMG/M |
| 3300031564|Ga0318573_10540766 | Not Available | 627 | Open in IMG/M |
| 3300031564|Ga0318573_10635148 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300031572|Ga0318515_10003579 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 6207 | Open in IMG/M |
| 3300031573|Ga0310915_10127192 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1745 | Open in IMG/M |
| 3300031680|Ga0318574_10279481 | All Organisms → cellular organisms → Bacteria | 968 | Open in IMG/M |
| 3300031680|Ga0318574_10558732 | Not Available | 671 | Open in IMG/M |
| 3300031680|Ga0318574_10574370 | Not Available | 661 | Open in IMG/M |
| 3300031682|Ga0318560_10167061 | All Organisms → cellular organisms → Bacteria | 1168 | Open in IMG/M |
| 3300031682|Ga0318560_10563645 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300031719|Ga0306917_11307781 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300031719|Ga0306917_11333805 | Not Available | 554 | Open in IMG/M |
| 3300031723|Ga0318493_10052448 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1934 | Open in IMG/M |
| 3300031724|Ga0318500_10428321 | Not Available | 660 | Open in IMG/M |
| 3300031736|Ga0318501_10171871 | All Organisms → cellular organisms → Bacteria | 1124 | Open in IMG/M |
| 3300031744|Ga0306918_10615216 | All Organisms → cellular organisms → Bacteria | 851 | Open in IMG/M |
| 3300031744|Ga0306918_11313803 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300031747|Ga0318502_10825141 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300031747|Ga0318502_10976112 | Not Available | 516 | Open in IMG/M |
| 3300031747|Ga0318502_11005874 | Not Available | 508 | Open in IMG/M |
| 3300031748|Ga0318492_10141882 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1207 | Open in IMG/M |
| 3300031748|Ga0318492_10245417 | All Organisms → cellular organisms → Bacteria | 924 | Open in IMG/M |
| 3300031748|Ga0318492_10762095 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300031751|Ga0318494_10160512 | Not Available | 1269 | Open in IMG/M |
| 3300031753|Ga0307477_10001510 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 19431 | Open in IMG/M |
| 3300031764|Ga0318535_10503915 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300031768|Ga0318509_10356501 | All Organisms → cellular organisms → Bacteria | 819 | Open in IMG/M |
| 3300031768|Ga0318509_10677946 | Not Available | 573 | Open in IMG/M |
| 3300031768|Ga0318509_10792535 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300031770|Ga0318521_10168269 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1252 | Open in IMG/M |
| 3300031770|Ga0318521_11032216 | Not Available | 504 | Open in IMG/M |
| 3300031771|Ga0318546_10877073 | Not Available | 632 | Open in IMG/M |
| 3300031779|Ga0318566_10161433 | All Organisms → cellular organisms → Bacteria | 1111 | Open in IMG/M |
| 3300031781|Ga0318547_11011875 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300031782|Ga0318552_10185556 | All Organisms → cellular organisms → Bacteria | 1051 | Open in IMG/M |
| 3300031782|Ga0318552_10680044 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300031793|Ga0318548_10470232 | Not Available | 615 | Open in IMG/M |
| 3300031793|Ga0318548_10505436 | Not Available | 590 | Open in IMG/M |
| 3300031796|Ga0318576_10016681 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2838 | Open in IMG/M |
| 3300031796|Ga0318576_10144096 | Not Available | 1109 | Open in IMG/M |
| 3300031799|Ga0318565_10489647 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300031805|Ga0318497_10699678 | Not Available | 568 | Open in IMG/M |
| 3300031832|Ga0318499_10235091 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
| 3300031833|Ga0310917_10559976 | Not Available | 777 | Open in IMG/M |
| 3300031835|Ga0318517_10426998 | Not Available | 598 | Open in IMG/M |
| 3300031859|Ga0318527_10180020 | All Organisms → cellular organisms → Bacteria | 892 | Open in IMG/M |
| 3300031860|Ga0318495_10480061 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300031879|Ga0306919_10010011 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 5305 | Open in IMG/M |
| 3300031879|Ga0306919_10156380 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1666 | Open in IMG/M |
| 3300031880|Ga0318544_10216752 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
| 3300031880|Ga0318544_10431942 | Not Available | 512 | Open in IMG/M |
| 3300031890|Ga0306925_10022515 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 6317 | Open in IMG/M |
| 3300031890|Ga0306925_10034350 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 5205 | Open in IMG/M |
| 3300031896|Ga0318551_10682015 | Not Available | 595 | Open in IMG/M |
| 3300031897|Ga0318520_11001736 | Not Available | 528 | Open in IMG/M |
| 3300031910|Ga0306923_10411658 | All Organisms → cellular organisms → Bacteria | 1537 | Open in IMG/M |
| 3300031910|Ga0306923_11272864 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
| 3300031910|Ga0306923_11886531 | Not Available | 611 | Open in IMG/M |
| 3300031912|Ga0306921_10131018 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2927 | Open in IMG/M |
| 3300031912|Ga0306921_11225853 | Not Available | 834 | Open in IMG/M |
| 3300031912|Ga0306921_11289409 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 809 | Open in IMG/M |
| 3300031941|Ga0310912_11349155 | Not Available | 540 | Open in IMG/M |
| 3300031942|Ga0310916_10045468 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3329 | Open in IMG/M |
| 3300031945|Ga0310913_10957156 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300031946|Ga0310910_10215438 | All Organisms → cellular organisms → Bacteria | 1493 | Open in IMG/M |
| 3300031946|Ga0310910_11329503 | Not Available | 555 | Open in IMG/M |
| 3300031947|Ga0310909_10206183 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1635 | Open in IMG/M |
| 3300031954|Ga0306926_11038633 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 973 | Open in IMG/M |
| 3300031954|Ga0306926_11806484 | Not Available | 694 | Open in IMG/M |
| 3300031962|Ga0307479_10263979 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 1701 | Open in IMG/M |
| 3300031981|Ga0318531_10142755 | Not Available | 1070 | Open in IMG/M |
| 3300032001|Ga0306922_11733189 | Not Available | 617 | Open in IMG/M |
| 3300032009|Ga0318563_10549027 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300032035|Ga0310911_10882959 | Not Available | 516 | Open in IMG/M |
| 3300032041|Ga0318549_10073603 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1454 | Open in IMG/M |
| 3300032055|Ga0318575_10103336 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1384 | Open in IMG/M |
| 3300032055|Ga0318575_10345124 | All Organisms → cellular organisms → Bacteria | 754 | Open in IMG/M |
| 3300032076|Ga0306924_11715831 | Not Available | 658 | Open in IMG/M |
| 3300032089|Ga0318525_10725524 | Not Available | 505 | Open in IMG/M |
| 3300032090|Ga0318518_10062931 | All Organisms → cellular organisms → Bacteria | 1792 | Open in IMG/M |
| 3300032090|Ga0318518_10110531 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 1378 | Open in IMG/M |
| 3300032091|Ga0318577_10325493 | Not Available | 735 | Open in IMG/M |
| 3300032094|Ga0318540_10629457 | Not Available | 517 | Open in IMG/M |
| 3300032180|Ga0307471_104187948 | Not Available | 509 | Open in IMG/M |
| 3300032205|Ga0307472_100248495 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1393 | Open in IMG/M |
| 3300032205|Ga0307472_100269797 | All Organisms → cellular organisms → Bacteria | 1348 | Open in IMG/M |
| 3300032205|Ga0307472_101211149 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
| 3300032261|Ga0306920_101867933 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 846 | Open in IMG/M |
| 3300033290|Ga0318519_10269000 | All Organisms → cellular organisms → Bacteria | 991 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 31.35% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 13.51% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.73% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.49% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 6.22% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 4.59% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.32% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.51% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.24% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.89% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.89% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.62% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.62% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 1.35% |
| Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 1.35% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 1.08% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.81% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.54% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.54% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.54% |
| Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.54% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.54% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.54% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.27% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.27% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.27% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.27% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.27% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2189573004 | Grass soil microbial communities from Rothamsted Park, UK - FG2 (Nitrogen) | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
| 3300003219 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 | Environmental | Open in IMG/M |
| 3300003368 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021362 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R09 | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021439 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R03 | Environmental | Open in IMG/M |
| 3300021444 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R02 | Environmental | Open in IMG/M |
| 3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022508 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-19-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022709 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026312 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes) | Environmental | Open in IMG/M |
| 3300026322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
| 3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026895 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 12 (SPAdes) | Environmental | Open in IMG/M |
| 3300027070 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF004 (SPAdes) | Environmental | Open in IMG/M |
| 3300027330 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 35 (SPAdes) | Environmental | Open in IMG/M |
| 3300027521 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027537 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027698 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027703 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 81 (SPAdes) | Environmental | Open in IMG/M |
| 3300027767 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027829 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030967 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA11 Emin (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030969 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA12 Emin (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031122 | Oak Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031832 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
| 3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FG2_06909540 | 2189573004 | Grass Soil | MQDWISDWKRSSPTERWFAIALVILCLMIPLGFLIGA |
| JGI12627J18819_102904071 | 3300001867 | Forest Soil | MQDWISDWKKWSRAERCFAVVLVIVALMIPLGVLFRGGISGT* |
| JGI12627J18819_103230432 | 3300001867 | Forest Soil | MKDWISDWKRWSRAERCFAVALVILSLVIPLGFLIGGRMIGT* |
| JGI12627J18819_103887262 | 3300001867 | Forest Soil | MQDWISDWKRWSRAERCLAVALAILSVVIPLGFLVGGRIIGT* |
| JGIcombinedJ26739_1009567551 | 3300002245 | Forest Soil | MQDWISDWKRWSRAERCFAIALAILSLAVPLGLLIGGRIIGI* |
| C688J35102_1199059451 | 3300002568 | Soil | VTGGWGLMNDWISDWKRWSRAERCFAIALVILSLAVPFGLLIGGRIIGT* |
| JGI25617J43924_101603752 | 3300002914 | Grasslands Soil | MKDWISDWKRWSRAERCFAIALVILSLAVPFGLVIGGRIIGT* |
| JGI26341J46601_100013132 | 3300003219 | Bog Forest Soil | MRDWISDWKRWSRAERCFAIMLVIIALVLPLGLLIVGGRIGS* |
| JGI26341J46601_100591002 | 3300003219 | Bog Forest Soil | MRDWISDWKKWSRAERCFAILLVIIALAFPLGLLIEGGRIGS* |
| JGI26340J50214_100088435 | 3300003368 | Bog Forest Soil | MQDWISDWKRWSRAERCFAIALVILSLVLPLGVLIGGRMIGT* |
| JGIcombinedJ51221_103679642 | 3300003505 | Forest Soil | VTGGHCLMQDWISDWKRWSRAERCFAIALVILSLVVPLGLLIGGHIVGI* |
| Ga0062385_101723461 | 3300004080 | Bog Forest Soil | MRDWISDWKKWSRAERCFAIMLVVIALVLPLGLLIVGGRIGS* |
| Ga0062386_1000997104 | 3300004152 | Bog Forest Soil | MRDWISDWNRWSRAERFVAVALVILTLALPLGLALAGGG* |
| Ga0062386_1001395683 | 3300004152 | Bog Forest Soil | MRDLISDWKKWSRTERWLAIALVVLSLALPVGLAIVGGKIGS* |
| Ga0062386_1005103331 | 3300004152 | Bog Forest Soil | DWISDWKKWSRAERCFAIMLVVIALVLPLGLLIVGGRIGS* |
| Ga0062386_1013341531 | 3300004152 | Bog Forest Soil | DWISDWKKWSRAERCFAIMLLVIALVLPLGLLIVGERIGS* |
| Ga0066395_100965793 | 3300004633 | Tropical Forest Soil | MRDWISDWKKWSHAERCFAIMLVIIALALPLGLLIAGERIGS* |
| Ga0066395_105612901 | 3300004633 | Tropical Forest Soil | MQDWISDWKRWSRAERCFAIALVILSLVIPLGLLIGGGIRGI* |
| Ga0062388_1008732212 | 3300004635 | Bog Forest Soil | MRDWISDWKKWSHAERCFAIMLVIIALVLPLGLLIVGERIGS* |
| Ga0066672_108108452 | 3300005167 | Soil | MKDWISDWKRWSRAERCFAIALVILSLAVPFGLLIGGRIIGT* |
| Ga0066677_101606142 | 3300005171 | Soil | MQDWISDWKRWSRAERCFAIVLVILSLVIPLGFLVGGRMIGT* |
| Ga0066673_106984581 | 3300005175 | Soil | MRDWISDWKRWSRAERWFAVVLAILALAFPLGLLISAGRIGI* |
| Ga0066679_108527631 | 3300005176 | Soil | MQDWISDWKRWTRAERCLAIVLVVLALAFPLGMLIGSGRIGI* |
| Ga0066685_103599242 | 3300005180 | Soil | MRDWILDWKRWSRAERCFAVVLAILALAFPLGLLISAGRIGI* |
| Ga0066675_108860292 | 3300005187 | Soil | MRDWVSDWKRWSRAERWFAVALVVLALALPFGMLIGSIRIGI* |
| Ga0066388_1007279893 | 3300005332 | Tropical Forest Soil | MRDWISDWKRWSRAERCFAIMLIILALVIPLGFLIRGGISGT* |
| Ga0066388_1014226032 | 3300005332 | Tropical Forest Soil | MRDWISDWKKWSRAERWFAIMLIIIALVLPLGLLIIGERVGS* |
| Ga0066388_1027249181 | 3300005332 | Tropical Forest Soil | MQDWISDWKRWSRAERFLAIALVILSLVIPLGFLVGGRITGI* |
| Ga0066388_1027744082 | 3300005332 | Tropical Forest Soil | MQDWISDWKRWSRAERCFAIALVILSLVIPLGLLIGGGIGGI* |
| Ga0066388_1062943121 | 3300005332 | Tropical Forest Soil | MRDWVSDWKKWSRAERCFAIMLVIIALVLPLGLLIVGERIGS* |
| Ga0008090_100218493 | 3300005363 | Tropical Rainforest Soil | MQDWISDWKRWSRAERCFAIMLVIMALMLPLGLLIAGERVGI* |
| Ga0070711_1005187242 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MKDWISDWKRWSRAERCFAIALVILSLVIPLGVLIGGRIVGT* |
| Ga0070711_1013310142 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MQDWISDWKRWSRAERCFAIVLVILSLMIPLGLLIRGGT* |
| Ga0070706_1003389072 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MQDWISDWKKWSRAERCFAIVLVVLALMIPLGLLIRGGISGT* |
| Ga0070707_1023057032 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MRDWISDWKRWSRAERCFAVVLAILALAFPLGILISAGRIGI* |
| Ga0070698_1004375482 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MQDWISDWKRWSRAERCFAIVLVILSLVIPLGLLIHGGT* |
| Ga0070699_1009589872 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MRDWISDWKRWSRAERCFAVVLAILALAFPLGILISAGRIAI* |
| Ga0070697_1004713581 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MRDWISDWKRWSRAERCFAVVLAILALAFPLGLLISAGRIGI* |
| Ga0066704_105572692 | 3300005557 | Soil | MRDWIADWRRWSRAERCFAIALVILSLVIPLGLLIGGGT* |
| Ga0066670_100644682 | 3300005560 | Soil | MQDWISDWKRWSRAERCFAVALVILSLVIPLGFLVGGRMIGT* |
| Ga0066703_104584442 | 3300005568 | Soil | VWPGGWGLMKDWISDWKRWSRAERCFAIALVILSLVIPLGVLIGGRIVGT* |
| Ga0066694_101589631 | 3300005574 | Soil | DWKRWSRAERCFAVVLAILALAFPLGLLISAGRIGI* |
| Ga0066903_1000966753 | 3300005764 | Tropical Forest Soil | MQDWISDWKRWSRAERFLAIALVILSLVIPLGFLVGGRISGI* |
| Ga0066903_1006932043 | 3300005764 | Tropical Forest Soil | VTGGWPFMQDWISDWKRWSRAERCFAIALVILSLVIPLGLLIGGGIGGI* |
| Ga0066903_1009439513 | 3300005764 | Tropical Forest Soil | MRDWISDWKKWSRAERCFAIMLVIIALVVPLGLVIVGERLHS* |
| Ga0066903_1011057312 | 3300005764 | Tropical Forest Soil | MRDWVSDWKKWSRTERCFAIALLITALAVPYGLLIGGGRMGS* |
| Ga0066903_1016701531 | 3300005764 | Tropical Forest Soil | GEPRVAGGCCHMRDWIADWKRWSRAERCVAIALLLLSLAIPLGLLIRPT* |
| Ga0066903_1019027402 | 3300005764 | Tropical Forest Soil | MHDLISDWKKWSRAERCFAIALVIVALAIPLGLLIEGARIGS* |
| Ga0066903_1028336112 | 3300005764 | Tropical Forest Soil | MHDWISDWKRWSRAERCFAIMLVIIALALPLGLLIAGERIGS* |
| Ga0066903_1029205692 | 3300005764 | Tropical Forest Soil | MQDWVSDWKRWSRAERCFAIMLVILALMIPLGMLLRGGISGT* |
| Ga0066903_1060971382 | 3300005764 | Tropical Forest Soil | MSDWVSDWKRWSRAERCLAIALAALALALPLGLLIGRSRIGI* |
| Ga0066903_1071675811 | 3300005764 | Tropical Forest Soil | MRDWISDWKKWSRAERCFAIMLVIIALVIPLGLVIVGERIGI* |
| Ga0066903_1071855092 | 3300005764 | Tropical Forest Soil | MRDWIADWKRWSRAERCVAIALVLLSLAIPLGLLI |
| Ga0066903_1081307931 | 3300005764 | Tropical Forest Soil | VLQGLDQMQDWISDWKRWSPAERCVAVALVILSLVLPLGVLVGGRIIGT* |
| Ga0070766_100091024 | 3300005921 | Soil | MQDWISDWKRWSRAERCFAIALVILSLVVPLGLLIGGHIVGI* |
| Ga0081540_10432635 | 3300005983 | Tabebuia Heterophylla Rhizosphere | MQDWISDWKRWSRAERCFAIALVILCLMIPLGFLIGGGIIGT* |
| Ga0081540_11457403 | 3300005983 | Tabebuia Heterophylla Rhizosphere | MQDWISDWKRWSRAERCFAIALVILCLMIPLGFLIGGSITG |
| Ga0070717_111455661 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | VTGGHRDMQDWISDWKRWSRAERCFAVALVILSLVIPLGFLIGGRMIGT* |
| Ga0070716_1001802582 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MTGGYCLMQDWISDWKRWSRAERCFASALVILSLAVPFGLLIGGRIIGT* |
| Ga0070712_1000902763 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MQDWISDWKRWSRAERCFAVALVILSLVIPLGFLIGGRMIGT* |
| Ga0070712_1003440473 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MQDWISDWKKWSRAERCFAIVLVVLALMIPLGLLIRGGINGT* |
| Ga0070712_1015792102 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | VTGGHCLMQDWISDWKRWSRAERCFAIVLVILSLVVPLGLLIGGHIVGI* |
| Ga0070765_1001154163 | 3300006176 | Soil | MQDWISDWKRWSLAERCFAIALVILSLVVPLGLLIGGHIVGI* |
| Ga0070765_1009326691 | 3300006176 | Soil | MKDWISDWKRWSRAERCFAVALVILSLVIPLGFLVGGRMIGS* |
| Ga0066659_115106372 | 3300006797 | Soil | MRDWISDWKRWSRAERCFAVALAILALAFPLGLLISAARIGI* |
| Ga0079220_105005361 | 3300006806 | Agricultural Soil | MQDWISDWKRWSRAERCFAVVLVIVALMIPLGVLFRGGIS |
| Ga0099791_105272952 | 3300007255 | Vadose Zone Soil | MRDWVSDWKRWSRAERWFAVALVVLALTLPLGMLIGSIRIGI* |
| Ga0099795_100493462 | 3300007788 | Vadose Zone Soil | MQDWISDWKRWSRAERCFAIVLVILSLVIPLGLLIRGGT* |
| Ga0066710_1043241651 | 3300009012 | Grasslands Soil | MRDWISDWKRWSRGERCFAIVLVILALALPLGLLISAGRIGI |
| Ga0099830_104588822 | 3300009088 | Vadose Zone Soil | MQDWISDWKRWSRAERCFAIVLVILSLVIPLGLVIRGGT* |
| Ga0066709_1011246272 | 3300009137 | Grasslands Soil | MQDWISDWKRWSRAERCFAIALVILSLVIPLGVLVGGRIIGI* |
| Ga0066709_1032374072 | 3300009137 | Grasslands Soil | MQDWISDWKLWSRAERCFAVALVVLSLVIPLGFLVGGRMIGT* |
| Ga0099792_102910361 | 3300009143 | Vadose Zone Soil | MQDWISDWKRWSRAERCFAIALAILSLVVPLGLLIGGRIIGV* |
| Ga0126374_101869693 | 3300009792 | Tropical Forest Soil | MRDWISDWKKWSHAERCFAIMLVIIALALPLGLLIAGERI |
| Ga0126374_115217211 | 3300009792 | Tropical Forest Soil | PVMRDWISDWKRWSRAERCFAIVLVILSLVIPLGLMIGT* |
| Ga0126380_108707682 | 3300010043 | Tropical Forest Soil | MRDWISDWKKWSRAERCFAIMLVIIALALPLGLLIAGERIGS* |
| Ga0126384_123188652 | 3300010046 | Tropical Forest Soil | MQDWISDWKRWSRAERCFAIALVILCLMIPLGFLIGGSIAGT* |
| Ga0126373_100507422 | 3300010048 | Tropical Forest Soil | MQDWISDWKRWSPAERCVAVALVILSLVLPLGVLVGGRIIGT* |
| Ga0126373_105078453 | 3300010048 | Tropical Forest Soil | MGDWISDWKRWSRAERCFAIMLLIIALVLPLGLLIVGERIGI* |
| Ga0126373_108914752 | 3300010048 | Tropical Forest Soil | MRDWIADWKRWSRAERCVAIALVILSLAIPLGLLIRPT* |
| Ga0126373_111566832 | 3300010048 | Tropical Forest Soil | MRDWIADWKRWSRAERCFAIALAILSLAIPLGLLLSPT* |
| Ga0126373_112024181 | 3300010048 | Tropical Forest Soil | WKKWSRAERCFAIMLVIIALVLPLGLLIVGERIGS* |
| Ga0126373_112726571 | 3300010048 | Tropical Forest Soil | MRDLISDWKKWSRAERCFAIALVIVALALPLGLLIEGTRIGS* |
| Ga0126373_112936632 | 3300010048 | Tropical Forest Soil | MGDWISDWKRWSRAERCFAIMLLIVALVLPLGLLIVGERIGI* |
| Ga0126373_113343512 | 3300010048 | Tropical Forest Soil | MRDWVSDWKKWSRTERCFAIVLVITALAVPFGLLIGGARVGS* |
| Ga0126373_129397032 | 3300010048 | Tropical Forest Soil | MQDWISDWKRWSRAERCFAVVLVIVALMIPLGVLFRGGISGT* |
| Ga0127503_101862331 | 3300010154 | Soil | MHDWISDWKKWSRAERCFAIMLVIIALALPLGLLIAGERIGI* |
| Ga0127503_106844772 | 3300010154 | Soil | DWISDWKKWSRAERCFAIMLVIIALALPLGLLIAGERMGS* |
| Ga0127503_107090021 | 3300010154 | Soil | MTQCSAGAVEMRDWISDWKRWSRAERCFAVVLAILALAFPLGILISAGRIGV* |
| Ga0127503_109349271 | 3300010154 | Soil | MRDWVSDWKRWSRAERWFAVALAVLALALPLGMLIGSVRIGI* |
| Ga0127503_112279592 | 3300010154 | Soil | RMHDWISDWKKWSRAERCFAIMLVVIALALPLGLLIAGERIGS* |
| Ga0074044_102919522 | 3300010343 | Bog Forest Soil | MRDWISDWKKWSHAERCFAILLVIIALVFPLGLLIVGERIGS* |
| Ga0126370_101701102 | 3300010358 | Tropical Forest Soil | MMRDWIADWKRWSRAERCVAIALVLLSLAIPLGLLIRPT* |
| Ga0126376_103708941 | 3300010359 | Tropical Forest Soil | MRDWIADWKRWSRAERCVAIALVILSLAIPLGVLIRPT* |
| Ga0126376_122081191 | 3300010359 | Tropical Forest Soil | MQDWISDWKRWSRAERCFAIALVILCLMIPLGFLIGGSIIGT* |
| Ga0126372_119228132 | 3300010360 | Tropical Forest Soil | DWIADWKRWSRAERCLAIVLVVLSLAIPLGLLLGPT* |
| Ga0126372_127611352 | 3300010360 | Tropical Forest Soil | TMRDWISDWKRWSRAERCFAIMLIILALVIPLGFLIRGGISGT* |
| Ga0126378_102821621 | 3300010361 | Tropical Forest Soil | MRDLISDWKKWSRAERCFAIALVIVALALPLGLLIEGGRIGS* |
| Ga0126378_103307712 | 3300010361 | Tropical Forest Soil | MQVWISDWKRWSRAERFLAIALVILSLVIPLGFLVGGRITGI* |
| Ga0126378_129729121 | 3300010361 | Tropical Forest Soil | MRDWISDWKKWSRAERCFAIMLVVIALALPLGLLIAGERIGS* |
| Ga0126379_103092694 | 3300010366 | Tropical Forest Soil | KRWSRAERCFAIALVILSLVIPLGLLIGGGIRGI* |
| Ga0134128_106057042 | 3300010373 | Terrestrial Soil | VQDWIADWKRWSRAERWFAIALVILSLAIPLGLMIST* |
| Ga0126381_1008697812 | 3300010376 | Tropical Forest Soil | MRDWIADWKRWSRGERCVAIALVILSVAIPLGLLIRPA* |
| Ga0126381_1012280382 | 3300010376 | Tropical Forest Soil | WISDWKRWSRAERFLAIALVILSLVIPLGFLVGGRISGI* |
| Ga0126381_1012456372 | 3300010376 | Tropical Forest Soil | MQDWISDWKKWSRAERCFAIALVILSLVIPLGLLIGGGIGGI* |
| Ga0126381_1015527352 | 3300010376 | Tropical Forest Soil | MRDWISDWKKWSRAERCFAIMLVIIALALPLGLLIAGE |
| Ga0126381_1019407362 | 3300010376 | Tropical Forest Soil | MGDWISDWKRWSRAERCFAIMLVVIALALPLGLLIAGERIGS* |
| Ga0126381_1019657622 | 3300010376 | Tropical Forest Soil | MGDWISDWKRWSRAERCFAIMLLIIALVLPLGLLIVGE |
| Ga0126381_1026068011 | 3300010376 | Tropical Forest Soil | MRDWIADWKRWSRAERCVAIALVLLSLAIPLGLLIR |
| Ga0126381_1032226742 | 3300010376 | Tropical Forest Soil | MRDWVSDWKRWSRAERCFAIMLVVIVLMLPLGLLIAGERIGS* |
| Ga0126381_1040910111 | 3300010376 | Tropical Forest Soil | MRDWISDWKRWSRAERCAAIALVVLSLALPVGLVLAGTRLGS |
| Ga0126381_1050051541 | 3300010376 | Tropical Forest Soil | MRDWISDWKRWSRAERCFATMLFIIALVLPLGLLIVGERIGI* |
| Ga0126383_116818452 | 3300010398 | Tropical Forest Soil | MRDWISDWKRWSRAERCFAIMLLIIALVLPLGLLIVGERIGI* |
| Ga0150983_116888252 | 3300011120 | Forest Soil | DWISDWKRWSRAERCFAVVLAILALAFPLGILISAGRIGV* |
| Ga0150983_126781682 | 3300011120 | Forest Soil | CLMQDWISDWKRWSRAERCFAIALVILSLVVPLGLLIGGRIIGI* |
| Ga0150983_163132911 | 3300011120 | Forest Soil | MRDWISDWKKWSRAERCFPIMLVIIALALPLGLLIAGERIGS* |
| Ga0137392_105925653 | 3300011269 | Vadose Zone Soil | MRDWIADWRRWSRAERCFAIALLILSLVIPLGLLIGG |
| Ga0137383_104789062 | 3300012199 | Vadose Zone Soil | MQDWISDWKRWSRAERCFAIVLVILSLVIPLGLLIGGVT* |
| Ga0137383_112242842 | 3300012199 | Vadose Zone Soil | MQDWISDWKRWSRAERCFAIALVILSLVIPLGFMIGT* |
| Ga0137363_107598411 | 3300012202 | Vadose Zone Soil | MRDWISDWKRWSRAERCFAVVLAILALAFPLGILISAGRIGV* |
| Ga0137363_108572282 | 3300012202 | Vadose Zone Soil | MRDWMSDWKRWSRGERCFAIVLAILALALPLGLLISAGRIGI* |
| Ga0137362_110922862 | 3300012205 | Vadose Zone Soil | MQDWISDWKRWSRAERCFAIALVILSLVVPLGVLVGGRMIGI* |
| Ga0137381_105196922 | 3300012207 | Vadose Zone Soil | MQDWISDWKRWSRAERCFAIVLVILSLVIPLGLLIGGGT* |
| Ga0150985_1036453363 | 3300012212 | Avena Fatua Rhizosphere | MQDWISDWKRWSRAERCFAIALVILCLTIPLGFLIGGGIIGT* |
| Ga0150985_1115124521 | 3300012212 | Avena Fatua Rhizosphere | VQDWIADWKRWSRAERCFAIALVILSLMVIPFGLMIST* |
| Ga0137370_105504142 | 3300012285 | Vadose Zone Soil | MQDWISDWKRWSRAERCFAIALVILSLAIPLGLLIGGGVMGT* |
| Ga0137386_110798182 | 3300012351 | Vadose Zone Soil | MQDWISDWKRWSRAERCFAIVLVILSLVIPLGLLIG |
| Ga0137385_114045402 | 3300012359 | Vadose Zone Soil | CRMRDLISDWKRWSRAERCAAIALVILSLALPVGLVLAGGNIGS* |
| Ga0137360_107212242 | 3300012361 | Vadose Zone Soil | MRDWISDWKRWSRAERCFAVVLAILALAFPLGILISGGRFGI* |
| Ga0137361_107371082 | 3300012362 | Vadose Zone Soil | MQDWISDWKRWSRAERCFAIALVILSLVIPLGVLVGGRMIGI* |
| Ga0137361_117518652 | 3300012362 | Vadose Zone Soil | MSDWKRWSRGERCFAIVLAILALALPLGLLISAGRIGI* |
| Ga0137390_104595512 | 3300012363 | Vadose Zone Soil | MRDCVSDWKRWSRAERWFAVALVVLALTLPLGMLIGSIRIGI* |
| Ga0137397_110614212 | 3300012685 | Vadose Zone Soil | MQDWISDWKRWSRAERCFAIALVILSLVIPLGLLIRGGT* |
| Ga0137394_101691062 | 3300012922 | Vadose Zone Soil | MRDWVSDWKRWSRAERWFAVALVVLALTLPLGTLIGSIRIGI* |
| Ga0137413_110459012 | 3300012924 | Vadose Zone Soil | MKDWISDWKRWSRAERCFAIVLVILSLVVPLGLLIGGHIVGI* |
| Ga0126375_118785102 | 3300012948 | Tropical Forest Soil | MQDWISDWKRWSRAERCFAIALVILCLMIPLGFLIGG |
| Ga0164301_107867711 | 3300012960 | Soil | MQDWISDWKRWSRAERCFAIVLVILSLVVPLGLLIGGHIVGI* |
| Ga0126369_103224133 | 3300012971 | Tropical Forest Soil | MQDWISDWKRWSRAERLLAVALVILSLVIPLGFLVGGRITGI* |
| Ga0126369_104116283 | 3300012971 | Tropical Forest Soil | MRDWISDWKKWSHAERCFAIMLVIITLALPLGLLIAGERIGS* |
| Ga0126369_117136281 | 3300012971 | Tropical Forest Soil | MRDWIADWKRWSRAERCVAIALVLLSLAIPLGLLIRPT* |
| Ga0126369_119431282 | 3300012971 | Tropical Forest Soil | MRDWISDWKRWSGAERCFAVMLVIIALVLPLGLLIVGGRIGS* |
| Ga0164307_113260082 | 3300012987 | Soil | MQDWISDWKRWSRAERRFASALVILSLAVPFGLLIGGRIIGT* |
| Ga0137403_104449302 | 3300015264 | Vadose Zone Soil | MQDWISDWKRWSRAERCFAIALVILSLVIPLGFLFSGGITGT* |
| Ga0132256_1009255322 | 3300015372 | Arabidopsis Rhizosphere | MKDWISDWKRWSRTERCFAIALVILSLVVPLGLLIGGGIIGT* |
| Ga0182036_101437923 | 3300016270 | Soil | MRDCISDWKKWSRAERCLAILLVIIALVLPLGLLMVGERIGS |
| Ga0182036_104839671 | 3300016270 | Soil | MRDLISDWKKWSRAERCFAIALVIVALALPLGLLLEAGRIGS |
| Ga0182036_105403572 | 3300016270 | Soil | MRDLISDWKKWSRAERCFAIMLVIIALVVPLGLVIAGERIGI |
| Ga0182036_117416692 | 3300016270 | Soil | WISDWKKWSRAERCFAILLVIVALVFPLGLLIVGERIGS |
| Ga0182033_100094281 | 3300016319 | Soil | RMRDWISDWKKWSRAERWFAIMLIIIALVLPLGLLIIGERVGS |
| Ga0182033_102460051 | 3300016319 | Soil | VQDWIADWKRWSRAERCFAIALVILSLVIPLGFLIG |
| Ga0182033_111115081 | 3300016319 | Soil | ISDWKRWSRAERCFAVVLVIVALMIPLGVLFRGGISGT |
| Ga0182033_118325341 | 3300016319 | Soil | MRDWISDWKKWSRVERCFAIMLVIIALVLPLGLLIIGERVGS |
| Ga0182035_101538234 | 3300016341 | Soil | MQDWISDWKRWSRAERCFAIALVILSLVIPLGFLIGGGRHGS |
| Ga0182035_106633251 | 3300016341 | Soil | WIADWKRWSRAERCVAIALVLLSLAIPLGLLIRPT |
| Ga0182032_100979873 | 3300016357 | Soil | VQDWIADWKRWSRAERCFAIALVILSLVIALGFLIGGRMIGT |
| Ga0182032_102795633 | 3300016357 | Soil | GVWRDRLMRDWISDWKRWSRAERCFAIMLFIIALALPLGLLIVGERIGI |
| Ga0182032_108741082 | 3300016357 | Soil | MGDWISDWKKWSRAERCFAIMLVIIALMLPLGLLIVGER |
| Ga0182034_106756902 | 3300016371 | Soil | MRDLISDWKKWSRAERCFAIALVIVVLALPLGLLIEGSRIGS |
| Ga0182034_119115202 | 3300016371 | Soil | MRDWISDWKRWSRAERCFAIMLFIIALVLPLGLLIVSERISS |
| Ga0182040_104032182 | 3300016387 | Soil | MRDWISDWKRWSRAERCFAIMLVIIALVLPLGLLIAGGKIGS |
| Ga0182039_102451273 | 3300016422 | Soil | MQDWISDWKRWSRAERCFAIALVILSLVIPLGLLI |
| Ga0187802_104597131 | 3300017822 | Freshwater Sediment | MRDWISDWKKWSPAERCFAILLAIIALALPLGLLIEGGRIGS |
| Ga0187806_10910572 | 3300017928 | Freshwater Sediment | MRDWISDWKKWSPAERCFAILLVIIALALPLGLLIEGS |
| Ga0187779_105283571 | 3300017959 | Tropical Peatland | MRDLISDWKKWSRAERCFAVALVIVALALPLGLLIGGSRIGS |
| Ga0187779_107728812 | 3300017959 | Tropical Peatland | MRDLISDWKRWSAMERWVAIALVVLSLVLASGALIGGLAIGG |
| Ga0187783_102205822 | 3300017970 | Tropical Peatland | MRDLISDWKKWSRTERWFAIALVIIAFALPVGLLIGGSRIGI |
| Ga0187782_109209782 | 3300017975 | Tropical Peatland | MRDLISDWKKWSPAERCFAIALVIVAFALPVGLLIGGSRIGS |
| Ga0187766_102932092 | 3300018058 | Tropical Peatland | MRDLISDWKKWSRAERCFAIAMVIVALALPLGLLMGGTRIGS |
| Ga0187766_111527121 | 3300018058 | Tropical Peatland | MRDWISDWKRWSRAERCFAIMLAIIALALPLGLLIVGERIGI |
| Ga0187769_100279586 | 3300018086 | Tropical Peatland | MRDWISDWKKWSPAERCFAILLAIMALALPLGLLIEGGRIGS |
| Ga0066662_113286912 | 3300018468 | Grasslands Soil | KERVWPGGWGLMQDWISDWKGWSRAERCFAIALVILSLVIPLGFMIGT |
| Ga0066669_104305771 | 3300018482 | Grasslands Soil | MRDWISDWKRWSRAERCFAVVLAILALAFPLGLLITVGRIGI |
| Ga0210407_1000051544 | 3300020579 | Soil | MRDWISDWKRWSRAERCFAVVLAILALAFPLGILISAGRIGV |
| Ga0210407_103185311 | 3300020579 | Soil | MRDWISDWKKWSRAERCFAIMLVIIALALPLGLLIAGERIGI |
| Ga0210407_103294142 | 3300020579 | Soil | MQDWISDWKRWSRAERCFAIALVILSLVVPLGLLIGGHIVGI |
| Ga0210407_103587673 | 3300020579 | Soil | VTGGHCLMQDWISDWKRWSRAERCFAIALVILSLVVPLGLLIGGH |
| Ga0210407_104339522 | 3300020579 | Soil | MRDWISDWKKWSRAERCFAIMLVVIALALPLGLLIAGERIGS |
| Ga0210403_100272456 | 3300020580 | Soil | MRDWISDWKKWSRAERCFAIMLVIIALVLPLGLLIVGERIGS |
| Ga0210403_103422133 | 3300020580 | Soil | MRDWISDWKKWSRAERCFAIMLVIIALALPLGLLIAGERMGS |
| Ga0210403_107831162 | 3300020580 | Soil | MQDWISDWKKWSRAERCFAIALVILSLVIPLGVLVGGRIIGI |
| Ga0210399_106855101 | 3300020581 | Soil | MRDWISDWKKWSRAERCFAIMLVIIALALPLGLLIAGERIGS |
| Ga0210399_107407842 | 3300020581 | Soil | MQDWISDWKRWSRAERCFAIALAILSLAVPLGLLIGGRIIGI |
| Ga0210399_107712102 | 3300020581 | Soil | MKDWISDWKRWSRAERCFAIALVILSLAVPFGLLIGGRII |
| Ga0210401_108090551 | 3300020583 | Soil | MQDWISDWKRWSRAERCFAVALVILSLVIPLGFLFGGRVIGS |
| Ga0210401_112927221 | 3300020583 | Soil | MTGGYCLMQDWISDWKRWSRAERCFAIVLVILSLVVPLGLLI |
| Ga0210406_105207632 | 3300021168 | Soil | WKKWSRAERCFAIMLVIIALALPLGLLIAGERIGI |
| Ga0210406_110499352 | 3300021168 | Soil | MQDWISDWKRWSRAERCFAIVLVILSLVIPLGLLIRGGT |
| Ga0210406_113562832 | 3300021168 | Soil | ARVSAGGFRMRDWISDWKKWSRAERCFAIMLVIIALALPLGLLIAGERIGS |
| Ga0210400_111146662 | 3300021170 | Soil | DMQDWISDWKRWSRAERCFAIVLVILSLVIPLGLLIRGGT |
| Ga0210408_107353051 | 3300021178 | Soil | MQDWISDWKRWSRAERCFAIALVILSLVVPLGLLIGGRIIGI |
| Ga0210408_112382561 | 3300021178 | Soil | MQDWISDWKKWSRAERCFAIVLVVLALMIPLGLLIRGGISGT |
| Ga0210396_106696051 | 3300021180 | Soil | MKDWISDWKRWSRAERCFAIALVILSLVIPLGFMIGGRMIGT |
| Ga0213882_100919072 | 3300021362 | Exposed Rock | MRDWIADWKRWSVAERCLAIALVILSVAIPLGLLITPT |
| Ga0213882_101267052 | 3300021362 | Exposed Rock | MQDWISDWKRWSRAERCFAIALVILSLVIPLGLLIGGGIRGI |
| Ga0210393_103286611 | 3300021401 | Soil | QDWISDWKRWSRAERCFAIALVILSLVVPLGLLIGGHIVGI |
| Ga0210393_103408261 | 3300021401 | Soil | VTGGHCLMQDWISDWKRWSRAERCFAIALVILSLVVPIGLLIGGHIV |
| Ga0210397_115436762 | 3300021403 | Soil | MKDWISDWKRWSRAERCFASALVILSLAVPFGLLIGGRIIGT |
| Ga0210394_100647533 | 3300021420 | Soil | MQDWISDWKRWSRAERCFAIALVILSLVVPIGLLIGGHIVGI |
| Ga0210384_114235821 | 3300021432 | Soil | MRDWIADWKRWSRAERCFAIALVILSLVIPLGLLIGRA |
| Ga0210384_115498502 | 3300021432 | Soil | MRDWVSDWKRWSRAERWFAVALAVLALALPLGMLIGSVRIGI |
| Ga0213879_101329042 | 3300021439 | Bulk Soil | MRDWIADWKRWSRAERCLAIALVILSLAIPLGLLIRPT |
| Ga0213878_100823943 | 3300021444 | Bulk Soil | MRDWISDWKKWSRAERCFAIMLVIIALVLPLGLLIIGERIGS |
| Ga0213878_100915903 | 3300021444 | Bulk Soil | MRDLISDWKKWSRAERCFAIALVIVALALPLGLLIEGGRIGS |
| Ga0213878_101737612 | 3300021444 | Bulk Soil | MRDWVADWKRWSRAERCFAIALLVTALALPLGLLIGGRIGI |
| Ga0213878_101822022 | 3300021444 | Bulk Soil | MRDLISDWKKWSRAERCFAIALVIIAFALPVGLLIGGSRIGS |
| Ga0187846_100110392 | 3300021476 | Biofilm | MRDWISDWKRWSRAERCFAIMLVIIALVFPLGLLIVGGRIGS |
| Ga0187846_100253803 | 3300021476 | Biofilm | MRDLISDWKKWSRAERCFAIMLVIIALVVPLGLVIVGERIGI |
| Ga0187846_101070301 | 3300021476 | Biofilm | MRDWISDWKKWSRAERCLAIMLVIIALALPLGLLIVGERIGS |
| Ga0187846_101091133 | 3300021476 | Biofilm | MRDWISDWKKWSRAERCFAIALVILALALPLGLLIGGGRIGI |
| Ga0210409_105840812 | 3300021559 | Soil | DWKRWSRAERCFAIALVILSLVVPLGLLIGGHIVGI |
| Ga0210409_113549561 | 3300021559 | Soil | MKDWISDWKRWSRAERCFAVALVILSLVIPLGFLIGGRMIGT |
| Ga0126371_100096882 | 3300021560 | Tropical Forest Soil | VLQGLDQMQDWISDWKRWSPAERCVAVALVILSLVLPLGVLVGGRIIGT |
| Ga0126371_101245622 | 3300021560 | Tropical Forest Soil | MRDWISDWKKWSRAERCFAIMLVIIALVVPLGLVIVGERLHS |
| Ga0126371_102954272 | 3300021560 | Tropical Forest Soil | MRDWISDWKKWSHAERCFAIMLVIIALALPLGLLIAGERIGS |
| Ga0126371_103284433 | 3300021560 | Tropical Forest Soil | VAGGCCHMRDWIADWKRWSRAERCVAIALVLLSLAIPLGLLIR |
| Ga0126371_105037272 | 3300021560 | Tropical Forest Soil | MRDWVSDWKKWSRTERCFAIVLVITALAVPFGLLIGGARVGS |
| Ga0126371_107488042 | 3300021560 | Tropical Forest Soil | MRDLISDWKKWSRSERCFAIALVIVALALPLGLLIEGGRIGI |
| Ga0126371_109777862 | 3300021560 | Tropical Forest Soil | MQDWISDWKRWSRAERCFAIALVILSLVIPLGLLIGGGIGGI |
| Ga0126371_112305952 | 3300021560 | Tropical Forest Soil | MQDWISDWKRWSRAERFLAIALVILSLVIPLGFLVGGRITGI |
| Ga0126371_113385142 | 3300021560 | Tropical Forest Soil | MRDWISDWKKWSRAERCFAIMLVIIALAVPLGLLIVGERIGI |
| Ga0126371_118091392 | 3300021560 | Tropical Forest Soil | MRDWISDWKKWSRAERWFAIMLIIIALVLPLGLLIIGERVGS |
| Ga0126371_121466082 | 3300021560 | Tropical Forest Soil | MRDWIADWKRWSRAERCVAIALLLLSLAIPLGLLIRPT |
| Ga0126371_137243292 | 3300021560 | Tropical Forest Soil | MRDWIADWKRWTRAERCVAIALVLLSLAIPLGLLIRPT |
| Ga0222728_10834951 | 3300022508 | Soil | RMRDWISDWKKWSRAERCFAIMLVIIALALPLGLLIAGERIGS |
| Ga0222756_10887852 | 3300022709 | Soil | MQDWISDWKRWSRAERCFAIVLVILSLVVPLGLLIGGHIVGI |
| Ga0242665_101722431 | 3300022724 | Soil | DWISDWKRWSRAERCFAVVLAILARAFPLGLLISAGRIGI |
| Ga0242665_102214631 | 3300022724 | Soil | YLMQDWISDWKRWSRAERCFAIALAILALAVPLGLLIGGRIIGI |
| Ga0242654_103564081 | 3300022726 | Soil | RVTGGHRHMQDWISDWKRWSRAERCFAIALVILSLVIPLGFLFGGGITGT |
| Ga0242654_104506932 | 3300022726 | Soil | WISDWKKWSRAERCFAVMLVVIALALPLGLLIASERIGS |
| Ga0207685_107404421 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MKDWISDWKRWSRAERCFAIVLVILSLAVPFGLLIGGRIIGT |
| Ga0207684_106313062 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MRDWISDWKRWSRAERCFAVVLAILALAFPLGLLISAGRIGI |
| Ga0207693_102680572 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MQDWISDWKKWSRAERCFAIVLVVLALMIPLGLLIRGGINGT |
| Ga0207663_103807152 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MQDWISDWKRWSRAERCFAIVLVILSLMIPLGLLIRGGT |
| Ga0209153_10904563 | 3300026312 | Soil | MKDWISDWKRWSRAERCFAIALVILSLVVPLGLLIGGGIIGT |
| Ga0209687_12067482 | 3300026322 | Soil | MRDWILDWKRWSRAERCFAVVLAILALSFPLGWLISAGRIGI |
| Ga0209473_10558953 | 3300026330 | Soil | MQDWISDWKRWSRAERCFAVALVILSLVIPLGFLVGGRMIGT |
| Ga0209157_11393382 | 3300026537 | Soil | MRDWILDWKRWSRAERCFAVVLAILALAFPLGLLISAGRIGI |
| Ga0209648_101658523 | 3300026551 | Grasslands Soil | MKDWISDWKRWSRAERCFAIALVILSLAVPFGLVIGGRIIGT |
| Ga0207758_10302532 | 3300026895 | Tropical Forest Soil | MRDWISDWKKWSRAERCFAIMLIIIALVLPLGLLIVGE |
| Ga0208365_10494802 | 3300027070 | Forest Soil | MHDWISDWKKWSRAERCFAIMLLIIALVLPLGLLIVGERIGS |
| Ga0207777_10879901 | 3300027330 | Tropical Forest Soil | MQDWISDWKRWSRAERCFAVVLVIVALMIPLGVLFR |
| Ga0209524_11068841 | 3300027521 | Forest Soil | MRDWISDWKRWSRAERWFAVALAVLALALPLGMLIGSVRIGI |
| Ga0209419_10039481 | 3300027537 | Forest Soil | MRDFVADWKKWSRAERCFAIMLVIIALALPLGLLIAGERIGS |
| Ga0209388_12044162 | 3300027655 | Vadose Zone Soil | MRDWVSDWKRWSRAERWFAVALVVLALTLPLGMLIGSIRIGI |
| Ga0209446_10012932 | 3300027698 | Bog Forest Soil | MRDWISDWKKWSRAERCFAILLVIIALAFPLGLLIEGGRIGS |
| Ga0209446_10022406 | 3300027698 | Bog Forest Soil | MRDWISDWKRWSRAERCFAIMLVIIALVLPLGLLIVGGRIGS |
| Ga0207862_10186592 | 3300027703 | Tropical Forest Soil | MRDWISDWKKWSRAERCFAIMLIIIALVLPLGLLIVGERIGS |
| Ga0209655_100328912 | 3300027767 | Bog Forest Soil | MQDWISDWKRWSRAERCFAVALVILSLVIPLGFLIGGHMIGT |
| Ga0209177_101096982 | 3300027775 | Agricultural Soil | MKDWISDWKRWSRTERCFAIALVILSLVVPLGLLIGGG |
| Ga0209448_101937602 | 3300027783 | Bog Forest Soil | MRDWISDWKKWSRAERCFAIMLVVIALVLPLGLLIVGERIGS |
| Ga0209656_100085513 | 3300027812 | Bog Forest Soil | MQDWISDWKRWSRAERCFAIALVILSLVLPLGVLIGGRMIGT |
| Ga0209040_102235482 | 3300027824 | Bog Forest Soil | MRDWISDWKKWSRAERCFAIMLLVIALVLPLGLLIVGERIGS |
| Ga0209040_102407482 | 3300027824 | Bog Forest Soil | MRDWISDWNRWSRAERFVAVALVILTLALPLGLALAGGG |
| Ga0209773_102714081 | 3300027829 | Bog Forest Soil | MKDWISDWKRWSRAERCFAIALVILSLVVPLGVLVGGRLIGI |
| Ga0209465_103931192 | 3300027874 | Tropical Forest Soil | MRDWVSDWKKWSRTERCFAIALLITALAVPYGLLIGGGRMGS |
| Ga0209590_110368932 | 3300027882 | Vadose Zone Soil | MQDWISDWKRWSRAERCFAIVLVILSLVVPLGLVIRGGT |
| Ga0209526_104681552 | 3300028047 | Forest Soil | SDWKRWSRAERCFAIALVILSLVVPLGLLIGGRIIGI |
| Ga0222749_102421641 | 3300029636 | Soil | MTGGYCLMQDWISDWKRWSRAERCFAIVLVILSLVIPLGLLIRGGT |
| Ga0222749_104529992 | 3300029636 | Soil | MGDWISDWKRWSRAERCFAVVLAILALAFPLGILISAGRIGV |
| Ga0075399_114751131 | 3300030967 | Soil | WISDWKKWSRAERCFAIMLVVIALALPLGLLIASERIGS |
| Ga0075394_115296821 | 3300030969 | Soil | MHDWISDWKKWSRAERCFAIMLVIIALALPLGLLIAGERIGS |
| Ga0170834_1033286111 | 3300031057 | Forest Soil | ECWRGFKMRDWISDWKKWSRAERCFAIMLVVIALALPLGLLIASERIGS |
| Ga0170834_1067592712 | 3300031057 | Forest Soil | MQDWISDWKKWSRAERCFAIALVILSLVIPFGLLVGGRIIGI |
| Ga0170822_124454953 | 3300031122 | Forest Soil | MQAWISDWKKWSRAERCFAIALVILSLVIPLGVLVGGRIIGI |
| Ga0170823_154622801 | 3300031128 | Forest Soil | MRDWISDWKKWSRAERCFAIMLVVIALALPLGLLIASEKIGS |
| Ga0170820_147734962 | 3300031446 | Forest Soil | MRDWISDWKKWSRAERCFAIMLVVIALALPLGLLIASERIGS |
| Ga0170819_116973531 | 3300031469 | Forest Soil | GFQMRDWISDWKKWSRAERCFAIMLVVIALALPLGLLIASERIGS |
| Ga0318516_100080164 | 3300031543 | Soil | MRDWIADWKRWSRAERCVAIALVLLSLAIPLGLLIRPT |
| Ga0318516_100317172 | 3300031543 | Soil | MGDWISDWKKWSRTERCFAIMLVIIALMLPLGLLIVGERVGI |
| Ga0318516_100721612 | 3300031543 | Soil | MQDWVSDWKRWSRAERCFAIMLVILALMIPLGMLLRGGISGT |
| Ga0318516_101156922 | 3300031543 | Soil | MRDWVSDWKKWSRAERCFAIMLVIIALVLPLGLLIVGERIGS |
| Ga0318516_101467882 | 3300031543 | Soil | MRDWISDWKKWSRAERCFAIMLVIIALVLPLGLLIIGERVGS |
| Ga0318516_103053412 | 3300031543 | Soil | MRDWISDWKRWSRAERCFAIMLVIIALVLPLGLLIAGGKIG |
| Ga0318516_104533182 | 3300031543 | Soil | MRDWISDWKKWSRAERCLAILLVIIALVLPLGLLMVGERIGS |
| Ga0318516_105261222 | 3300031543 | Soil | MRDWISDWKRWSRAERCFAIMLFIIALVLPLGLLIVSERVGI |
| Ga0318516_105972692 | 3300031543 | Soil | MQDWISDWKRWSRAERCFAVVLVIVALMIPLGVLFRGGISGT |
| Ga0318516_108700782 | 3300031543 | Soil | VQDWIADWKRWSRAERCFAIALVILSLVIPLGFLIGGRMIGT |
| Ga0318534_105551752 | 3300031544 | Soil | MHDWISDWKRWSRAERCFAIMLVIIALVFPLGLLIVGGRIGI |
| Ga0318528_100108721 | 3300031561 | Soil | CHMRDWIADWKRWSRAERCVAIALVLLSLAIPLGLLIRPT |
| Ga0318528_100334282 | 3300031561 | Soil | MQDWISDWKRWSRAERCFAIALVILSLVIPLGFLIGGGRLGS |
| Ga0318528_104082041 | 3300031561 | Soil | MQDWISDWKRWSRAERWFAIALVILSVMIPLGLLFGGGIRGI |
| Ga0318573_102285602 | 3300031564 | Soil | DYTMQDWVSDWKRWSRAERCFAIMLVILALMIPLGMLLRGGISGT |
| Ga0318573_105407661 | 3300031564 | Soil | MQDWISDWKRWSRAERCFAVALVIVALMIPLGVLFRGGISGT |
| Ga0318573_106351481 | 3300031564 | Soil | MRDWIADWKRWSRAERCVAIALVLLSLAIPLGLLIRP |
| Ga0318515_100035791 | 3300031572 | Soil | LGAWRDRLMRDWISDWKRWSRAERCFAIMLFIIALALPLGLLIVGERIGI |
| Ga0310915_101271922 | 3300031573 | Soil | MRDWISDWKRWSRAERCFAIMLFIIALVLPLGLLIVGERIGI |
| Ga0318574_102794813 | 3300031680 | Soil | MRDWISDWKRWSRAERCFAIMLFIIALVLPLGLLIVSER |
| Ga0318574_105587321 | 3300031680 | Soil | MRDWISDWKRWSRAERCFAIMLFIIALVLPLGLFIVGERIGI |
| Ga0318574_105743701 | 3300031680 | Soil | RDWVSDWKKWSRAERCFAIMLVIIALVLPLGLLIVGERIGS |
| Ga0318560_101670613 | 3300031682 | Soil | MRDWISDWKRWSRAERCFAIMLVIIALVLPLGLLI |
| Ga0318560_105636452 | 3300031682 | Soil | MRDWISDWKKWSRAERCFAIMLIIIALVLPLGLLIIGERVGS |
| Ga0306917_113077812 | 3300031719 | Soil | MRDLISDWKKWSRAERCFAIMLVIIALVVPLGLVIVGERI |
| Ga0306917_113338052 | 3300031719 | Soil | MQNWISDWKRWSRAERCFAIALVILSLVIPLGLLIGGGIGGI |
| Ga0318493_100524481 | 3300031723 | Soil | WISDWKKWSRAERCFAIMLVIIALVLPLGLLIVGERIGS |
| Ga0318500_104283212 | 3300031724 | Soil | ISDWKRWSRAERCFAIALVILSLVIPLGFLIGGGRLGS |
| Ga0318501_101718711 | 3300031736 | Soil | MRDWISDWKKWSRAERWFAIMLIIIALVLPLGLLIIGE |
| Ga0306918_106152162 | 3300031744 | Soil | MQDWISDWKRWSRAERCFAVALVILSLVIPLGVLIGGRIAGT |
| Ga0306918_113138032 | 3300031744 | Soil | MRDWISDWKKWSRAERCFAIMLFIIALVLPLGLLIVSERISS |
| Ga0318502_108251411 | 3300031747 | Soil | MRDWISDWKKWSRAERWFAIMLIIIALVLPLGLLIMGE |
| Ga0318502_109761121 | 3300031747 | Soil | MRDWISDWKKWSRAERCFAIMLVIIALVVPLGLVIVGERIGI |
| Ga0318502_110058742 | 3300031747 | Soil | CRMRDWISDWKKWSRAERWFAIMLIIIALVLPLGLLIIGERVGS |
| Ga0318492_101418823 | 3300031748 | Soil | WISDWKKWSRAERCFAIMLVIIALVLPLGLLIIGERVGS |
| Ga0318492_102454172 | 3300031748 | Soil | MRDWISDWKRWSRAERCFAIMLVIIALVLPLGLLIVGGRIG |
| Ga0318492_107620951 | 3300031748 | Soil | MSDWVSDWKRWSRAERCLAIALAALALALPLGLLIGRSRIGI |
| Ga0318494_101605123 | 3300031751 | Soil | RDRLMRDWISDWKRWSRAERCFAIMLFIIALALPLGLLIVGERIGI |
| Ga0307477_1000151011 | 3300031753 | Hardwood Forest Soil | MHDWISDWKKWSRAERCFAIMLLIIALVIPLGLLIVGERIGS |
| Ga0318535_105039152 | 3300031764 | Soil | MRDLISDWKKWSRAERCFAIAMVIVALALPLGLLM |
| Ga0318509_103565012 | 3300031768 | Soil | MRDWISDWKRWSRAERCFAIMLFIIALALPLGLFIVGGRVGI |
| Ga0318509_106779461 | 3300031768 | Soil | VWRDRPMRDWISDWKRWSRAERCFAIMLFIIALVLPLGLLIVGERIGI |
| Ga0318509_107925352 | 3300031768 | Soil | MRDWISDWKKWSRAERCFAILLVIVALVFPLGLLIV |
| Ga0318521_101682691 | 3300031770 | Soil | SDWKKWSRAERWFAIMLIIIALVLPLGLLIIGERVGS |
| Ga0318521_110322161 | 3300031770 | Soil | VESGRGCCHMRDWIADWKRWSRAERCVAIALVLLSLAIPLGLLIRPT |
| Ga0318546_108770732 | 3300031771 | Soil | WKKWSRAERCFAIMLVIIALVVPLGLVIVGERIGI |
| Ga0318566_101614333 | 3300031779 | Soil | MRDWISDWKKWSRAERCFAIMLVIIALVLPLGLLIVGERIG |
| Ga0318547_110118751 | 3300031781 | Soil | MRDWISDWKKWSHAERCFAIMLVIIALALPLGLLIAGERIG |
| Ga0318552_101855561 | 3300031782 | Soil | MRDWISDWKRWSRAERCFAIMLFIIALVLPLGLFIVGER |
| Ga0318552_106800441 | 3300031782 | Soil | MRDWISDWKRWSRAERCFAIMLFIIALALPLGLLIVG |
| Ga0318548_104702321 | 3300031793 | Soil | KLGAWRDRLMRDWISDWKRWSRAERCFAIMLFIIALALPLGLLIVGERIGI |
| Ga0318548_105054361 | 3300031793 | Soil | HMRDWIADWKRWSRAERCVAIALVLLSLAIPLGLLIRPT |
| Ga0318576_100166816 | 3300031796 | Soil | MRDWISDWKKWSRAERWFAIMLIIIALVLPLGLLIIGERVG |
| Ga0318576_101440963 | 3300031796 | Soil | PGVWRDRPMRDWISDWKRWSRAERCFAIMLFIIALVLPLGLLIVGERIGI |
| Ga0318565_104896471 | 3300031799 | Soil | MQDWISDWKRWSRAERCFAVVLVIVALMIPLGVLF |
| Ga0318497_106996782 | 3300031805 | Soil | SSMQDWISDWKRWSRAERCFAVALVIVALMIPLGVLFRGGISGT |
| Ga0318499_102350912 | 3300031832 | Soil | MRDWISDWKKWSRAERCLAILLVIIALVLPLGLLMVGERIG |
| Ga0310917_105599762 | 3300031833 | Soil | GLAGRRMRDLISDWKKWSRAERCFAIMLVIIALVVPLGLVIVGERIGI |
| Ga0318517_104269981 | 3300031835 | Soil | SDWKRWSRAERCFAIMLFIIALVLPLGLLIVSERVGI |
| Ga0318527_101800202 | 3300031859 | Soil | MRDWVSDWKKWSRAERCFAIMLVIIALVLPLGLLI |
| Ga0318495_104800612 | 3300031860 | Soil | MQDWISDWKRWSRAERCFAVALVIVALMIPLGVLFRGGIS |
| Ga0306919_100100114 | 3300031879 | Soil | MRDWISDWKRWSRAERCFAIMLFIIALALPLGLLIVGERIGI |
| Ga0306919_101563803 | 3300031879 | Soil | MRDWISDWKRWSRAERCFAIMLVIIALVLPLGLLIVGGKIGS |
| Ga0318544_102167521 | 3300031880 | Soil | MGDWISDWKKWSRAERCFAIMLVIIALMLPLGLLIVGERVGI |
| Ga0318544_104319421 | 3300031880 | Soil | MRDWISDWKKWSRAERCFAILLVIVALVFPLGLLIVGERIGS |
| Ga0306925_100225151 | 3300031890 | Soil | MRDWISDWKKWSRAERCFAIMLVIIALVLPLGPLIIGERVGS |
| Ga0306925_100343501 | 3300031890 | Soil | DWIADWKRWSRAERCVAIALVLLSLAIPLGLLIRPT |
| Ga0318551_106820152 | 3300031896 | Soil | SDWKKWSRAERCFAILLVIVALVFPLGLLIVGERIGS |
| Ga0318520_110017361 | 3300031897 | Soil | RLMRDWISDWKRWSRAERCFAIMLFIIALALPLGLFIVGGRVGI |
| Ga0306923_104116581 | 3300031910 | Soil | MRDWISDWKKWSRAERCFAIMLVIIALVLPLGPLIIGERV |
| Ga0306923_112728642 | 3300031910 | Soil | MRDLISDWKKWSRAERCFAIAMVIVALALPLGLLMGGSRIGS |
| Ga0306923_118865312 | 3300031910 | Soil | LFMQDWISDWKRWSRAERCFAIALVILSLVIPLGLLIGGGIGGI |
| Ga0306921_101310183 | 3300031912 | Soil | DWIADWKRWSRAERCFAIALVILSLVIPLGFLIGGRMIGT |
| Ga0306921_112258532 | 3300031912 | Soil | MQDWISDWKRWSRAERCFAVVLVIMALMIPLGVLFRGGISGT |
| Ga0306921_112894092 | 3300031912 | Soil | WKRWSRAERCFAIMLFIIALALPLGLLIVGERIGI |
| Ga0310912_113491551 | 3300031941 | Soil | MRDWISDWKKWSRAERCFAIMLIIIALVLPLGRLIIGERVGS |
| Ga0310916_100454682 | 3300031942 | Soil | MRDLISDWKKWSRAERCFAIMLVIIALVVPLGMVIVGERIGI |
| Ga0310913_109571561 | 3300031945 | Soil | MRDWISDWKRWSRAERCFAIMLFIIALVLPLGLLI |
| Ga0310910_102154381 | 3300031946 | Soil | MRDWISDWKKWSRAERCFAIMLVIIALVLPLGPLIIGERVG |
| Ga0310910_113295032 | 3300031946 | Soil | MRDLISDWKKWSRAERCFAIAMVIAALALPLGLLMGGSRIGS |
| Ga0310909_102061831 | 3300031947 | Soil | VQDWIADWKRWSRAERCFAIALVILSLVIPLGFLIGGR |
| Ga0306926_110386332 | 3300031954 | Soil | MKDWISDWKRWSRAERCFAIALVILSLVIPLGFLIGGRVIGT |
| Ga0306926_118064842 | 3300031954 | Soil | MRDLISDWKKWSSAERCFAIALVIAALALPLGMLMGGSRIGS |
| Ga0307479_102639792 | 3300031962 | Hardwood Forest Soil | MRDWISDWKKWSRAERCFAIMLIIIALVLPLGLLIIGERIGS |
| Ga0318531_101427553 | 3300031981 | Soil | VSDWKKWSRAERCFAIMLVIIALVLPLGLLIVGERIGS |
| Ga0306922_117331891 | 3300032001 | Soil | MQDWISDWKRWSRVERCFAIVLVILSLVIPLGFLIGGGTLASG |
| Ga0318563_105490271 | 3300032009 | Soil | MGDWISDWKKWSRAERCFAIMLVIIALMLPLGLLIVGERIGI |
| Ga0310911_108829591 | 3300032035 | Soil | RDRLMRDWISDWKRWSRAERCFAIMLFIIALVLPLGLLIVGERIGI |
| Ga0318549_100736032 | 3300032041 | Soil | MQDWISDWKRWSRAERCFAVALVILALMIPLGVLFRGGISGT |
| Ga0318575_101033363 | 3300032055 | Soil | GCQMGDWISDWKKWSRAERCFAIMLVIIALMLPLGLLIVGERVGI |
| Ga0318575_103451241 | 3300032055 | Soil | MQDWISDWKRWSRAERCFAIALVILSLVIPLGFLIGGRGLGS |
| Ga0306924_117158311 | 3300032076 | Soil | MRDLISDWKKWSRVERCFAIAMVIVALALPLGWLMGGSRIGS |
| Ga0318525_107255241 | 3300032089 | Soil | WRDRLMRDWISDWKRWSRAERCFAIMLFIIALALPLGLLIVGERIGI |
| Ga0318518_100629311 | 3300032090 | Soil | MGDWISDWKKWSRAERCFAIMLVIIALMLPLGLLIVG |
| Ga0318518_101105312 | 3300032090 | Soil | MRDWISDWNRWSRAERCFAIMLFIIALVLPLGLLIVSERVGI |
| Ga0318577_103254932 | 3300032091 | Soil | LPERWRGFQMRDWISDWKKWSRAERCFAIMLVVIALALPLGLLIAGERIGS |
| Ga0318540_106294571 | 3300032094 | Soil | MRDWISDWKRWSRAERCFAIMLFIIALALPLGLFIVGGRVG |
| Ga0307471_1041879482 | 3300032180 | Hardwood Forest Soil | MHDWISDWKRWSRAERCFAVVLAILALAFPLGILISAGRIGI |
| Ga0307472_1002484954 | 3300032205 | Hardwood Forest Soil | GGNTMRDWISDWKKWSRAERCFAIMLVIIALALPLGLLIAGERIGI |
| Ga0307472_1002697972 | 3300032205 | Hardwood Forest Soil | MRDWISDWKRWSRAERCFAVVLAILALAFPLGILISAGKIGI |
| Ga0307472_1012111492 | 3300032205 | Hardwood Forest Soil | MRDWISDWKKWSRAERCFAIMLVIIALALPLGLLIAGERI |
| Ga0306920_1018679332 | 3300032261 | Soil | MHDLISDWKKWSRAERCFAIALVIVALAIPLGLLIEGARIGS |
| Ga0318519_102690003 | 3300033290 | Soil | MRDWISDWKKWSRAERCFAIMLVIIALVLPLGLLI |
| ⦗Top⦘ |