


| Basic Information | |
|---|---|
| Family ID | F006304 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 376 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MAKRLTVAEKYRQLKKQTEDAGMKVQEKDGKIVVTRKKKK |
| Number of Associated Samples | 222 |
| Number of Associated Scaffolds | 375 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 61.29 % |
| % of genes near scaffold ends (potentially truncated) | 26.60 % |
| % of genes from short scaffolds (< 2000 bps) | 70.74 % |
| Associated GOLD sequencing projects | 192 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.52 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (51.330 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (25.798 % of family members) |
| Environment Ontology (ENVO) | Unclassified (48.404 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (52.394 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Mixed | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 20.59% β-sheet: 17.65% Coil/Unstructured: 61.76% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.52 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 375 Family Scaffolds |
|---|---|---|
| PF02867 | Ribonuc_red_lgC | 2.93 |
| PF02562 | PhoH | 2.40 |
| PF11351 | GTA_holin_3TM | 2.40 |
| PF03237 | Terminase_6N | 2.13 |
| PF00166 | Cpn10 | 1.60 |
| PF00268 | Ribonuc_red_sm | 1.07 |
| PF00476 | DNA_pol_A | 1.07 |
| PF06568 | DUF1127 | 0.80 |
| PF11753 | DUF3310 | 0.80 |
| PF03592 | Terminase_2 | 0.80 |
| PF00961 | LAGLIDADG_1 | 0.80 |
| PF00534 | Glycos_transf_1 | 0.53 |
| PF13155 | Toprim_2 | 0.53 |
| PF09723 | Zn-ribbon_8 | 0.53 |
| PF05345 | He_PIG | 0.53 |
| PF10263 | SprT-like | 0.53 |
| PF13539 | Peptidase_M15_4 | 0.53 |
| PF11325 | DUF3127 | 0.27 |
| PF13392 | HNH_3 | 0.27 |
| PF01041 | DegT_DnrJ_EryC1 | 0.27 |
| PF04367 | DUF502 | 0.27 |
| PF12705 | PDDEXK_1 | 0.27 |
| PF00145 | DNA_methylase | 0.27 |
| PF00041 | fn3 | 0.27 |
| PF00959 | Phage_lysozyme | 0.27 |
| PF02557 | VanY | 0.27 |
| PF00271 | Helicase_C | 0.27 |
| PF02954 | HTH_8 | 0.27 |
| PF13704 | Glyco_tranf_2_4 | 0.27 |
| PF02195 | ParBc | 0.27 |
| PF05838 | Glyco_hydro_108 | 0.27 |
| PF13692 | Glyco_trans_1_4 | 0.27 |
| PF04233 | Phage_Mu_F | 0.27 |
| PF00462 | Glutaredoxin | 0.27 |
| PF08291 | Peptidase_M15_3 | 0.27 |
| PF01510 | Amidase_2 | 0.27 |
| PF12898 | Stc1 | 0.27 |
| PF04466 | Terminase_3 | 0.27 |
| COG ID | Name | Functional Category | % Frequency in 375 Family Scaffolds |
|---|---|---|---|
| COG0209 | Ribonucleotide reductase alpha subunit | Nucleotide transport and metabolism [F] | 2.93 |
| COG1702 | Phosphate starvation-inducible protein PhoH, predicted ATPase | Signal transduction mechanisms [T] | 2.40 |
| COG1875 | Predicted ribonuclease YlaK, contains NYN-type RNase and PhoH-family ATPase domains | General function prediction only [R] | 2.40 |
| COG0234 | Co-chaperonin GroES (HSP10) | Posttranslational modification, protein turnover, chaperones [O] | 1.60 |
| COG0208 | Ribonucleotide reductase beta subunit, ferritin-like domain | Nucleotide transport and metabolism [F] | 1.07 |
| COG0749 | DNA polymerase I, 3'-5' exonuclease and polymerase domains | Replication, recombination and repair [L] | 1.07 |
| COG3728 | Phage terminase, small subunit | Mobilome: prophages, transposons [X] | 0.80 |
| COG5457 | Uncharacterized conserved protein YjiS, DUF1127 family | Function unknown [S] | 0.80 |
| COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 0.27 |
| COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 0.27 |
| COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 0.27 |
| COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 0.27 |
| COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 0.27 |
| COG1104 | Cysteine desulfurase/Cysteine sulfinate desulfinase IscS or related enzyme, NifS family | Amino acid transport and metabolism [E] | 0.27 |
| COG1783 | Phage terminase large subunit | Mobilome: prophages, transposons [X] | 0.27 |
| COG1876 | LD-carboxypeptidase LdcB, LAS superfamily | Cell wall/membrane/envelope biogenesis [M] | 0.27 |
| COG2173 | D-alanyl-D-alanine dipeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.27 |
| COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 0.27 |
| COG2928 | Uncharacterized membrane protein | Function unknown [S] | 0.27 |
| COG3926 | Lysozyme family protein | General function prediction only [R] | 0.27 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 51.33 % |
| All Organisms | root | All Organisms | 45.48 % |
| unclassified Hyphomonas | no rank | unclassified Hyphomonas | 3.19 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2020350000|Qingha_contig153040 | Not Available | 1124 | Open in IMG/M |
| 2199352018|QLA_contig01613.1613 | Not Available | 2686 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10018941 | All Organisms → Viruses → Predicted Viral | 4075 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10034159 | All Organisms → Viruses → Predicted Viral | 2750 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10039339 | All Organisms → Viruses → Predicted Viral | 2489 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10107276 | Not Available | 1139 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10134377 | All Organisms → Viruses | 942 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10204565 | Not Available | 659 | Open in IMG/M |
| 3300000115|DelMOSum2011_c10111661 | Not Available | 873 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10032483 | Not Available | 2426 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10096927 | Not Available | 1122 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10144405 | Not Available | 823 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10209231 | Not Available | 619 | Open in IMG/M |
| 3300000117|DelMOWin2010_c10064335 | Not Available | 1517 | Open in IMG/M |
| 3300000117|DelMOWin2010_c10071990 | Not Available | 1388 | Open in IMG/M |
| 3300000418|P_2C_Liq_1_UnCtyDRAFT_1073843 | Not Available | 564 | Open in IMG/M |
| 3300000947|BBAY92_10185957 | Not Available | 542 | Open in IMG/M |
| 3300001460|JGI24003J15210_10174688 | Not Available | 526 | Open in IMG/M |
| 3300001533|MLSed_10074066 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1888 | Open in IMG/M |
| 3300001748|JGI11772J19994_1023513 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64 | 869 | Open in IMG/M |
| 3300001943|GOS2226_1002661 | All Organisms → cellular organisms → Bacteria | 929 | Open in IMG/M |
| 3300002144|M2t2BS2_11131772 | All Organisms → cellular organisms → Bacteria | 845 | Open in IMG/M |
| 3300002220|MLSBCLC_10445231 | All Organisms → Viruses → Predicted Viral | 1537 | Open in IMG/M |
| 3300003346|JGI26081J50195_1001099 | Not Available | 10885 | Open in IMG/M |
| 3300003427|JGI26084J50262_1066334 | Not Available | 805 | Open in IMG/M |
| 3300003617|JGI26082J51739_10011715 | All Organisms → Viruses → Predicted Viral | 4220 | Open in IMG/M |
| 3300003635|p5metav_100081 | Not Available | 15095 | Open in IMG/M |
| 3300004240|Ga0007787_10019928 | All Organisms → cellular organisms → Bacteria | 2805 | Open in IMG/M |
| 3300004448|Ga0065861_1004314 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1097 | Open in IMG/M |
| 3300004448|Ga0065861_1011959 | All Organisms → Viruses → Predicted Viral | 1854 | Open in IMG/M |
| 3300004448|Ga0065861_1023752 | Not Available | 3066 | Open in IMG/M |
| 3300004448|Ga0065861_1028531 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2965 | Open in IMG/M |
| 3300004448|Ga0065861_1070525 | Not Available | 955 | Open in IMG/M |
| 3300004448|Ga0065861_1082885 | All Organisms → Viruses → Predicted Viral | 2362 | Open in IMG/M |
| 3300004457|Ga0066224_1006265 | Not Available | 12300 | Open in IMG/M |
| 3300004457|Ga0066224_1123370 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Zobellviridae → Cobavirinae → Veravirus → Roseobacter phage CRP-5 | 518 | Open in IMG/M |
| 3300004460|Ga0066222_1047692 | All Organisms → Viruses → Predicted Viral | 2096 | Open in IMG/M |
| 3300004461|Ga0066223_1036080 | All Organisms → Viruses → Predicted Viral | 2720 | Open in IMG/M |
| 3300005239|Ga0073579_1290546 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 828 | Open in IMG/M |
| 3300005346|Ga0074242_10663729 | Not Available | 584 | Open in IMG/M |
| 3300005346|Ga0074242_10708006 | Not Available | 521 | Open in IMG/M |
| 3300005346|Ga0074242_10758749 | Not Available | 1163 | Open in IMG/M |
| 3300005346|Ga0074242_11196711 | Not Available | 1596 | Open in IMG/M |
| 3300005346|Ga0074242_11928855 | Not Available | 1326 | Open in IMG/M |
| 3300005417|Ga0068884_1512443 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C440 | 1108 | Open in IMG/M |
| 3300005512|Ga0074648_1014263 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4908 | Open in IMG/M |
| 3300005512|Ga0074648_1015809 | Not Available | 4528 | Open in IMG/M |
| 3300005512|Ga0074648_1025443 | Not Available | 3143 | Open in IMG/M |
| 3300005512|Ga0074648_1048263 | All Organisms → Viruses → environmental samples → uncultured virus | 1880 | Open in IMG/M |
| 3300005512|Ga0074648_1093853 | Not Available | 1077 | Open in IMG/M |
| 3300005512|Ga0074648_1105059 | Not Available | 979 | Open in IMG/M |
| 3300005527|Ga0068876_10440166 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 722 | Open in IMG/M |
| 3300005528|Ga0068872_10246376 | All Organisms → Viruses → Predicted Viral | 1004 | Open in IMG/M |
| 3300005581|Ga0049081_10053971 | All Organisms → cellular organisms → Bacteria | 1519 | Open in IMG/M |
| 3300005581|Ga0049081_10284869 | Not Available | 572 | Open in IMG/M |
| 3300005611|Ga0074647_1022583 | All Organisms → cellular organisms → Bacteria | 977 | Open in IMG/M |
| 3300005613|Ga0074649_1011932 | Not Available | 5904 | Open in IMG/M |
| 3300005613|Ga0074649_1028710 | All Organisms → cellular organisms → Bacteria | 2860 | Open in IMG/M |
| 3300005613|Ga0074649_1068489 | Not Available | 1422 | Open in IMG/M |
| 3300005613|Ga0074649_1095756 | All Organisms → cellular organisms → Bacteria | 1088 | Open in IMG/M |
| 3300005747|Ga0076924_1240022 | Not Available | 1250 | Open in IMG/M |
| 3300005805|Ga0079957_1017396 | Not Available | 5133 | Open in IMG/M |
| 3300005805|Ga0079957_1027887 | Not Available | 3790 | Open in IMG/M |
| 3300005826|Ga0074477_1381903 | Not Available | 631 | Open in IMG/M |
| 3300005914|Ga0075117_1034198 | Not Available | 1736 | Open in IMG/M |
| 3300005940|Ga0073913_10049485 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
| 3300005941|Ga0070743_10136487 | Not Available | 817 | Open in IMG/M |
| 3300006025|Ga0075474_10011183 | Not Available | 3409 | Open in IMG/M |
| 3300006030|Ga0075470_10065956 | All Organisms → Viruses → Predicted Viral | 1101 | Open in IMG/M |
| 3300006425|Ga0075486_1808374 | Not Available | 707 | Open in IMG/M |
| 3300006734|Ga0098073_1010193 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1612 | Open in IMG/M |
| 3300006802|Ga0070749_10019467 | unclassified Hyphomonas → Hyphomonas sp. | 4313 | Open in IMG/M |
| 3300006802|Ga0070749_10019979 | All Organisms → Viruses → Predicted Viral | 4251 | Open in IMG/M |
| 3300006802|Ga0070749_10028842 | Not Available | 3476 | Open in IMG/M |
| 3300006802|Ga0070749_10093096 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1789 | Open in IMG/M |
| 3300006802|Ga0070749_10249217 | Not Available | 1006 | Open in IMG/M |
| 3300006802|Ga0070749_10331228 | Not Available | 849 | Open in IMG/M |
| 3300006802|Ga0070749_10422861 | Not Available | 733 | Open in IMG/M |
| 3300006802|Ga0070749_10513828 | Not Available | 651 | Open in IMG/M |
| 3300006803|Ga0075467_10332227 | Not Available | 803 | Open in IMG/M |
| 3300006803|Ga0075467_10728157 | Not Available | 505 | Open in IMG/M |
| 3300006805|Ga0075464_11058676 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 510 | Open in IMG/M |
| 3300006810|Ga0070754_10003287 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 11492 | Open in IMG/M |
| 3300006810|Ga0070754_10042839 | All Organisms → cellular organisms → Bacteria | 2439 | Open in IMG/M |
| 3300006810|Ga0070754_10067726 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 1833 | Open in IMG/M |
| 3300006810|Ga0070754_10227784 | Not Available | 859 | Open in IMG/M |
| 3300006810|Ga0070754_10322401 | All Organisms → Viruses → environmental samples → uncultured virus | 689 | Open in IMG/M |
| 3300006810|Ga0070754_10335873 | Not Available | 671 | Open in IMG/M |
| 3300006810|Ga0070754_10399057 | Not Available | 602 | Open in IMG/M |
| 3300006810|Ga0070754_10442357 | Not Available | 565 | Open in IMG/M |
| 3300006810|Ga0070754_10452803 | Not Available | 556 | Open in IMG/M |
| 3300006810|Ga0070754_10527833 | Not Available | 506 | Open in IMG/M |
| 3300006868|Ga0075481_10251288 | Not Available | 623 | Open in IMG/M |
| 3300006869|Ga0075477_10015280 | All Organisms → cellular organisms → Bacteria | 3590 | Open in IMG/M |
| 3300006874|Ga0075475_10076571 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae | 1539 | Open in IMG/M |
| 3300006874|Ga0075475_10116814 | Not Available | 1193 | Open in IMG/M |
| 3300006916|Ga0070750_10006689 | unclassified Hyphomonas → Hyphomonas sp. | 6196 | Open in IMG/M |
| 3300006916|Ga0070750_10201187 | Not Available | 882 | Open in IMG/M |
| 3300006916|Ga0070750_10264766 | unclassified Hyphomonas → Hyphomonas sp. | 743 | Open in IMG/M |
| 3300006919|Ga0070746_10032794 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2785 | Open in IMG/M |
| 3300006919|Ga0070746_10370377 | Not Available | 646 | Open in IMG/M |
| 3300007229|Ga0075468_10100660 | All Organisms → cellular organisms → Bacteria | 916 | Open in IMG/M |
| 3300007229|Ga0075468_10146143 | Not Available | 718 | Open in IMG/M |
| 3300007276|Ga0070747_1048032 | unclassified Hyphomonas → Hyphomonas sp. | 1641 | Open in IMG/M |
| 3300007344|Ga0070745_1011673 | All Organisms → Viruses → Predicted Viral | 4147 | Open in IMG/M |
| 3300007344|Ga0070745_1089676 | Not Available | 1213 | Open in IMG/M |
| 3300007345|Ga0070752_1261351 | Not Available | 670 | Open in IMG/M |
| 3300007363|Ga0075458_10014051 | Not Available | 2554 | Open in IMG/M |
| 3300007537|Ga0102934_1080417 | Not Available | 1610 | Open in IMG/M |
| 3300007538|Ga0099851_1055221 | Not Available | 1556 | Open in IMG/M |
| 3300007538|Ga0099851_1154837 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 852 | Open in IMG/M |
| 3300007538|Ga0099851_1181467 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C493 | 773 | Open in IMG/M |
| 3300007538|Ga0099851_1243788 | Not Available | 644 | Open in IMG/M |
| 3300007538|Ga0099851_1322949 | Not Available | 542 | Open in IMG/M |
| 3300007539|Ga0099849_1084439 | All Organisms → Viruses → Predicted Viral | 1281 | Open in IMG/M |
| 3300007540|Ga0099847_1194877 | Not Available | 592 | Open in IMG/M |
| 3300007540|Ga0099847_1196655 | Not Available | 589 | Open in IMG/M |
| 3300007540|Ga0099847_1211067 | Not Available | 564 | Open in IMG/M |
| 3300007541|Ga0099848_1044339 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → Puniceispirillum phage HMO-2011 | 1810 | Open in IMG/M |
| 3300007611|Ga0102927_1016350 | Not Available | 1717 | Open in IMG/M |
| 3300007640|Ga0070751_1031042 | Not Available | 2456 | Open in IMG/M |
| 3300007778|Ga0102954_1122466 | Not Available | 737 | Open in IMG/M |
| 3300007960|Ga0099850_1131088 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C493 | 1019 | Open in IMG/M |
| 3300008107|Ga0114340_1003611 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 14469 | Open in IMG/M |
| 3300008116|Ga0114350_1000538 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 39655 | Open in IMG/M |
| 3300008117|Ga0114351_1001441 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.Bin397 | 32550 | Open in IMG/M |
| 3300008117|Ga0114351_1019541 | All Organisms → Viruses → Predicted Viral | 4563 | Open in IMG/M |
| 3300008261|Ga0114336_1000403 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 35379 | Open in IMG/M |
| 3300008263|Ga0114349_1068992 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2732 | Open in IMG/M |
| 3300008266|Ga0114363_1048850 | All Organisms → Viruses → Predicted Viral | 1692 | Open in IMG/M |
| 3300008267|Ga0114364_1045529 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1607 | Open in IMG/M |
| 3300009000|Ga0102960_1190814 | Not Available | 732 | Open in IMG/M |
| 3300009001|Ga0102963_1017134 | Not Available | 3062 | Open in IMG/M |
| 3300009001|Ga0102963_1160589 | Not Available | 903 | Open in IMG/M |
| 3300009001|Ga0102963_1213785 | Not Available | 767 | Open in IMG/M |
| 3300009001|Ga0102963_1289147 | Not Available | 646 | Open in IMG/M |
| 3300009027|Ga0102957_1194432 | Not Available | 726 | Open in IMG/M |
| 3300009027|Ga0102957_1422897 | Not Available | 501 | Open in IMG/M |
| 3300009071|Ga0115566_10004479 | Not Available | 11110 | Open in IMG/M |
| 3300009079|Ga0102814_10356355 | Not Available | 796 | Open in IMG/M |
| 3300009086|Ga0102812_10404294 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 743 | Open in IMG/M |
| 3300009124|Ga0118687_10173572 | unclassified Hyphomonas → Hyphomonas sp. | 778 | Open in IMG/M |
| 3300009149|Ga0114918_10030569 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales | 3853 | Open in IMG/M |
| 3300009149|Ga0114918_10033883 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 3608 | Open in IMG/M |
| 3300009149|Ga0114918_10218103 | Not Available | 1099 | Open in IMG/M |
| 3300009149|Ga0114918_10422474 | Not Available | 723 | Open in IMG/M |
| 3300009149|Ga0114918_10503699 | Not Available | 648 | Open in IMG/M |
| 3300009154|Ga0114963_10015914 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5057 | Open in IMG/M |
| 3300009155|Ga0114968_10773720 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 500 | Open in IMG/M |
| 3300009164|Ga0114975_10580114 | Not Available | 599 | Open in IMG/M |
| 3300009183|Ga0114974_10012630 | Not Available | 6108 | Open in IMG/M |
| 3300009193|Ga0115551_1233530 | Not Available | 817 | Open in IMG/M |
| 3300009420|Ga0114994_10789518 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 617 | Open in IMG/M |
| 3300009434|Ga0115562_1119970 | Not Available | 1014 | Open in IMG/M |
| 3300009449|Ga0115558_1048808 | unclassified Hyphomonas → Hyphomonas sp. | 1956 | Open in IMG/M |
| 3300009450|Ga0127391_1010195 | All Organisms → Viruses → Predicted Viral | 2005 | Open in IMG/M |
| 3300009466|Ga0126448_1075513 | Not Available | 766 | Open in IMG/M |
| 3300009495|Ga0115571_1156947 | Not Available | 950 | Open in IMG/M |
| 3300009495|Ga0115571_1313295 | Not Available | 623 | Open in IMG/M |
| 3300009496|Ga0115570_10441502 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 550 | Open in IMG/M |
| 3300009504|Ga0114946_10444528 | All Organisms → Viruses | 668 | Open in IMG/M |
| 3300010293|Ga0116204_1219046 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 612 | Open in IMG/M |
| 3300010296|Ga0129348_1057739 | Not Available | 1394 | Open in IMG/M |
| 3300010296|Ga0129348_1065405 | Not Available | 1300 | Open in IMG/M |
| 3300010296|Ga0129348_1211539 | unclassified Hyphomonas → Hyphomonas sp. | 658 | Open in IMG/M |
| 3300010299|Ga0129342_1131459 | Not Available | 922 | Open in IMG/M |
| 3300010299|Ga0129342_1305108 | Not Available | 547 | Open in IMG/M |
| 3300010316|Ga0136655_1217421 | Not Available | 569 | Open in IMG/M |
| 3300010354|Ga0129333_10011538 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8372 | Open in IMG/M |
| 3300010354|Ga0129333_10202189 | Not Available | 1806 | Open in IMG/M |
| 3300010354|Ga0129333_10633939 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 925 | Open in IMG/M |
| 3300010354|Ga0129333_11150414 | Not Available | 646 | Open in IMG/M |
| 3300010354|Ga0129333_11462799 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 561 | Open in IMG/M |
| 3300010368|Ga0129324_10185027 | Not Available | 853 | Open in IMG/M |
| 3300010368|Ga0129324_10205985 | Not Available | 797 | Open in IMG/M |
| 3300010370|Ga0129336_10624046 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → unclassified Sphingobacteriales → Sphingobacteriales bacterium | 574 | Open in IMG/M |
| 3300010370|Ga0129336_10670576 | Not Available | 550 | Open in IMG/M |
| 3300010389|Ga0136549_10025904 | All Organisms → Viruses → Predicted Viral | 3394 | Open in IMG/M |
| 3300010392|Ga0118731_100459413 | Not Available | 1017 | Open in IMG/M |
| 3300010885|Ga0133913_12213412 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Roseobacter phage CRP-9 | 1355 | Open in IMG/M |
| 3300012525|Ga0129353_1787068 | Not Available | 817 | Open in IMG/M |
| 3300013004|Ga0164293_10000313 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 37193 | Open in IMG/M |
| 3300013010|Ga0129327_10689777 | Not Available | 571 | Open in IMG/M |
| (restricted) 3300013122|Ga0172374_1120717 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 986 | Open in IMG/M |
| (restricted) 3300013127|Ga0172365_10458747 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 740 | Open in IMG/M |
| (restricted) 3300013129|Ga0172364_10922914 | Not Available | 535 | Open in IMG/M |
| (restricted) 3300013131|Ga0172373_10067478 | Not Available | 2915 | Open in IMG/M |
| (restricted) 3300013132|Ga0172372_10514461 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Roseobacter phage CRP-9 | 789 | Open in IMG/M |
| 3300013372|Ga0177922_10117041 | Not Available | 752 | Open in IMG/M |
| 3300013372|Ga0177922_10368015 | All Organisms → cellular organisms → Bacteria | 5606 | Open in IMG/M |
| (restricted) 3300014720|Ga0172376_10780566 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 512 | Open in IMG/M |
| 3300014819|Ga0119954_1002472 | Not Available | 5591 | Open in IMG/M |
| 3300014819|Ga0119954_1002832 | Not Available | 5133 | Open in IMG/M |
| 3300017697|Ga0180120_10320514 | Not Available | 617 | Open in IMG/M |
| 3300017727|Ga0181401_1029107 | All Organisms → Viruses → Predicted Viral | 1597 | Open in IMG/M |
| 3300017752|Ga0181400_1116364 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 775 | Open in IMG/M |
| 3300017788|Ga0169931_10273287 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1356 | Open in IMG/M |
| 3300017960|Ga0180429_10259215 | Not Available | 1156 | Open in IMG/M |
| 3300017963|Ga0180437_10073905 | Not Available | 3008 | Open in IMG/M |
| 3300017963|Ga0180437_10192708 | All Organisms → Viruses → Predicted Viral | 1610 | Open in IMG/M |
| 3300017963|Ga0180437_10203322 | All Organisms → Viruses → Predicted Viral | 1557 | Open in IMG/M |
| 3300017963|Ga0180437_10274205 | Not Available | 1293 | Open in IMG/M |
| 3300017963|Ga0180437_10485306 | Not Available | 913 | Open in IMG/M |
| 3300017963|Ga0180437_10579147 | Not Available | 821 | Open in IMG/M |
| 3300017963|Ga0180437_10593098 | All Organisms → Viruses → environmental samples → uncultured virus | 810 | Open in IMG/M |
| 3300017963|Ga0180437_11195150 | Not Available | 541 | Open in IMG/M |
| 3300017963|Ga0180437_11258688 | Not Available | 526 | Open in IMG/M |
| 3300017963|Ga0180437_11357518 | Not Available | 502 | Open in IMG/M |
| 3300017971|Ga0180438_10305640 | Not Available | 1224 | Open in IMG/M |
| 3300017971|Ga0180438_10432291 | All Organisms → Viruses | 992 | Open in IMG/M |
| 3300017971|Ga0180438_10567996 | Not Available | 842 | Open in IMG/M |
| 3300017971|Ga0180438_10677716 | Not Available | 759 | Open in IMG/M |
| 3300017987|Ga0180431_10089336 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED203 | 2585 | Open in IMG/M |
| 3300017987|Ga0180431_10170078 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae → unclassified Crocinitomicaceae → Crocinitomicaceae bacterium | 1695 | Open in IMG/M |
| 3300017987|Ga0180431_10352844 | Not Available | 1058 | Open in IMG/M |
| 3300017987|Ga0180431_10531098 | Not Available | 816 | Open in IMG/M |
| 3300017989|Ga0180432_10062128 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3415 | Open in IMG/M |
| 3300017989|Ga0180432_10155876 | Not Available | 1875 | Open in IMG/M |
| 3300017991|Ga0180434_10190707 | All Organisms → Viruses → Predicted Viral | 1648 | Open in IMG/M |
| 3300017991|Ga0180434_10197114 | Not Available | 1617 | Open in IMG/M |
| 3300017991|Ga0180434_10799016 | Not Available | 712 | Open in IMG/M |
| 3300017991|Ga0180434_10898129 | Not Available | 667 | Open in IMG/M |
| 3300018080|Ga0180433_10061135 | Not Available | 3431 | Open in IMG/M |
| 3300018080|Ga0180433_10876601 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
| 3300018080|Ga0180433_11192067 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 552 | Open in IMG/M |
| 3300018424|Ga0181591_10434530 | Not Available | 970 | Open in IMG/M |
| 3300018775|Ga0188848_1000465 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 5319 | Open in IMG/M |
| 3300018775|Ga0188848_1001792 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2486 | Open in IMG/M |
| 3300019696|Ga0194017_1019982 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 704 | Open in IMG/M |
| 3300019738|Ga0193994_1028716 | Not Available | 715 | Open in IMG/M |
| 3300020074|Ga0194113_10231252 | All Organisms → Viruses → Predicted Viral | 1452 | Open in IMG/M |
| 3300020165|Ga0206125_10003519 | Not Available | 14910 | Open in IMG/M |
| 3300020182|Ga0206129_10065511 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Dolichocephalovirinae | 2130 | Open in IMG/M |
| 3300020185|Ga0206131_10237548 | Not Available | 861 | Open in IMG/M |
| 3300020187|Ga0206130_10053106 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 2838 | Open in IMG/M |
| 3300021371|Ga0213863_10442835 | Not Available | 518 | Open in IMG/M |
| 3300021957|Ga0222717_10500401 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium TMED228 | 654 | Open in IMG/M |
| 3300021957|Ga0222717_10686201 | Not Available | 525 | Open in IMG/M |
| 3300021958|Ga0222718_10000441 | All Organisms → Viruses | 42779 | Open in IMG/M |
| 3300021958|Ga0222718_10004389 | All Organisms → cellular organisms → Bacteria | 11732 | Open in IMG/M |
| 3300021958|Ga0222718_10012480 | All Organisms → Viruses | 6204 | Open in IMG/M |
| 3300021958|Ga0222718_10013281 | unclassified Hyphomonas → Hyphomonas sp. | 5974 | Open in IMG/M |
| 3300021958|Ga0222718_10100168 | Not Available | 1710 | Open in IMG/M |
| 3300021958|Ga0222718_10172457 | All Organisms → cellular organisms → Bacteria | 1202 | Open in IMG/M |
| 3300021959|Ga0222716_10091857 | Not Available | 2066 | Open in IMG/M |
| 3300021959|Ga0222716_10588595 | Not Available | 610 | Open in IMG/M |
| 3300021960|Ga0222715_10000480 | Not Available | 39597 | Open in IMG/M |
| 3300021961|Ga0222714_10399347 | Not Available | 726 | Open in IMG/M |
| 3300021964|Ga0222719_10220175 | Not Available | 1283 | Open in IMG/M |
| 3300021964|Ga0222719_10246400 | Not Available | 1190 | Open in IMG/M |
| 3300022053|Ga0212030_1011411 | Not Available | 1112 | Open in IMG/M |
| 3300022053|Ga0212030_1032635 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Roseobacter phage CRP-2 | 726 | Open in IMG/M |
| 3300022053|Ga0212030_1062105 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300022057|Ga0212025_1015830 | Not Available | 1183 | Open in IMG/M |
| 3300022057|Ga0212025_1043790 | Not Available | 770 | Open in IMG/M |
| 3300022061|Ga0212023_1053497 | Not Available | 561 | Open in IMG/M |
| 3300022065|Ga0212024_1000650 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 3005 | Open in IMG/M |
| 3300022065|Ga0212024_1009671 | Not Available | 1416 | Open in IMG/M |
| 3300022065|Ga0212024_1012576 | Not Available | 1290 | Open in IMG/M |
| 3300022065|Ga0212024_1065353 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium TMED228 | 644 | Open in IMG/M |
| 3300022068|Ga0212021_1001057 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 3054 | Open in IMG/M |
| 3300022167|Ga0212020_1088523 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Roseobacter phage CRP-9 | 518 | Open in IMG/M |
| 3300022176|Ga0212031_1049344 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Xanthomonas → Xanthomonas campestris | 706 | Open in IMG/M |
| 3300022176|Ga0212031_1075480 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 574 | Open in IMG/M |
| 3300022178|Ga0196887_1040277 | All Organisms → Viruses | 1246 | Open in IMG/M |
| 3300022178|Ga0196887_1103970 | Not Available | 631 | Open in IMG/M |
| 3300022179|Ga0181353_1000978 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 5612 | Open in IMG/M |
| 3300022179|Ga0181353_1103148 | Not Available | 699 | Open in IMG/M |
| 3300022187|Ga0196899_1045703 | All Organisms → Viruses | 1459 | Open in IMG/M |
| 3300022198|Ga0196905_1002007 | Not Available | 7694 | Open in IMG/M |
| 3300022198|Ga0196905_1048825 | Not Available | 1210 | Open in IMG/M |
| 3300022198|Ga0196905_1064090 | All Organisms → Viruses → Predicted Viral | 1022 | Open in IMG/M |
| 3300022752|Ga0214917_10064171 | All Organisms → Viruses → Predicted Viral | 2363 | Open in IMG/M |
| 3300022821|Ga0222673_1007468 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Pseudoalteromonadaceae → Pseudoalteromonas → unclassified Pseudoalteromonas → Pseudoalteromonas sp. TMED43 | 2127 | Open in IMG/M |
| (restricted) 3300023109|Ga0233432_10086180 | All Organisms → Viruses → Predicted Viral | 1813 | Open in IMG/M |
| 3300023179|Ga0214923_10073870 | Not Available | 2434 | Open in IMG/M |
| 3300023179|Ga0214923_10116083 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1760 | Open in IMG/M |
| (restricted) 3300023210|Ga0233412_10117151 | Not Available | 1126 | Open in IMG/M |
| (restricted) 3300023210|Ga0233412_10120029 | All Organisms → Viruses | 1113 | Open in IMG/M |
| (restricted) 3300023210|Ga0233412_10552666 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 523 | Open in IMG/M |
| (restricted) 3300024059|Ga0255040_10521950 | Not Available | 510 | Open in IMG/M |
| (restricted) 3300024255|Ga0233438_10094494 | Not Available | 1379 | Open in IMG/M |
| 3300024262|Ga0210003_1005785 | Not Available | 9408 | Open in IMG/M |
| 3300024262|Ga0210003_1050537 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales | 2124 | Open in IMG/M |
| 3300024262|Ga0210003_1127680 | All Organisms → Viruses | 1117 | Open in IMG/M |
| 3300024262|Ga0210003_1243118 | Not Available | 714 | Open in IMG/M |
| 3300024262|Ga0210003_1261734 | All Organisms → Viruses | 678 | Open in IMG/M |
| 3300024262|Ga0210003_1346917 | Not Available | 553 | Open in IMG/M |
| 3300024346|Ga0244775_10894186 | Not Available | 706 | Open in IMG/M |
| 3300024433|Ga0209986_10180344 | Not Available | 1068 | Open in IMG/M |
| (restricted) 3300024518|Ga0255048_10207071 | Not Available | 957 | Open in IMG/M |
| (restricted) 3300024518|Ga0255048_10215561 | Not Available | 935 | Open in IMG/M |
| (restricted) 3300024528|Ga0255045_10064267 | All Organisms → Viruses → Predicted Viral | 1262 | Open in IMG/M |
| 3300025483|Ga0209557_1098144 | All Organisms → Viruses | 609 | Open in IMG/M |
| 3300025543|Ga0208303_1015254 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 2276 | Open in IMG/M |
| 3300025543|Ga0208303_1015699 | Not Available | 2237 | Open in IMG/M |
| 3300025543|Ga0208303_1052259 | Not Available | 988 | Open in IMG/M |
| 3300025543|Ga0208303_1069139 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Pelagivirus → Pelagibacter virus HTVC019P | 808 | Open in IMG/M |
| 3300025585|Ga0208546_1010085 | All Organisms → Viruses → Predicted Viral | 2500 | Open in IMG/M |
| 3300025610|Ga0208149_1044332 | Not Available | 1169 | Open in IMG/M |
| 3300025626|Ga0209716_1142904 | Not Available | 628 | Open in IMG/M |
| 3300025646|Ga0208161_1009214 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 4214 | Open in IMG/M |
| 3300025646|Ga0208161_1024496 | All Organisms → Viruses | 2211 | Open in IMG/M |
| 3300025646|Ga0208161_1149402 | Not Available | 585 | Open in IMG/M |
| 3300025647|Ga0208160_1074218 | Not Available | 922 | Open in IMG/M |
| 3300025655|Ga0208795_1052755 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 1197 | Open in IMG/M |
| 3300025655|Ga0208795_1057032 | Not Available | 1137 | Open in IMG/M |
| 3300025671|Ga0208898_1009843 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae | 4837 | Open in IMG/M |
| 3300025674|Ga0208162_1050158 | Not Available | 1405 | Open in IMG/M |
| 3300025674|Ga0208162_1097766 | Not Available | 879 | Open in IMG/M |
| 3300025687|Ga0208019_1027752 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 2140 | Open in IMG/M |
| 3300025687|Ga0208019_1141845 | Not Available | 687 | Open in IMG/M |
| 3300025695|Ga0209653_1001738 | All Organisms → Viruses | 17058 | Open in IMG/M |
| 3300025695|Ga0209653_1094996 | Not Available | 979 | Open in IMG/M |
| 3300025695|Ga0209653_1156948 | All Organisms → Viruses | 663 | Open in IMG/M |
| 3300025696|Ga0209532_1228694 | Not Available | 511 | Open in IMG/M |
| 3300025699|Ga0209715_1030504 | All Organisms → Viruses → Predicted Viral | 2562 | Open in IMG/M |
| 3300025701|Ga0209771_1102727 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED197 | 945 | Open in IMG/M |
| 3300025701|Ga0209771_1155301 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 700 | Open in IMG/M |
| 3300025704|Ga0209602_1142431 | All Organisms → Viruses | 781 | Open in IMG/M |
| 3300025759|Ga0208899_1009871 | unclassified Hyphomonas → Hyphomonas sp. | 5389 | Open in IMG/M |
| 3300025810|Ga0208543_1038934 | All Organisms → cellular organisms → Bacteria | 1186 | Open in IMG/M |
| 3300025870|Ga0209666_1002518 | All Organisms → Viruses | 13636 | Open in IMG/M |
| 3300025876|Ga0209223_10226113 | unclassified Hyphomonas → Hyphomonas sp. | 896 | Open in IMG/M |
| 3300025880|Ga0209534_10141750 | All Organisms → Viruses → Predicted Viral | 1286 | Open in IMG/M |
| 3300025889|Ga0208644_1023324 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3852 | Open in IMG/M |
| 3300026138|Ga0209951_1014689 | Not Available | 1735 | Open in IMG/M |
| 3300026187|Ga0209929_1005019 | All Organisms → Viruses → environmental samples → uncultured virus | 4545 | Open in IMG/M |
| 3300026197|Ga0209925_1033945 | All Organisms → Viruses | 1936 | Open in IMG/M |
| 3300027214|Ga0208306_1001067 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 6028 | Open in IMG/M |
| (restricted) 3300027728|Ga0247836_1002933 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 23760 | Open in IMG/M |
| 3300027747|Ga0209189_1307704 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 614 | Open in IMG/M |
| 3300027759|Ga0209296_1006648 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 7267 | Open in IMG/M |
| 3300027805|Ga0209229_10013340 | All Organisms → Viruses → Predicted Viral | 3495 | Open in IMG/M |
| (restricted) 3300027861|Ga0233415_10003721 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 6309 | Open in IMG/M |
| (restricted) 3300027861|Ga0233415_10007394 | unclassified Hyphomonas → Hyphomonas sp. | 4382 | Open in IMG/M |
| (restricted) 3300027861|Ga0233415_10022941 | All Organisms → Viruses → Predicted Viral | 2493 | Open in IMG/M |
| (restricted) 3300027881|Ga0255055_10102919 | All Organisms → Viruses → Predicted Viral | 1575 | Open in IMG/M |
| (restricted) 3300027996|Ga0233413_10031716 | Not Available | 1997 | Open in IMG/M |
| (restricted) 3300027996|Ga0233413_10269794 | Not Available | 727 | Open in IMG/M |
| 3300028025|Ga0247723_1000219 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 37203 | Open in IMG/M |
| (restricted) 3300028043|Ga0233417_10421950 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Roseobacter phage CRP-9 | 617 | Open in IMG/M |
| 3300028125|Ga0256368_1094935 | Not Available | 501 | Open in IMG/M |
| (restricted) 3300028569|Ga0247843_1048692 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2415 | Open in IMG/M |
| 3300031519|Ga0307488_10060727 | All Organisms → Viruses → Predicted Viral | 2884 | Open in IMG/M |
| 3300031519|Ga0307488_10187539 | Not Available | 1413 | Open in IMG/M |
| 3300031519|Ga0307488_10215715 | All Organisms → Viruses | 1288 | Open in IMG/M |
| 3300031519|Ga0307488_10646968 | Not Available | 606 | Open in IMG/M |
| 3300031539|Ga0307380_10170016 | Not Available | 2141 | Open in IMG/M |
| 3300031539|Ga0307380_10223477 | All Organisms → Viruses | 1800 | Open in IMG/M |
| 3300031566|Ga0307378_10848948 | Not Available | 763 | Open in IMG/M |
| 3300031578|Ga0307376_10720544 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 624 | Open in IMG/M |
| 3300031594|Ga0302131_1257841 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 556 | Open in IMG/M |
| 3300031673|Ga0307377_10170620 | All Organisms → Viruses → environmental samples → uncultured virus | 1710 | Open in IMG/M |
| 3300031758|Ga0315907_10072482 | All Organisms → Viruses → Predicted Viral | 2982 | Open in IMG/M |
| 3300031758|Ga0315907_10196641 | Not Available | 1691 | Open in IMG/M |
| 3300031857|Ga0315909_10112218 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 2324 | Open in IMG/M |
| 3300031857|Ga0315909_10531778 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 803 | Open in IMG/M |
| 3300031857|Ga0315909_10539184 | Not Available | 795 | Open in IMG/M |
| 3300031857|Ga0315909_10569567 | Not Available | 764 | Open in IMG/M |
| 3300031951|Ga0315904_10589567 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 959 | Open in IMG/M |
| 3300032050|Ga0315906_10019069 | All Organisms → cellular organisms → Bacteria | 7669 | Open in IMG/M |
| 3300032050|Ga0315906_10358053 | Not Available | 1288 | Open in IMG/M |
| 3300032093|Ga0315902_10227886 | All Organisms → Viruses → Predicted Viral | 1838 | Open in IMG/M |
| 3300032277|Ga0316202_10376324 | Not Available | 663 | Open in IMG/M |
| 3300032373|Ga0316204_10488681 | All Organisms → Viruses | 919 | Open in IMG/M |
| 3300032373|Ga0316204_10488681 | All Organisms → Viruses | 919 | Open in IMG/M |
| 3300033557|Ga0316617_100113165 | All Organisms → Viruses → Predicted Viral | 1955 | Open in IMG/M |
| 3300034073|Ga0310130_0084216 | Not Available | 950 | Open in IMG/M |
| 3300034374|Ga0348335_009199 | unclassified Hyphomonas → Hyphomonas sp. | 5609 | Open in IMG/M |
| 3300034375|Ga0348336_117752 | Not Available | 857 | Open in IMG/M |
| 3300034418|Ga0348337_149524 | Not Available | 662 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 25.80% |
| Hypersaline Lake Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment | 7.71% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 4.79% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 3.72% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 3.46% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 3.46% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 3.19% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 2.93% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 2.93% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 2.66% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 2.66% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 2.66% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 2.66% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Sediment → Saline Water And Sediment | 2.39% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 2.13% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 2.13% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.86% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Epilimnion → Saline Water And Sediment | 1.86% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 1.33% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 1.33% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.06% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 1.06% |
| Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 1.06% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 1.06% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.80% |
| Microbial Mat | Environmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat | 0.80% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.80% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 0.80% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 0.53% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 0.53% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.53% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.53% |
| Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 0.53% |
| Meromictic Pond | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Meromictic Pond | 0.53% |
| Pond Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Pond Soil | 0.53% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 0.27% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 0.27% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.27% |
| Anoxic Lake Water | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Lake Water | 0.27% |
| Benthic | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Benthic | 0.27% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.27% |
| Marine | Environmental → Aquatic → Marine → Coastal → Sediment → Marine | 0.27% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 0.27% |
| Sea-Ice Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine | 0.27% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.27% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.27% |
| Enviromental | Environmental → Aquatic → Marine → Unclassified → Unclassified → Enviromental | 0.27% |
| Saline Lake | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake | 0.27% |
| Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 0.27% |
| Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water | 0.27% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water And Sediment | 0.27% |
| Hypersaline Samples | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Microbial Mats → Hypersaline Samples | 0.27% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.27% |
| Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment | 0.27% |
| Marine Methane Seep Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Methane Seep Sediment | 0.27% |
| Marine | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Marine | 0.27% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.27% |
| Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Sand | 0.27% |
| Fracking Water | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water | 0.27% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.27% |
| Macroalgal Surface | Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface | 0.27% |
| Hydrocarbon Resource Environments | Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments | 0.27% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2020350000 | Saline water microbial communities from Qinghai Lake, Tibetan Plateau - High mountain lake (assembled) | Environmental | Open in IMG/M |
| 2199352018 | Saline water microbial communities from Qinghai Lake, Tibetan Plateau -Sample 11630 | Environmental | Open in IMG/M |
| 3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
| 3300000115 | Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011 | Environmental | Open in IMG/M |
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
| 3300000418 | Marine microbial community from Union City, CA, USA - Pond 2C Liquid 1 | Environmental | Open in IMG/M |
| 3300000947 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY92 | Host-Associated | Open in IMG/M |
| 3300001460 | Marine viral communities from the Pacific Ocean - LP-28 | Environmental | Open in IMG/M |
| 3300001533 | Benthic freshwater microbial communities from British Columbia, Canada | Environmental | Open in IMG/M |
| 3300001748 | Saline surface water microbial communities from Etoliko Lagoon, Greece - surface water (0 m) | Environmental | Open in IMG/M |
| 3300001943 | Marine microbial communities from Cape May, New Jersey, USA - GS010 | Environmental | Open in IMG/M |
| 3300002144 | Marine microbial communities from the Baltic Sea, analyzing arctic terrigenous carbon compounds - M2t2BS2 (113f) | Environmental | Open in IMG/M |
| 3300002220 | Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - West In Pit SyncrudeMLSB2011 | Engineered | Open in IMG/M |
| 3300003346 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_74LU_5_DNA | Environmental | Open in IMG/M |
| 3300003427 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_116LU_22_DNA | Environmental | Open in IMG/M |
| 3300003617 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_105LU_22_DNA | Environmental | Open in IMG/M |
| 3300003635 | Hypersaline viral communities from Bras del Port, Santa Pola, Spain - Lo Valdivia P5 | Environmental | Open in IMG/M |
| 3300004240 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN | Environmental | Open in IMG/M |
| 3300004448 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
| 3300004457 | Marine viral communities from Newfoundland, Canada MC-1 | Environmental | Open in IMG/M |
| 3300004460 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
| 3300004461 | Marine viral communities from Newfoundland, Canada BC-2 | Environmental | Open in IMG/M |
| 3300005239 | Environmental Genome Shotgun Sequencing: Ocean Microbial Populations from the Gulf of Maine | Environmental | Open in IMG/M |
| 3300005346 | Saline sediment microbial community from Etoliko Lagoon, Greece | Environmental | Open in IMG/M |
| 3300005417 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005512 | Saline surface water microbial communities from Etoliko Lagoon, Greece - halocline_water | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005528 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005611 | Saline surface water microbial communities from Etoliko Lagoon, Greece | Environmental | Open in IMG/M |
| 3300005613 | Saline sediment microbial communities from Etoliko Lagoon, Greece - sediment | Environmental | Open in IMG/M |
| 3300005747 | Seawater microbial communities from Vineyard Sound, MA, USA - control T14 | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300005826 | Microbial communities from Baker Bay sediment, Columbia River estuary, Washington - S.186_BBA | Environmental | Open in IMG/M |
| 3300005914 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKJ | Environmental | Open in IMG/M |
| 3300005940 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_25-Nov-14 | Environmental | Open in IMG/M |
| 3300005941 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 | Environmental | Open in IMG/M |
| 3300006025 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006030 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006425 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006734 | Marine viral communities from the Gulf of Mexico - 31_GoM_OMZ_CsCl metaG | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006868 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006869 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006874 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300007229 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007276 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 | Environmental | Open in IMG/M |
| 3300007344 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 | Environmental | Open in IMG/M |
| 3300007345 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 | Environmental | Open in IMG/M |
| 3300007363 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007537 | Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2_A_D1_MG | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
| 3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
| 3300007611 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R1_A_H2O_MG | Environmental | Open in IMG/M |
| 3300007640 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 | Environmental | Open in IMG/M |
| 3300007778 | Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_C_H2O_MG | Environmental | Open in IMG/M |
| 3300007960 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG | Environmental | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
| 3300008117 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008261 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NA | Environmental | Open in IMG/M |
| 3300008263 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-53-LTR | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
| 3300009000 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_H2O_MG | Environmental | Open in IMG/M |
| 3300009001 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG | Environmental | Open in IMG/M |
| 3300009027 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_H2O_MG | Environmental | Open in IMG/M |
| 3300009071 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 | Environmental | Open in IMG/M |
| 3300009079 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741 | Environmental | Open in IMG/M |
| 3300009086 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713 | Environmental | Open in IMG/M |
| 3300009124 | Marine sediment microbial communities from methane seeps within Hudson Canyon, US Atlantic Margin - Hudson Canyon PC-16 72 cmbsf | Environmental | Open in IMG/M |
| 3300009149 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG | Environmental | Open in IMG/M |
| 3300009154 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG | Environmental | Open in IMG/M |
| 3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300009193 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110321 | Environmental | Open in IMG/M |
| 3300009420 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 | Environmental | Open in IMG/M |
| 3300009434 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516 | Environmental | Open in IMG/M |
| 3300009449 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110426 | Environmental | Open in IMG/M |
| 3300009450 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 4m depth; DNA IDBA-UD | Environmental | Open in IMG/M |
| 3300009466 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 2m depth; DNA IDBA-UD | Environmental | Open in IMG/M |
| 3300009495 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 | Environmental | Open in IMG/M |
| 3300009496 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120524 | Environmental | Open in IMG/M |
| 3300009504 | Lake sediment microbial communities from Walker lake, Nevada to study Microbial Dark Matter (Phase II) - Walker Lake 11/02/13 Deep Sediment | Environmental | Open in IMG/M |
| 3300010293 | Anoxic lake water microbial communities from Lake Kivu, Rwanda to study Microbial Dark Matter (Phase II) - Lake Kivu water 52m metaG | Environmental | Open in IMG/M |
| 3300010296 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_DNA | Environmental | Open in IMG/M |
| 3300010299 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010300 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNA | Environmental | Open in IMG/M |
| 3300010316 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.8_DNA | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010368 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
| 3300010389 | Marine sediment microbial communities from methane seeps within Baltimore Canyon, US Atlantic Margin - Baltimore Canyon MUC-11 12-14 cmbsf | Environmental | Open in IMG/M |
| 3300010392 | Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385 | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300012525 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013010 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_DNA | Environmental | Open in IMG/M |
| 3300013122 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10.3m | Environmental | Open in IMG/M |
| 3300013127 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 48cm | Environmental | Open in IMG/M |
| 3300013129 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 10cm | Environmental | Open in IMG/M |
| 3300013131 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10m | Environmental | Open in IMG/M |
| 3300013132 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_9.5m | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300014720 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_35m | Environmental | Open in IMG/M |
| 3300014819 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1011A | Environmental | Open in IMG/M |
| 3300017697 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2) | Environmental | Open in IMG/M |
| 3300017727 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 24 SPOT_SRF_2011-07-20 | Environmental | Open in IMG/M |
| 3300017752 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 23 SPOT_SRF_2011-06-22 | Environmental | Open in IMG/M |
| 3300017788 | Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20L | Environmental | Open in IMG/M |
| 3300017960 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_S_1 metaG | Environmental | Open in IMG/M |
| 3300017963 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_D_1 metaG | Environmental | Open in IMG/M |
| 3300017971 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_D_2 metaG | Environmental | Open in IMG/M |
| 3300017987 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_MS_1 metaG | Environmental | Open in IMG/M |
| 3300017989 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_MS_2 metaG | Environmental | Open in IMG/M |
| 3300017991 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_D_2 metaG | Environmental | Open in IMG/M |
| 3300018080 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_D_1 metaG | Environmental | Open in IMG/M |
| 3300018424 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018775 | Metatranscriptome of marine microbial communities from Baltic Sea - GS679_0p8 | Environmental | Open in IMG/M |
| 3300019696 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRC_3-4_MG | Environmental | Open in IMG/M |
| 3300019738 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FLT_0-1_MG | Environmental | Open in IMG/M |
| 3300020074 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200m | Environmental | Open in IMG/M |
| 3300020165 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160331_1 | Environmental | Open in IMG/M |
| 3300020182 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160502_2 | Environmental | Open in IMG/M |
| 3300020185 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160517_1 | Environmental | Open in IMG/M |
| 3300020187 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160512_1 | Environmental | Open in IMG/M |
| 3300020595 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160412_1 | Environmental | Open in IMG/M |
| 3300021371 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO497 | Environmental | Open in IMG/M |
| 3300021957 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18D | Environmental | Open in IMG/M |
| 3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
| 3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
| 3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300021964 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34D | Environmental | Open in IMG/M |
| 3300022053 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v2) | Environmental | Open in IMG/M |
| 3300022057 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v2) | Environmental | Open in IMG/M |
| 3300022061 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v2) | Environmental | Open in IMG/M |
| 3300022063 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v2) | Environmental | Open in IMG/M |
| 3300022065 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v2) | Environmental | Open in IMG/M |
| 3300022068 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (v2) | Environmental | Open in IMG/M |
| 3300022167 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (v2) | Environmental | Open in IMG/M |
| 3300022176 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v2) | Environmental | Open in IMG/M |
| 3300022178 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v3) | Environmental | Open in IMG/M |
| 3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
| 3300022187 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3) | Environmental | Open in IMG/M |
| 3300022198 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
| 3300022821 | Saline water microbial communities from Ace Lake, Antarctica - #801 | Environmental | Open in IMG/M |
| 3300023109 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_10_MG | Environmental | Open in IMG/M |
| 3300023179 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510 | Environmental | Open in IMG/M |
| 3300023210 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_4_MG | Environmental | Open in IMG/M |
| 3300024059 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_2 | Environmental | Open in IMG/M |
| 3300024255 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_123_September2016_10_MG | Environmental | Open in IMG/M |
| 3300024262 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300024433 | Deep subsurface microbial communities from Black Sea to uncover new lineages of life (NeLLi) - Black_00105 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300024518 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_2 | Environmental | Open in IMG/M |
| 3300024528 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_23 | Environmental | Open in IMG/M |
| 3300025483 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - Saanich Inlet SI074_LV_120m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025543 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025585 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025610 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025626 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 (SPAdes) | Environmental | Open in IMG/M |
| 3300025646 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025647 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025655 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025671 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes) | Environmental | Open in IMG/M |
| 3300025674 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025687 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025695 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_116LU_22_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025696 | Pelagic Microbial community sample from North Sea - COGITO 998_met_02 (SPAdes) | Environmental | Open in IMG/M |
| 3300025699 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120503 (SPAdes) | Environmental | Open in IMG/M |
| 3300025701 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_59LU_5_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025704 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120524 (SPAdes) | Environmental | Open in IMG/M |
| 3300025759 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes) | Environmental | Open in IMG/M |
| 3300025810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025870 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_125m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025876 | Pelagic Microbial community sample from North Sea - COGITO 998_met_06 (SPAdes) | Environmental | Open in IMG/M |
| 3300025880 | Pelagic Microbial community sample from North Sea - COGITO 998_met_07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300026138 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300026187 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300026197 | Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2_A_D1_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300027214 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027728 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_14m | Environmental | Open in IMG/M |
| 3300027747 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
| 3300027861 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_12_MG | Environmental | Open in IMG/M |
| 3300027881 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_27 | Environmental | Open in IMG/M |
| 3300027996 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_6_MG | Environmental | Open in IMG/M |
| 3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
| 3300028043 (restricted) | Sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - Sediment_Towuti_2014_0.5_MG | Environmental | Open in IMG/M |
| 3300028125 | Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - SB | Environmental | Open in IMG/M |
| 3300028569 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2017_8m | Environmental | Open in IMG/M |
| 3300031519 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2 | Environmental | Open in IMG/M |
| 3300031539 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-3 | Environmental | Open in IMG/M |
| 3300031566 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-1 | Environmental | Open in IMG/M |
| 3300031578 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-2 | Environmental | Open in IMG/M |
| 3300031594 | Marine microbial communities from Western Arctic Ocean, Canada - CB9_20m | Environmental | Open in IMG/M |
| 3300031673 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-3 | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
| 3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
| 3300032277 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month pyrrhotite | Environmental | Open in IMG/M |
| 3300032373 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 6-month pyrrhotite 2 | Environmental | Open in IMG/M |
| 3300033557 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_B | Environmental | Open in IMG/M |
| 3300034073 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XL | Environmental | Open in IMG/M |
| 3300034374 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4) | Environmental | Open in IMG/M |
| 3300034375 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v4) | Environmental | Open in IMG/M |
| 3300034418 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v4) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Qinghai_240840 | 2020350000 | Saline Water | MAKLSIAEKYKQLKRQTERAGMSISEKNRKLIVKRKRKING |
| QLA_00532800 | 2199352018 | Saline Water | KKVTMVKKLTFEDKFKQLKKHTEDAGMKVSEKEGKIVVTKVKTGGKKR |
| DelMOSum2010_100189415 | 3300000101 | Marine | VATKPKKLTDAQKYRQLKSQTEAAGMKVEEVNGKIVVRRKKK* |
| DelMOSum2010_100341596 | 3300000101 | Marine | MAKKLTDAQKYQQLKRQTESAGMAVKEIDGKIVVSRKKRKK* |
| DelMOSum2010_100393396 | 3300000101 | Marine | MAKAKKLTVAEKYRQLKAQTESAGMKVEEVDGKIVVRRKAKKK* |
| DelMOSum2010_101072764 | 3300000101 | Marine | MKTKKLTITQKYRQLKKQTEQAGMKVKEEDGKIVVTGKPKRK* |
| DelMOSum2010_101343774 | 3300000101 | Marine | MATEKKLTSAQKYNQLKKQTESAGMKVKEVDGKIVVTRKKKR* |
| DelMOSum2010_102045652 | 3300000101 | Marine | MTKKKLTPSEKYQQLKKHTENAGMVVKEKEGKIXVTRKXGXXNA* |
| DelMOSum2011_101116611 | 3300000115 | Marine | MTKDKKKLTPSEKYQQLKKHTEDAGMKVKEEDGKII |
| DelMOSpr2010_100324833 | 3300000116 | Marine | MTNKLTPSEKYRQLKKHTEDAGMKVTEKDGKIIVTRKKKK* |
| DelMOSpr2010_100969274 | 3300000116 | Marine | MTKDKKKLTPSEKYQQLKKHTEDAGMKVKEEDGKIIVTRKEKDND* |
| DelMOSpr2010_101444051 | 3300000116 | Marine | MAKKLTPSEKYKQLKKHTENAGMVVKEKEGKIVVTRK |
| DelMOSpr2010_102092312 | 3300000116 | Marine | MTKKLTPSEKYRQLKKHTEDAGMVVKEKAGKIVVTRKKKKNND* |
| DelMOWin2010_100643354 | 3300000117 | Marine | MPKDKKRLTTSEKYQQLKKHTEDAGMKVKEKDGKIIXTXXXXK* |
| DelMOWin2010_100719905 | 3300000117 | Marine | MAKRLTVAEKYRQLKKQTEDAGMKVQEKDGKIVITRKKKK* |
| P_2C_Liq_1_UnCtyDRAFT_10738432 | 3300000418 | Enviromental | MAKEPKLTPAEKYRQLKKHTEDAGMKVTEKNGKIVVTRTRKAK* |
| BBAY92_101859572 | 3300000947 | Macroalgal Surface | MAKKLTDAQKYQQLKRQTETAGMTVKEVDGKIVVSRKKRKK* |
| JGI24003J15210_101746882 | 3300001460 | Marine | MARKLTPSEKYQQLKKHTEDAGMVVKEKDGKIIVKRKKKKNA* |
| MLSed_100740662 | 3300001533 | Benthic | MAKTPAPKRKLTPAEKYRQLKKHTEDAGMTVSEKGGKIVVSKRRPK* |
| JGI11772J19994_10235131 | 3300001748 | Saline Water And Sediment | MTNKLTPSEKYRQLKKHTEDAGMKVTEKDGKIIVTRKKKK |
| GOS2226_10026611 | 3300001943 | Marine | TSAQKYNQLKKQTESAGMKVKEVDGKIVVTRKKKK* |
| M2t2BS2_111317722 | 3300002144 | Marine | VIKLTCKQRYAQLKKHTENAGMKVLEKDGKIIVTRRRKKK* |
| MLSBCLC_104452312 | 3300002220 | Hydrocarbon Resource Environments | MAKKPLTAAEKYRQLKAQTESAGMKVEEVDGKIVVRRKAPKRK* |
| JGI26081J50195_100109916 | 3300003346 | Marine | MAVKRLTAAEKYAQLKAQTEAAGMKVREVGGKIVVDRKRKPAGKK* |
| JGI26084J50262_10663343 | 3300003427 | Marine | MAKKLTVAEKYRQLKAQTESAGMKVEEVNGKIVVRRKPKKKAKS* |
| JGI26082J51739_100117153 | 3300003617 | Marine | VTKKLTAAQKYAQLKAQTEAAGMKVEEVDGKIVVKRKPKK* |
| p5metav_10008112 | 3300003635 | Hypersaline Samples | MPKKLTAAEKYAQLKAQTEAAGMKVREVDGKIVVERKRKPAKKK* |
| Ga0007787_100199282 | 3300004240 | Freshwater Lake | MAKKLTAAEKYAQLKGQTEDAGMTVKEKNRKIVVKKKKKA* |
| Ga0065861_10043142 | 3300004448 | Marine | MPSKKLTPSEKYAQLKAQTEAAGMKVKEVNGKIVVERKKRK* |
| Ga0065861_10119595 | 3300004448 | Marine | MKAKATKKLTVSEKYRQLKAQTEAAGMKVAEVDGKIVVKRKAKKK* |
| Ga0065861_10237521 | 3300004448 | Marine | MVKKKLTVEQKYNQLKKQTENAGMSVKEVDGKIVVTRKKKTG* |
| Ga0065861_10285315 | 3300004448 | Marine | MAKKPLTVTEKYRQLKAQTESAGMKVEEVNGKIVVRRKPKKGK* |
| Ga0065861_10705251 | 3300004448 | Marine | KIMPSKKLTPSEKYAQLKAQTEAAGMKVKEVNGKIVVERKKRK* |
| Ga0065861_10828854 | 3300004448 | Marine | VATKPKKLTDAQKYQQLKSQTEAAGMKVEEVNGKIVVRRKKKSGY* |
| Ga0066224_100626511 | 3300004457 | Marine | MIKKKLTITEKYRQLKKQTEQAGMKVKEEDGKIVVTGKPKRK* |
| Ga0066224_11233703 | 3300004457 | Marine | VATKPKKLTDAQKYRQLKAQTEAAGMKVEEVNGKIVVKQRNRR* |
| Ga0066222_10476926 | 3300004460 | Marine | MTKKLTVEQKYNQLKKQTENAGMSVKEVDGKIVVTRKKYKK* |
| Ga0066223_103608012 | 3300004461 | Marine | RRVATKPKKLTDAQKYRQLKSQTEAAGMKVEEVNGKIVVRRKKK* |
| Ga0073579_12905462 | 3300005239 | Marine | MIKKKLTITQKYRQLKKQTEQAGMKVKEEDGKIVVTGKPKRK* |
| Ga0074242_106637292 | 3300005346 | Saline Water And Sediment | KIMAKLTPAEKYKQLKKHTEDAGMKVTEKDGKIVVTRKKKK* |
| Ga0074242_107080062 | 3300005346 | Saline Water And Sediment | MAKLTPAEKYKQLKKHTEDAGMKVTEKDGKIVVTRKKKNNG* |
| Ga0074242_107587494 | 3300005346 | Saline Water And Sediment | MAKKLTVSEKYRQLKKHTEDAGMKVQEKDGKIVVTRKRKK* |
| Ga0074242_111967111 | 3300005346 | Saline Water And Sediment | MAKLTPAEKYRQLKKHTEDAGMKVTEKDGKIVVTRKKKK* |
| Ga0074242_119288554 | 3300005346 | Saline Water And Sediment | MAKRLTVTEKYRQLKKHTEDAGMKVQEKDGKIVVTRRKK* |
| Ga0068884_15124433 | 3300005417 | Freshwater Lake | MPKAKLTVAQKYSQLKRQTESAGMKVSEKNGKIVVTRRKKK* |
| Ga0074648_101426312 | 3300005512 | Saline Water And Sediment | MAKLTTAEKYRQLKKHTEDAGMKVTEKDGKIVVTRKKKK* |
| Ga0074648_10158094 | 3300005512 | Saline Water And Sediment | MVKKLTVSEKYRQLKKHTEDAGMKVQEKDGKIVVTRKRKK* |
| Ga0074648_10254437 | 3300005512 | Saline Water And Sediment | MPKLTVAEKYKQLKKHTEDAGMKVTEKDGKIVVTRKKKK* |
| Ga0074648_10482636 | 3300005512 | Saline Water And Sediment | MGKKLTPSEKYQQLKKHTEDAGMKVTEKDGKIIVTRKKKK* |
| Ga0074648_10938532 | 3300005512 | Saline Water And Sediment | MAKLTPAEKYKQLKKHTEDAGMKVTEKDGKIVVTRKKKK* |
| Ga0074648_11050591 | 3300005512 | Saline Water And Sediment | MAKRLTVAEKYRQLKKHTEDAGMKVQEKDGKIVVTRKKK* |
| Ga0068876_104401663 | 3300005527 | Freshwater Lake | VPSKPAKRLTVDQKYQQLKSQTERAGMTVKEKDGKIIVSRKKKDK* |
| Ga0068872_102463765 | 3300005528 | Freshwater Lake | VPSKPAKRLTVAQKYQQLKSQTERAGMTVKEKDGKIIVSRKKKDK* |
| Ga0049081_100539715 | 3300005581 | Freshwater Lentic | MAKKLTVAQKYSQLKKQTESAGMKVMEKDGKIVVSRRRKK* |
| Ga0049081_102848692 | 3300005581 | Freshwater Lentic | MAKKLTSSEKYNQLKKQTEDAGMLVVEQDGKIVVLRKKKK* |
| Ga0074647_10225832 | 3300005611 | Saline Water And Sediment | MIKLTCKQRYSQLKKHTENAGMKVEEKNGKIVVTRRKKKK* |
| Ga0074649_10119324 | 3300005613 | Saline Water And Sediment | MAKRLTVTEKYRQLKKHTEDAGMKVQEKDGKIVVTRKKK* |
| Ga0074649_10287103 | 3300005613 | Saline Water And Sediment | MIKLTCKQRYSQLKKHTENAGMKVEEKNGKIIVTRRKKKK* |
| Ga0074649_10684895 | 3300005613 | Saline Water And Sediment | MVKKLTVSEKYRQLKKHTENAGMKVQEKDGKIVVTRKKK* |
| Ga0074649_10957565 | 3300005613 | Saline Water And Sediment | MVKKLTPSEKYRQLKKHTEDAGMKVQEKDGKIVVTRKKK* |
| Ga0076924_12400223 | 3300005747 | Marine | MTKKLTVEQKYNQLKKQTENAGMSVKEVDGKIVVTRKKYKNGKAT* |
| Ga0079957_10173964 | 3300005805 | Lake | MLKKYVKPLSVAEKYMQLKKQTEAAGMTVTEKDGKIIVSRRRR* |
| Ga0079957_10278875 | 3300005805 | Lake | MAKKLTAAEKYAQLKGQTEDAGMTVKEKNRKIVVKKKKKG* |
| Ga0074477_13819032 | 3300005826 | Sediment (Intertidal) | VVTKPKKLTDSQKYRQLKSQTEAAGMKVEEVNGKIVVRRKKK* |
| Ga0075117_10341982 | 3300005914 | Saline Lake | LTVEQKYRQLKRQTEAAGMTVSERDGKIVVSRKRS |
| Ga0073913_100494852 | 3300005940 | Sand | MAKKLTVAQKYSQLKKQTESAGMKVMEKDGKIVVSRRKKK* |
| Ga0070743_101364872 | 3300005941 | Estuarine | MKAKATKKLTVSEKYRQLKAQTEAAGMKVAEVGGKIVVKRKAKKK* |
| Ga0075474_100111831 | 3300006025 | Aqueous | MAKLTPSEKYKQLKKHTEDAGMKVTEKDGKIVVTRKKKK* |
| Ga0075470_100659562 | 3300006030 | Aqueous | MASKKLTASQKYSQLKSQTERAGMTVKEVNGKIVVSRKRKK* |
| Ga0075486_18083744 | 3300006425 | Aqueous | EKYQQLKKHTENAGMVVKEKEGKIVVTRKKKKNND* |
| Ga0098073_10101931 | 3300006734 | Marine | VIKLTCKQRYAQLKKHTENAGMKVLEKDGKIIVTRRKKKK* |
| Ga0070749_100194673 | 3300006802 | Aqueous | MTKKLTPSEKYRQLKKHTENAGMVVKEKEGKIVVTRKKGKKNA* |
| Ga0070749_1001997911 | 3300006802 | Aqueous | TVTKKLTVAEKYRQLKAQTESAGMKVEEVDGKIVVRRKPKNKK* |
| Ga0070749_1002884212 | 3300006802 | Aqueous | MVKLTVAEKYKQLKKQTEDAGMKVTEKDGKIVVTRKKKK* |
| Ga0070749_100930964 | 3300006802 | Aqueous | MIKLTCKQRYSQLKKHTENAGMKVKEEDGKIIVTRKRKK* |
| Ga0070749_102492171 | 3300006802 | Aqueous | MATTKKKLTPAQKYSQLKRQTESAGMKVKEVDGKIVVTRK |
| Ga0070749_103312284 | 3300006802 | Aqueous | MARLSVAEKYKQLKKQTEDAGMKVSEKDGKIVVTRKKKK* |
| Ga0070749_104228613 | 3300006802 | Aqueous | MAKKPAAKKLTDAQKYRQLKAQTEAAGMKVEEVDGKIVVRRKK* |
| Ga0070749_105138282 | 3300006802 | Aqueous | VAKLTAAQKYAQLKRQTEQAGMTVSVKGQKVVVSRKKKRRKKA* |
| Ga0075467_103322274 | 3300006803 | Aqueous | VAKKLTPSEKYKQLKKHTENAGMKVVEKDGKIVVRRKR |
| Ga0075467_107281572 | 3300006803 | Aqueous | MAKKPLTAAEKYRQLKAQTERAGMKVEEVDGKIVVRRKPKGK* |
| Ga0075464_110586763 | 3300006805 | Aqueous | MKKLTVAQKYKDLKKQTESAGMKVTEKKGKLVVSRK |
| Ga0070754_1000328711 | 3300006810 | Aqueous | VTKKLTVAEKYRQLKAQTESAGMKVEEVDGKIVVRRKPKNKK* |
| Ga0070754_100428398 | 3300006810 | Aqueous | MAKRLTVSEKYRQLKKHTENAGMKVQEKDGKIVVTRKKK* |
| Ga0070754_100677263 | 3300006810 | Aqueous | MKKKLTITQKWRQLKKQTEDAGMEVKEQNGKIVVTRKQKRK* |
| Ga0070754_102277843 | 3300006810 | Aqueous | MIKLTCKQRYSQLKKHTENAGMRVLEKNGKIIVTRRKKKK* |
| Ga0070754_103224012 | 3300006810 | Aqueous | MSKKLTPSEKYKQLKKHTENAGMKVVEKDGKIIVRKKGKNNG* |
| Ga0070754_103358732 | 3300006810 | Aqueous | MAKRLTVAEKYRQLKKQTEDAGMKVQEKDGKIVVTRKKK* |
| Ga0070754_103990573 | 3300006810 | Aqueous | MAKKLTPAQKYSQLKRQTESAGMKVKEVDGKIVVTRK |
| Ga0070754_104423573 | 3300006810 | Aqueous | LTVAEKYRQLKKQTEDAGMKVQEKDGKIVVTRKKKK* |
| Ga0070754_104528032 | 3300006810 | Aqueous | MIKKKLTITQKWRQLKKQTEDAGMEVKEQNGKIVVIRKQKRK* |
| Ga0070754_105278332 | 3300006810 | Aqueous | MTKKKLTPLEKYQQLKKHTENAGMVVKEKEGKIVVTRKKGKRNA* |
| Ga0075481_102512882 | 3300006868 | Aqueous | MKAKATKKLTVSEKYRQLKAQTEAAGMKVAEVDGKIVVKRKVKKK* |
| Ga0075477_100152804 | 3300006869 | Aqueous | MPKLTAAEKYRQLKKQTEDAGMKVTEKDGKIVVTRKKKK* |
| Ga0075475_100765712 | 3300006874 | Aqueous | MKKKLTITQKWRQLKKQTEDAGMEVKEQNGKIVVIRKQKRK* |
| Ga0075475_101168144 | 3300006874 | Aqueous | VSKKLTPSEKYKQLKKHTENAGMKVVEKDGKIIVRKKGKNNG* |
| Ga0070750_100066894 | 3300006916 | Aqueous | MTKKKLTPSEKYQQLKKHTENAGMVVKEKEGKIVVTR |
| Ga0070750_102011872 | 3300006916 | Aqueous | MAKLTPAEKYKQLKKHTEDAGMKVMEKDGKIVVTRKKKK* |
| Ga0070750_102647662 | 3300006916 | Aqueous | MTKKLTPSEKYRQLKKHTEDAGMVVKEKAGKIVVTKKKGKKNG* |
| Ga0070746_100327941 | 3300006919 | Aqueous | MTKNKKKLTPSEKYQQLKKHTENAGMKVKEEDGKI |
| Ga0070746_103703773 | 3300006919 | Aqueous | MPKDKKRLTTSEKYQQLKKHTEDAGMKVKEKDGKIIVTRK |
| Ga0075468_101006601 | 3300007229 | Aqueous | KLTPSEKYQQLKKHTENAGMVVKEKEGKIVVTRKKGKRNA* |
| Ga0075468_101461433 | 3300007229 | Aqueous | MAKKPLTAAEKYRQLKAQTERAGMKVEEVDGKIVVRRKP |
| Ga0070747_10480321 | 3300007276 | Aqueous | SEKYQQLKKHTENAGMVVKEKEGKIVVTRKKGKRNA* |
| Ga0070745_10116738 | 3300007344 | Aqueous | VTKKLTVAEKYRQLKAHTESAGMKVEEVDGKIVVRRKPKNKK* |
| Ga0070745_10896766 | 3300007344 | Aqueous | MATEKKLTSAQKYNQLKKQTESAGMKVKEVDGKIVVTRKRKK* |
| Ga0070752_12613511 | 3300007345 | Aqueous | IMAKLTPAEKYKQLKKHTEDAGMKVTEKDGKIVVTRKKKK* |
| Ga0075458_100140512 | 3300007363 | Aqueous | VKKLTAAQKYSQLKKQTEAAGMKVREVKGKIVVSRRKKK* |
| Ga0102934_10804172 | 3300007537 | Pond Soil | MAKKPAAKKLTPSEKYRQLKKHTEDAGMSVTEKDGKIVVRRKSRKG* |
| Ga0099851_10552211 | 3300007538 | Aqueous | LTPAEKYKQLKKHTEDAGMKVTEKDGKIVVTRKKKK* |
| Ga0099851_11548372 | 3300007538 | Aqueous | MPKKRLTAAQKYNQLKRQTESAGMKVSEKNGKIVVSRRKKK* |
| Ga0099851_11814673 | 3300007538 | Aqueous | MKKLTPSEKYSQLKKHTENAGMTVVEKNGKIIVTRKKKK* |
| Ga0099851_12437883 | 3300007538 | Aqueous | VTKKLTVAQKYAQLKAQTEAAGMKVEEVDGKIVVRRKPKAKK* |
| Ga0099851_13229491 | 3300007538 | Aqueous | MAKLTSAEKYKQLKKHTEDAGMKVTEKDGKIVVTRKKKK* |
| Ga0099849_10844392 | 3300007539 | Aqueous | VTKKLTAAQKYAQLKAQTERAGMKVEEVDGKIVVRRKPKAKK* |
| Ga0099847_11948771 | 3300007540 | Aqueous | KRLTVSEKYRQLKKHTENAGMKVQEKDGKIVVTRKKK* |
| Ga0099847_11966552 | 3300007540 | Aqueous | MAKLTPAEKYKQLKKHTEDAGMKVTEKDGKIWLPERRKNK |
| Ga0099847_12110672 | 3300007540 | Aqueous | MVKLTVAEKYKQLKKQTEDAGMKVSEKDGKIVVTRKKKK* |
| Ga0099848_10443393 | 3300007541 | Aqueous | VTAKRLTAAQKYAQLKAQTERAGMKVEEVDGKIVVRRKPKAKK* |
| Ga0102927_10163507 | 3300007611 | Pond Water | NTRAAKKLTPSQKYRQLKRHTEDAGMSVREVDGKIVVKES* |
| Ga0070751_10310422 | 3300007640 | Aqueous | MARKLTPSEKYKQLKKHTENAGMVVKEKEGKIVVTRKKK |
| Ga0102954_11224661 | 3300007778 | Water | MAKLTVAEKYKQLKKHTEDAGMKVTEKDGKIMVTRKKKK* |
| Ga0099850_11310883 | 3300007960 | Aqueous | MKKLTPSEKYSQLKKHTENAGMTVVEKDGKIIVTKKK |
| Ga0114340_10036119 | 3300008107 | Freshwater, Plankton | MPKAKLTTAQKYSQLKKQTESAGMKVSEKNGKIVVSRRKKK* |
| Ga0114350_100053851 | 3300008116 | Freshwater, Plankton | MKRLSAAQKYAQLKKQTEGAGMTVREKAGKIVVSRRKKKKRG* |
| Ga0114351_100144134 | 3300008117 | Freshwater, Plankton | MAKKLTTAQKYSQLKKQTEQAGMKVTERNGKLIVTRKKKK* |
| Ga0114351_10195416 | 3300008117 | Freshwater, Plankton | MAKKLTVTQKYSMLKKQTEQAGMMVMEKNGKLVVTRKKKKK* |
| Ga0114336_100040325 | 3300008261 | Freshwater, Plankton | MAKRLTISEKYRQLKRQTEQAGMNVTEKNGKLIVSRKKKKK* |
| Ga0114349_10689928 | 3300008263 | Freshwater, Plankton | MPKAKLTVAQKYSKLKRQTESAGMKVSEKNGKIVVTRRKKK* |
| Ga0114363_10488505 | 3300008266 | Freshwater, Plankton | MKKLTVAQKWRQLKRMTEEAGMTVTEKDGKLIVSRKKKK* |
| Ga0114364_10455297 | 3300008267 | Freshwater, Plankton | MKKLTTTQKYNQLKRQTESAGMTVTEKNGKLVVSRKRKKNAK |
| Ga0102960_11908142 | 3300009000 | Pond Water | MATTKKKLTTTQKYNQLKRQTENAGMKVKEVDGKIVITRKKKK* |
| Ga0102963_10171343 | 3300009001 | Pond Water | MAKLTVAEKYKQLKKHTEDAGMKVTEKDGKIVVTRKKKK* |
| Ga0102963_11605892 | 3300009001 | Pond Water | MPKLTVAEKYKQLKKHTEDAGMKVTEKDGKIVVTR |
| Ga0102963_12137851 | 3300009001 | Pond Water | MAKRLTATEKYRQLKKHTEDAGMKVQEKDGKIVVTRKKK* |
| Ga0102963_12891472 | 3300009001 | Pond Water | MKKKLTVTQKYRQLKKQTEDAGMKVKEEDGKIVVTRK |
| Ga0102957_11944321 | 3300009027 | Pond Water | MTTKKLTVAEKYRQLKAQTEAAGMTVKEVNGKIVVTRNKKK* |
| Ga0102957_14228971 | 3300009027 | Pond Water | KVMAKLTPAEKYKQLKKHTEDAGMKVTEKDGKIVVTRKKKN* |
| Ga0115566_1000447919 | 3300009071 | Pelagic Marine | MAKKLTDAQKYQQLKRQTETAGMAVKEVDGKIVVSRKKRKK* |
| Ga0102814_103563553 | 3300009079 | Estuarine | MPTKKLTDAQKYQQLKRQTESAGMSVKEVDGKIVVSRKKKKAK* |
| Ga0102812_104042941 | 3300009086 | Estuarine | MPTKKLTDAQKYQQLKRQTESAGMSVKEVDGKIVVTRKKKK* |
| Ga0118687_101735722 | 3300009124 | Sediment | LTPSEKYQQLKKHTENAGMKVKEEDGKIIVTRKKKK* |
| Ga0114918_100305693 | 3300009149 | Deep Subsurface | MKKLTDAEKYRQLKAQTEKAGMTVREIDGKIVVSRRKGKP* |
| Ga0114918_100338839 | 3300009149 | Deep Subsurface | MTKLTPAEKYKQLKKHTEDAGMKVTEKDGKIVVTRKKKK* |
| Ga0114918_102181031 | 3300009149 | Deep Subsurface | MAKRLTVAEKYRQLKKQTEDAGMKVQEKDGKIVVTRKKKK* |
| Ga0114918_104224743 | 3300009149 | Deep Subsurface | MAKEKKLTPAQKYNQLKRQTESAGMKVKEVDGKIVVIRKKKK* |
| Ga0114918_105036992 | 3300009149 | Deep Subsurface | MSKKLTPAQKYSQLKRQTESAGMKVKEVDGKIVVTRKKKK* |
| Ga0114963_100159146 | 3300009154 | Freshwater Lake | MPDKRLTVSEKYRQLKAQTERAGMTVKEKDGKIVVSRKKKAK* |
| Ga0114968_107737201 | 3300009155 | Freshwater Lake | MKKLTVAQKYKDLKKQTESAGMKVTEKKGKLVVSRKK |
| Ga0114975_105801141 | 3300009164 | Freshwater Lake | VMPDKRLTVSEKYRQLKAQTERAGMTVKEKDGKIVVSRKKKAK* |
| Ga0114974_100126303 | 3300009183 | Freshwater Lake | MVKKKLTVAQKYNQLKKQTESAGMKVIVKDGKVVVTRKKKK* |
| Ga0115551_12335305 | 3300009193 | Pelagic Marine | MAKEKKLTPAQKYNQLKRQTESAGMKVKEVDGKIVVT |
| Ga0114994_107895182 | 3300009420 | Marine | MAKKLTDAQKYQQLKRQTESAGMAVKEVDGKIVVSRKKRKK* |
| Ga0115562_11199705 | 3300009434 | Pelagic Marine | MAKEKKLTPAQKYNQLKRQTESAGMKVKEVDGKIVVTRKKK |
| Ga0115558_10488083 | 3300009449 | Pelagic Marine | MTKKKLTPSEKYQQLKKHTENAGMVVKEKEGKIVVTRKK |
| Ga0127391_10101953 | 3300009450 | Meromictic Pond | VAKKLTAAQKYSQLKKHTENAGMTVVEKDGKIIVSRKKKK* |
| Ga0126448_10755132 | 3300009466 | Meromictic Pond | MAKKLTFEEKYKQLKKHTEDAGMKVKEVEGKIVVERIKKGSKK* |
| Ga0115571_11569473 | 3300009495 | Pelagic Marine | MVKKVIKKTLSPSEKYRQLKAQTEAAGMKVSEVNGKIVVKRRSKK* |
| Ga0115571_13132951 | 3300009495 | Pelagic Marine | MAKKLTDAQKYQQLKRQTESAGMAVKEVDGKIVVSRKGKKK* |
| Ga0115570_104415022 | 3300009496 | Pelagic Marine | MVKKVIKKTLSPSEKYRQLKAQTEAAGMMVSEVNGKIVVKRRSKK* |
| Ga0114946_104445282 | 3300009504 | Sediment | MVKKLTVAQKYSQLKKHTENAGMKVTEKDGKIVVTRKGKK* |
| Ga0116204_12190462 | 3300010293 | Anoxic Lake Water | MAVKKLTVAQKYRQLKAQTERAGMKVTEKNGKIVVTRRKKK* |
| Ga0129348_10577397 | 3300010296 | Freshwater To Marine Saline Gradient | MAKKLTPAQKYSQLKRQTESAGMKVKEVDGKIVVTRKKKK* |
| Ga0129348_10654053 | 3300010296 | Freshwater To Marine Saline Gradient | TPAEKYKQLKKHTEDAGMKVTEKDGKIVVTRKKKK* |
| Ga0129348_12115393 | 3300010296 | Freshwater To Marine Saline Gradient | MTKKKLTPSEKYQQLKKHTENAGMVVKEKEGKIVV |
| Ga0129342_11314592 | 3300010299 | Freshwater To Marine Saline Gradient | MVKLTPAEKYKQLKKHTEDAGMKVTEKDGKIVVTRKKKK* |
| Ga0129342_13051082 | 3300010299 | Freshwater To Marine Saline Gradient | MATTKKKLTPAQKYSQLKRQTESAGMKVKEVDGKIVVTRKKK |
| Ga0129351_11953662 | 3300010300 | Freshwater To Marine Saline Gradient | MAKKLSCSQKYSQLKRHTENAGMTVKEVDGKIVVKRKVKNVKKNKK* |
| Ga0136655_12174212 | 3300010316 | Freshwater To Marine Saline Gradient | MAKLTPAEKYKQLKKHTEDAGMKVMEKDGKIVVTRK |
| Ga0129333_1001153815 | 3300010354 | Freshwater To Marine Saline Gradient | VKKLTAAQKYSQLKKQTEAAGMKVREVKGKIVVSRRKK |
| Ga0129333_102021891 | 3300010354 | Freshwater To Marine Saline Gradient | LTAAQKYSQLKKQTEAAGMKVREVKGKIVVSRRKKK* |
| Ga0129333_106339393 | 3300010354 | Freshwater To Marine Saline Gradient | MKRLSTAQKYAQLKKQTEGAGMTVREKGGKIVVSRRKKKKRG* |
| Ga0129333_111504143 | 3300010354 | Freshwater To Marine Saline Gradient | VIKKLTPAEKYQQLKAQTEAAGMRVEEVAGKIVVRRKIKPKAKK* |
| Ga0129333_114627991 | 3300010354 | Freshwater To Marine Saline Gradient | MKRLTAAQKYAQLKKQTERAGMTVREKAGKIVVSRKRRKRG* |
| Ga0129324_101850273 | 3300010368 | Freshwater To Marine Saline Gradient | MATTKNKLTASQKYNQLKRQTESAGMKVKEVDGKIVVTRKKKK* |
| Ga0129324_102059851 | 3300010368 | Freshwater To Marine Saline Gradient | QIRGVRKMAKRLTVAEKYRQLKKQTEDAGMKVQEKDGKIVVTRKKK* |
| Ga0129336_106240462 | 3300010370 | Freshwater To Marine Saline Gradient | MLKKYVKPLSVAEKYMQLKKQTEAAGMIVTEKDGKIIVSRRRR* |
| Ga0129336_106705762 | 3300010370 | Freshwater To Marine Saline Gradient | MKAKKLTVAQKYRQLKKQTESAGMTITEKNGKLIVSRKKKK* |
| Ga0136549_1002590410 | 3300010389 | Marine Methane Seep Sediment | MAKAPSKSKLTPAEKYRQLKKHTEDAGMKVTEKDGKIVVTRKRKSK* |
| Ga0118731_1004594133 | 3300010392 | Marine | MAVKKLTVAEKYAQLKAQTEAAGMKVREVNGKIVVERKRKPAAKK* |
| Ga0133913_122134123 | 3300010885 | Freshwater Lake | MKKLTTTQKYNQLKRQTESAGMTVTEKSGKLVVSRKRKKNAKGKA* |
| Ga0129353_17870683 | 3300012525 | Aqueous | MKKLTPAQKYSQLKRQTESAGMKVKEVDGKIVVTRKKKK* |
| Ga0164293_1000031316 | 3300013004 | Freshwater | VAKKLTVAQKYSQLKKHTENAGMKVMEKDGKIVVSRRKKK* |
| Ga0129327_106897772 | 3300013010 | Freshwater To Marine Saline Gradient | MIKKKLTITQKYRQLKKQTEQAGMKVKEEDGKIVVTG |
| (restricted) Ga0172374_11207171 | 3300013122 | Freshwater | MVVKKLTVAQKYRQLKAQTERAGMKVTEKNGKIVVTRRKKK* |
| (restricted) Ga0172365_104587473 | 3300013127 | Sediment | MAVKKLTVAQKYRQLKSQTERAGMKVTEKNGKIVVTRRKKK* |
| (restricted) Ga0172364_109229143 | 3300013129 | Sediment | MAVKKLTVAQKYRQLKAQTERAGMKVTEKNGKIVVTRRK |
| (restricted) Ga0172373_100674784 | 3300013131 | Freshwater | MAKKLTAVEKYAQLKGQAEDAGMTIKEKNRKIVVTKKKKK* |
| (restricted) Ga0172372_105144614 | 3300013132 | Freshwater | MVVKKLTVAQKYRQLKAQTERAGMKVTEKNGKIVVTRRK |
| Ga0177922_101170412 | 3300013372 | Freshwater | MAKKLTSQEKYNQLKKQTEDAGMLVVEQNGKIVVTRKKKK* |
| Ga0177922_103680153 | 3300013372 | Freshwater | MLKKYVKPLSIAEKYMQLKKQTEAAGMTVTEKDGKIIVSRRRR* |
| (restricted) Ga0172376_107805662 | 3300014720 | Freshwater | MVVKKLTIAQKYRQLKAQTERAGMKVTEKNGKIVVTRRKKK* |
| Ga0119954_100247213 | 3300014819 | Freshwater | MVKKLTAAEKYAQLKGQTEDAGMTVKEKNRKIVVKKKKKA* |
| Ga0119954_10028329 | 3300014819 | Freshwater | MKKLTTAQKYSSLKKQTEDAGMKVSEQNGKLIVTKKKKK* |
| Ga0180120_103205142 | 3300017697 | Freshwater To Marine Saline Gradient | MAKKLTPSEKYKQLKKHTENAGMVVKEKEGKIVVTRKK |
| Ga0181401_10291074 | 3300017727 | Seawater | ATKKLTVSEKYRQLKAQTEAAGMKVAEVDGKIVVKRKAKKK |
| Ga0181400_11163642 | 3300017752 | Seawater | LMAKKPVAKKLTPAEKYRQLKSQTEAAGMKVEEVNGKIVVKRKKK |
| Ga0169931_102732873 | 3300017788 | Freshwater | MAVKKLTVAQKYRQLKAQTERAGMKVTEKNGKIVVTRRKKK |
| Ga0180429_102592154 | 3300017960 | Hypersaline Lake Sediment | MAEKRLTVTEKYRQLKAHTERAGMKVEEKNGRIVVTRKK |
| Ga0180437_100739056 | 3300017963 | Hypersaline Lake Sediment | MAKLTPAEKYRQLKKHTEDAGMKVTEKDGKIVVTRKKKK |
| Ga0180437_101927084 | 3300017963 | Hypersaline Lake Sediment | MPGSKTKRLTPAEKYRQLKAQTEAAGMKVEEKDGKIVVSRRRKR |
| Ga0180437_102033225 | 3300017963 | Hypersaline Lake Sediment | MSKKLTPSEKYQQLKKHTEDAGMKVQEKDGKIIVTRKKKK |
| Ga0180437_102742053 | 3300017963 | Hypersaline Lake Sediment | MAKKLTVSEKYRQLKKHTEDAGMKVQEKDGKIVVTRKRKK |
| Ga0180437_104853063 | 3300017963 | Hypersaline Lake Sediment | MAKRLTVAEKYRQLKKQTEDAGMKVQEKDGKIVVTRKKKK |
| Ga0180437_105791473 | 3300017963 | Hypersaline Lake Sediment | MVIKLTAAEKYAQLKAQTEAAGMKVREVGGKIVVERKRKPASKK |
| Ga0180437_105930982 | 3300017963 | Hypersaline Lake Sediment | MAKKLTVSEKYRQLKKHTENAGMKVQEKDGKIVVTRKGKK |
| Ga0180437_111951502 | 3300017963 | Hypersaline Lake Sediment | MANKLTPTENYKQLKKHTENAGIKVVEKDGKIIVRKKKKNEKTR |
| Ga0180437_112586882 | 3300017963 | Hypersaline Lake Sediment | MGKKLTPSEKYQQLKKHTEDAGMKVTEKDGKIIVTRKKKK |
| Ga0180437_113575182 | 3300017963 | Hypersaline Lake Sediment | MAKKLTVSEKYRQLKKHTENAGMKVQEKDGKIVVTRKKK |
| Ga0180438_103056403 | 3300017971 | Hypersaline Lake Sediment | MTKKLTPAEKYKQLKKHTEEAGMKVSEKNGKIIVT |
| Ga0180438_104322912 | 3300017971 | Hypersaline Lake Sediment | MVKKLTAAEKYAQLKAQTEAAGMKVREVGGKIVVERKRKPASKK |
| Ga0180438_105679962 | 3300017971 | Hypersaline Lake Sediment | MPKLTTAEKYRKLKKHTEDAGMKVTEKDGKIVVTRKKKK |
| Ga0180438_106777163 | 3300017971 | Hypersaline Lake Sediment | MPKKLTPSEKYQQLKKHTENAGMKVEEVNGKIVVTKIKKK |
| Ga0180431_100893364 | 3300017987 | Hypersaline Lake Sediment | MAKKLTPSEKYQQLKKHTENAGMKVEEVNGKIVVTKKRKK |
| Ga0180431_101700783 | 3300017987 | Hypersaline Lake Sediment | MTKEPKLTPAEKYRQLKKHTEDAGMKVTEKAGKIVVTRTRKAK |
| Ga0180431_103528443 | 3300017987 | Hypersaline Lake Sediment | MAKRLTVAEKYRQLKKHTEDAGMKVQEKEGKIIVTRKKK |
| Ga0180431_105310982 | 3300017987 | Hypersaline Lake Sediment | MPGNKTKRLTPAEKYRQLKAQTEAAGMKVEEKDGKIVVSRRRKR |
| Ga0180432_100621282 | 3300017989 | Hypersaline Lake Sediment | MAKEPKLTPAEKYRQLKKHTEDAGMKVTEKAGKIVVTRTRKAK |
| Ga0180432_101558764 | 3300017989 | Hypersaline Lake Sediment | MGKKLTPSEKYQQLKKHTEDAGMKVQEKDGKIIVTRKKKK |
| Ga0180434_101907075 | 3300017991 | Hypersaline Lake Sediment | MAKEPSKRKLTYTEKYRQLKKHTEDAGMKVEEKDGKIVVTRTRKAK |
| Ga0180434_101971146 | 3300017991 | Hypersaline Lake Sediment | MAKKLTVSEKYRQLKKHTEDAGMKVQEKDGKIVVTRKRKSK |
| Ga0180434_103407024 | 3300017991 | Hypersaline Lake Sediment | MAKKLSCSQKYSQLKRHTENAGMTVKEVDGRIVVKRKAKNVKKNKK |
| Ga0180434_107990163 | 3300017991 | Hypersaline Lake Sediment | MAKRLTVAEKYRQLKKQTEDAGIKVQEKDGKIVVTRKKKK |
| Ga0180434_108981292 | 3300017991 | Hypersaline Lake Sediment | MPKKLTPSEKYQQLKKHTENAGMKVEEVNGKIVVTKKRKK |
| Ga0180433_100611357 | 3300018080 | Hypersaline Lake Sediment | MPKLTTAEKYRQLKKHTEDAGMKVTEKDGKIVVTRKKKK |
| Ga0180433_108766012 | 3300018080 | Hypersaline Lake Sediment | MAEKRLTVAEKYRQLKAHTERAGMKVEEKNGRIVVTRKKR |
| Ga0180433_111920671 | 3300018080 | Hypersaline Lake Sediment | MAKRLTVAEKYRQLKKQTEDAGMKVQEKDGKIVVTRKKK |
| Ga0181591_104345302 | 3300018424 | Salt Marsh | MPKLTVAEKYKQLKKHTENAGMKVTEKDGKIVVTRKKKK |
| Ga0188848_10004658 | 3300018775 | Freshwater Lake | VADKKLTVAQKYSQLKKHTENAGMTVKEKNGKIVVSRRKKK |
| Ga0188848_10017924 | 3300018775 | Freshwater Lake | MKKLTPSEKYSQLKKHTENAGMTVVEKDGKIIVTKKKKK |
| Ga0194017_10199823 | 3300019696 | Sediment | MATTKKKLTPAQKYSQLIRQTENAGMKVVEKDGKIVVTRKKKK |
| Ga0193994_10287162 | 3300019738 | Sediment | MATTKKKLTPAQKYSQLKRQTESAGMKVKEIDGKIVVTRKKKK |
| Ga0194113_102312523 | 3300020074 | Freshwater Lake | MVVKKLTVAQKYRQLKAQTERAGMKVTEKNGKIVVTRRKKK |
| Ga0206125_100035197 | 3300020165 | Seawater | MVKKVIKKTLSPSEKYRQLKAQTEAAGMMVSEVNGKIVVKRRSKK |
| Ga0206129_100655112 | 3300020182 | Seawater | MIKKKLTITQKYRQLKKQTEQAGMKVKEEDGKIVVTGKPKRK |
| Ga0206131_102375483 | 3300020185 | Seawater | MVKKLTDSQKYQQLKRQTERAGMTVKEVDGKIVVSRKKRKK |
| Ga0206130_100531061 | 3300020187 | Seawater | TMTQKYRQLKKQTEQAGMKVKEEDGKIVVTGKPKRK |
| Ga0206126_103418003 | 3300020595 | Seawater | LGKQGEVVMVKKVIKKTLSPSEKYRQLKAQTEAAGMMVSEVNGKIVVKRRSKK |
| Ga0213863_104428351 | 3300021371 | Seawater | KLTITQKYRQLKKQTENAGMEVKEENGKLVVTRKRKRK |
| Ga0222717_105004012 | 3300021957 | Estuarine Water | MARKLTPSEKYQQLKKHTEDAGMVVKEKDGKIIVKRKKKKNA |
| Ga0222717_106862012 | 3300021957 | Estuarine Water | MKAKATKKLTVSEKYRQLKAQTEAAGMKVAEVDGKIVVKRKAKKK |
| Ga0222718_1000044149 | 3300021958 | Estuarine Water | MVKKLTPSEKYRQLKKHTEDAGMKVQEKDGKIVVTRKKK |
| Ga0222718_100043895 | 3300021958 | Estuarine Water | MPKLTAAEKYRQLKKQTEDAGMKVTEKDGKIVVTRKKKK |
| Ga0222718_1001248010 | 3300021958 | Estuarine Water | MPTKKLTDAQKYQQLKRQTESAGMSVKEVDGKIVVSRKKKKKSGY |
| Ga0222718_100132813 | 3300021958 | Estuarine Water | MTKKLTPSEKYRQLKKHTEDAGMVVKEKAGKIVVTKKKVKKNA |
| Ga0222718_101001686 | 3300021958 | Estuarine Water | MPKLTVAEKYKQLKKHTEDAGMKVTEKDGKIMVTRKKKK |
| Ga0222718_101724572 | 3300021958 | Estuarine Water | MTKKLTPSEKYRQLKKHTEDAGMVVKEKAGKIVVTRKKGKKNA |
| Ga0222716_100918574 | 3300021959 | Estuarine Water | MARLSVAEKYKQLKKQTEDAGMKVSEKDGKIVVTRKKKK |
| Ga0222716_105885952 | 3300021959 | Estuarine Water | MVKLTVAEKYKQLKKQTEDAGMKVTEKDGKIVVTRKKKK |
| Ga0222715_100004807 | 3300021960 | Estuarine Water | MAKKPAAKKLTDAQKYRQLKAQTEAAGMKVEEVDGKIVVRRKK |
| Ga0222714_103993472 | 3300021961 | Estuarine Water | MKKKLTVTQKYRQLKKQTEDAGMKVKEEDGKIVVTRKR |
| Ga0222719_102201753 | 3300021964 | Estuarine Water | MAKLTSAEKYRQLKKHTEDAGMKVMEKDGKIVVTRKKKK |
| Ga0222719_102464001 | 3300021964 | Estuarine Water | VAKKLTPSEKYKQLKKHTENAGMKVVEKDGKIVVR |
| Ga0212030_10114112 | 3300022053 | Aqueous | MAKKLTPAQKYSQLKRQTESAGMKVKEVDGKIVVTRKKKK |
| Ga0212030_10326354 | 3300022053 | Aqueous | AKKLTVAEKYRQLKAQTESAGMKVEEVDGKIVVRRKAKKK |
| Ga0212030_10621052 | 3300022053 | Aqueous | VIKLTCKQRYAQLKKHTENAGMKVLEKDGKIIVTRRKKKK |
| Ga0212025_10158305 | 3300022057 | Aqueous | MATTKKKLTPAQKYSQLKRQTESAGMKVKEVDGKIVVTRKK |
| Ga0212025_10437902 | 3300022057 | Aqueous | MAKLTPAEKYKQLKKHTEDAGMKVTEKDGKIVVTRKKKK |
| Ga0212023_10534971 | 3300022061 | Aqueous | MATTKKKLTPAQKYSQLKRQTESAGMKVKEVDGKIVVTR |
| Ga0212029_10716772 | 3300022063 | Aqueous | STKKQEAATVTKKLTVAEKYRQLKAQTESAGMKVEEVDGKIVVRRKPKNKK |
| Ga0212024_10006502 | 3300022065 | Aqueous | MSKKLTPSEKYKQLKKHTENAGMKVVEKDGKIIVRKKGKNNG |
| Ga0212024_10096716 | 3300022065 | Aqueous | VAKKLTPSEKYKQLKKHTENAGMKVVEKDGKIVVARK |
| Ga0212024_10125763 | 3300022065 | Aqueous | MAKRLTVAEKYRQLKKQTEDAGMKVQEKDGKIVITRKKKK |
| Ga0212024_10653532 | 3300022065 | Aqueous | MTKKLTPSEKYRQLKKHTENAGMVVKEKEGKIVVTRKKGKKNA |
| Ga0212021_10010571 | 3300022068 | Aqueous | MATTKKKLTPAQKYSQLKRQTESAGMKVKEVDGKIVVTRKKKNND |
| Ga0212020_10885231 | 3300022167 | Aqueous | VAEKYRQLKAQTESAGMKVEEVDGKIVVRRKAKKK |
| Ga0212031_10493443 | 3300022176 | Aqueous | MPKKRLTAAQKYNQLKRQTESAGMKVSEKNGKIVVSRRKKK |
| Ga0212031_10754802 | 3300022176 | Aqueous | VKKLTAAQKYSQLKKQTEAAGMKVREVKGKIVVSRRKKK |
| Ga0196887_10402776 | 3300022178 | Aqueous | MATTKKKLTPAQKYSQLKRQTESAGMKVKEVDGKIV |
| Ga0196887_11039701 | 3300022178 | Aqueous | MAKKPLTAAEKYRQLKAQTERAGMKVEEVDGKIVVR |
| Ga0181353_10009785 | 3300022179 | Freshwater Lake | MKRLSAAQKYAQLKKQTEGAGMTVREKAGKIVVSRRKKKKRG |
| Ga0181353_11031481 | 3300022179 | Freshwater Lake | MAKKLTAAEKYAQLKGQTEDAGMTVKEKNRKIVVKKKKKA |
| Ga0196899_10457036 | 3300022187 | Aqueous | MATTKKKLTTAQKYNQLKRQTENAGMKVKEVDGKIVVTRKK |
| Ga0196905_100200711 | 3300022198 | Aqueous | VTKKLTVAEKYRQLKAQTESAGMKVEEVDGKIVVRRKPKNKK |
| Ga0196905_10488256 | 3300022198 | Aqueous | MATTKKKLTPAQKYSQLKRQTESAGMKVKEVDGKI |
| Ga0196905_10640902 | 3300022198 | Aqueous | VATVTKKLTVAQKYAQLKAQTEAAGMKVEEVDGKIVVRRKPKAKK |
| Ga0214917_100641713 | 3300022752 | Freshwater | MPKKRLTAAQKYSQLKRQTESAGMKVSEKNGKIVVSRRKKK |
| Ga0222673_10074684 | 3300022821 | Saline Water | PKLTVEQKYRQLKRQTEAAGMTVSERDGKIVVSRKRSR |
| (restricted) Ga0233432_100861802 | 3300023109 | Seawater | MIKKKLTITEKYRQLKKQTEQAGMKVKEEDGKIVVTGKPKRK |
| Ga0214923_100738704 | 3300023179 | Freshwater | MKKLTTAQKYSSLKKQTEDAGMKVSEQNGKLIVTKKKKK |
| Ga0214923_101160832 | 3300023179 | Freshwater | MGNNIMKKLTTAEKYKSLKKQTEQAGMTVKEKNGKLVVSKKLNK |
| (restricted) Ga0233412_101171512 | 3300023210 | Seawater | MAVKRLTAAEKYAQLKAQTEAAGMKVREVGGKIVVDRKRKPAGKK |
| (restricted) Ga0233412_101200294 | 3300023210 | Seawater | MATTKKKLTTAQKYNQLKRQTENAGMKVKEVDGKIVVTRKKKR |
| (restricted) Ga0233412_105526663 | 3300023210 | Seawater | MPSKKLTPSEKYAQLKAQTEAAGMKVKEVNGKIVVERKKRK |
| (restricted) Ga0255040_105219501 | 3300024059 | Seawater | MPKDKKRLTTSEKYQQLKKHTEDAGMKVKEEDGKIIVTRKRKR |
| (restricted) Ga0233438_100944946 | 3300024255 | Seawater | KLTPSEKYNQLKKQTESAGMKVKEVDGKIVVTRKKKK |
| Ga0210003_100578514 | 3300024262 | Deep Subsurface | MAKEKKLTPAQKYNQLKRQTESAGMKVKEVDGKIVVIRKKKK |
| Ga0210003_10505372 | 3300024262 | Deep Subsurface | MKKLTDAEKYRQLKAQTEKAGMTVREIDGKIVVSRRKGKP |
| Ga0210003_11276801 | 3300024262 | Deep Subsurface | IMSKKLTPAQKYSQLKRQTESAGMKVKEVDGKIVVTRKKKK |
| Ga0210003_12431182 | 3300024262 | Deep Subsurface | MAKRLTVSEKYRQLKKHTENAGMKVQEKDGKIVVTRKKK |
| Ga0210003_12617343 | 3300024262 | Deep Subsurface | MAKRLTVAEKYRQLKKQTEDAGMKIQEKDGKIVVTRKKK |
| Ga0210003_13469172 | 3300024262 | Deep Subsurface | MTKLTPAEKYKQLKKHTEDAGMKVTEKDGKIVVTRKKKK |
| Ga0244775_108941863 | 3300024346 | Estuarine | DRGECIMPTKKLTDAQKYQQLKRQTESAGMSVKEVDGKIVVSR |
| Ga0209986_101803443 | 3300024433 | Deep Subsurface | MVKKLTVSEKYRQLKKHTEDAGMKVQEKDGKIVVTRKRKK |
| (restricted) Ga0255048_102070713 | 3300024518 | Seawater | RSKTMPKLTVAEKYKQLKKHTENAGMKVTEKDGKIMVTRKRKLKGN |
| (restricted) Ga0255048_102155611 | 3300024518 | Seawater | MAKDKKLTPSEKYNQLKKQTESAGMKVKEVDGKIVVTR |
| (restricted) Ga0255045_100642672 | 3300024528 | Seawater | VTKKLTAAQKYAQLKAQTEAAGMKVEEVDGKIVVKRKPKK |
| Ga0209557_10981442 | 3300025483 | Marine | MPTKKLTDAQKYQQLKRQTESAGMSVKEVDGKIVVSRKKKKAK |
| Ga0208303_10152544 | 3300025543 | Aqueous | MAKAKKLTVAEKYRQLKAQTESAGMKVEEVDGKIVVRRKAKKK |
| Ga0208303_10156993 | 3300025543 | Aqueous | MAKLTPAEKYKQLKKHTENAGMKVVEKDGKIVVTRKKKK |
| Ga0208303_10522593 | 3300025543 | Aqueous | MAKKPLTAAEKYRQLKAQTERAGMKVEEVDGKIVVRRKPKGK |
| Ga0208303_10691392 | 3300025543 | Aqueous | MKTKKLTITQKYRQLKKQTEQAGMKVKEEDGKIVVTGKPKRK |
| Ga0208546_10100852 | 3300025585 | Aqueous | MASKKLTASQKYSQLKSQTERAGMTVKEVNGKIVVSRKRKK |
| Ga0208149_10443322 | 3300025610 | Aqueous | MAKLTPSEKYKQLKKHTEDAGMKVTEKDGKIVVTRKKKK |
| Ga0209716_11429044 | 3300025626 | Pelagic Marine | MATTKKKLTSAQKYSQLKRQTESAGMKVKEVDGKIVVTRK |
| Ga0208161_10092146 | 3300025646 | Aqueous | MKRLTAAQKYAQLKKQTERAGMTVREKAGKIVVSRKRRKRG |
| Ga0208161_10244962 | 3300025646 | Aqueous | MKKLTPSEKYSQLKKHTENAGMTVVEKNGKIIVTRKKKK |
| Ga0208161_11494021 | 3300025646 | Aqueous | KLTSAEKYKQLKKHTEDAGMKVTEKDGKIVVTRKKKK |
| Ga0208160_10742181 | 3300025647 | Aqueous | AKKLTDAQKYRQLKAQTEAAGMKVEEVDGKIVVRRKK |
| Ga0208795_10527553 | 3300025655 | Aqueous | VTKKLTVAQKYAQLKAQTEAAGMKVEEVDGKIVVRRKPKAKK |
| Ga0208795_10570322 | 3300025655 | Aqueous | MVKLTPAEKYKQLKKHTEDAGMKVTEKDGKIVVTRKKKK |
| Ga0208898_10098432 | 3300025671 | Aqueous | MKKKLTITQKWRQLKKQTEDAGMEVKEQNGKIVVTRKQKRK |
| Ga0208162_10501583 | 3300025674 | Aqueous | MTTKKLTVAEKYRQLKAQTEAAGMTVKEVNGKIVVTRNKKK |
| Ga0208162_10977662 | 3300025674 | Aqueous | MAKLTPAEKYKQLKKHTEDAGMKVTEKDGKIVVTRKK |
| Ga0208019_10277523 | 3300025687 | Aqueous | VATVTKKLTAAQKYAQLKAQTEAAGMKVEEVDGKIVVRRKPKAKK |
| Ga0208019_11418452 | 3300025687 | Aqueous | MAKLTSAEKYKQLKKHTEDAGMKVTEKDGKIVVTRKKKK |
| Ga0209653_10017388 | 3300025695 | Marine | MAKKLTVAEKYRQLKAQTESAGMKVEEVNGKIVVRRKPKKKAKS |
| Ga0209653_10949965 | 3300025695 | Marine | MAKKLTVAEKYAQLKAQTEAAGMKVKEVDGKIVVERKRKPAAKK |
| Ga0209653_11569482 | 3300025695 | Marine | MAKRLTVAEKYRQLKKQTEDAGMKVQEKDGKIIVTRKKK |
| Ga0209532_12286942 | 3300025696 | Pelagic Marine | MAKKLTDAQKYQQLKRQTESAGMSVKEVDGKIVVSRKGKKK |
| Ga0209715_10305045 | 3300025699 | Pelagic Marine | MAKKLTDAQKYQQLKRQTETAGMAVKEVDGKIVVSRKKRKK |
| Ga0209771_11027273 | 3300025701 | Marine | MATTKKKLTTAQKYNQLKKQTENAGMKVKEVDGKIVVTRK |
| Ga0209771_11553013 | 3300025701 | Marine | MVKKLTISEKYRQLKKHTEDAGMKVQEKEGKIVVTRKKK |
| Ga0209602_11424313 | 3300025704 | Pelagic Marine | MVKKVIKKTLSPSEKYRQLKAQTEAAGMKVSEVNGKIVVKRRSKK |
| Ga0208899_10098713 | 3300025759 | Aqueous | MTKKKLTPSEKYQQLKKHTENAGMVVKEKEGKIVVT |
| Ga0208543_10389341 | 3300025810 | Aqueous | TPSEKYQQLKKHTENAGMVVKEKEGKIVVTRKKKKNND |
| Ga0209666_10025187 | 3300025870 | Marine | MATTKKKLTTAQKYNQLKRQTENAGMKVKEVDGKIVVTRNKKK |
| Ga0209223_102261132 | 3300025876 | Pelagic Marine | MTKKKLTPLEKYQQLKKHTENAGMVVKEKEGKIVVTRRKGKKNA |
| Ga0209534_101417504 | 3300025880 | Pelagic Marine | PTKKLTDAQKYQQLKRQTESAGMAVKEVDGKIVVSRKRKKK |
| Ga0208644_10233241 | 3300025889 | Aqueous | MAKLTPSEKYKQLKKHTEDAGMKVTEKDGKIVVTRKK |
| Ga0209951_10146893 | 3300026138 | Pond Water | MAKLTVAEKYKQLKKHTEDAGMKVTEKDGKIVVTRKKKK |
| Ga0209929_10050191 | 3300026187 | Pond Water | MAKLTVAEKYKQLKKHTEDAGMKVTEKDGKIVVTRKKK |
| Ga0209925_10339452 | 3300026197 | Pond Soil | MAKKPAAKKLTPSEKYRQLKKHTEDAGMSVTEKDGKIVVRRKSRKG |
| Ga0208306_10010678 | 3300027214 | Estuarine | MAKKLTVAQKYSQLKKQTESAGMKVMEKDGKIVVSRRRKK |
| (restricted) Ga0247836_100293329 | 3300027728 | Freshwater | VAKKLTVAQKYSQLKKHTENAGMKVMEKDGKIVVSRRKKK |
| Ga0209189_13077041 | 3300027747 | Freshwater Lake | MPDKRLTVSEKYRQLKAQTERAGMTVKEKDGKIVVS |
| Ga0209296_10066483 | 3300027759 | Freshwater Lake | MVKKKLTVAQKYNQLKKQTESAGMKVIVKDGKVVVTRKKKK |
| Ga0209229_100133404 | 3300027805 | Freshwater And Sediment | MKKLTVAQKWRQLKRMTEEAGMTVTEKDGKLIVSRKKKK |
| (restricted) Ga0233415_100037215 | 3300027861 | Seawater | VATKPKKLTDAQKYRQLKSQTEAAGMKVEEVNGKIVVRRKKK |
| (restricted) Ga0233415_100073941 | 3300027861 | Seawater | MTKKKLTPSEKYQQLKKHTENAGMVVKEKEGKIVVTRK |
| (restricted) Ga0233415_100229411 | 3300027861 | Seawater | KIMATTKKKLTTAQKYNQLKRQTENAGMKVKEVDGKIVVTRKNKK |
| (restricted) Ga0255055_101029191 | 3300027881 | Seawater | LTPSEKYQQLKKHTEDAGMKVKEEDGKIIVTRKRKR |
| (restricted) Ga0233413_100317167 | 3300027996 | Seawater | MPKLTVAEKYKQLKKHTENAGMKVTEKDGKIMVTRKRKLKGN |
| (restricted) Ga0233413_102697944 | 3300027996 | Seawater | KAKATKKLTVSEKYRQLKAQTEAAGMKVAEVDGKIVVKRKAKKK |
| Ga0247723_100021944 | 3300028025 | Deep Subsurface Sediment | MKKLTTAQKYNQLKRQTESAGMTVTEKNGKLVVSRKRKKNAKGKA |
| (restricted) Ga0233417_104219504 | 3300028043 | Sediment | MKRLTATQKFGQLKRQTEAAGMSVREKSGKIVVSRR |
| Ga0256368_10949352 | 3300028125 | Sea-Ice Brine | MATEKKLTSAQKYNQLKKQTESAGMKVKEVDGKIVVTRKKKR |
| (restricted) Ga0247843_10486927 | 3300028569 | Freshwater | TTGQKYSQLKKQTERAGMKVTEKNGKIVVSRRKKKQ |
| Ga0307488_100607277 | 3300031519 | Sackhole Brine | MAKKLTDAQKYQQLKRQTESAGMAVKEVDGKIVVSRKKRKK |
| Ga0307488_101875393 | 3300031519 | Sackhole Brine | MPSKKLTPSEKYAQLKAQTEAAGMKVKEVNGKIVVERKKKK |
| Ga0307488_102157151 | 3300031519 | Sackhole Brine | MATEKKLTSAQKYNQLKKQTESAGMKVKEVDGKIIVTRKKKR |
| Ga0307488_106469683 | 3300031519 | Sackhole Brine | QGEMVMAKKLTDAQKYQQLKRQTESAGMAVKEVDGKIVVSRKKRKK |
| Ga0307380_101700163 | 3300031539 | Soil | VTKKLTAAQKYAQLKAQTERAGMKVDEVDGKIVVRRKAKPKAKK |
| Ga0307380_102234771 | 3300031539 | Soil | MAKRLTISEKYRQLKKHTENAGMKVQEKDGKIVVTRKKK |
| Ga0307378_108489483 | 3300031566 | Soil | MIKLTPAEKYKQLKKHTEDAGMKVTEKDGKIVVTR |
| Ga0307376_107205442 | 3300031578 | Soil | MADKKLTVAQKYSQLKKHTENAGMKVTEKDGKIVVSRRKKK |
| Ga0302131_12578411 | 3300031594 | Marine | MATEKKLTSAQKYNQLKKQTESAGMKVKEVDGKIVVTRKK |
| Ga0307377_101706205 | 3300031673 | Soil | DKKKLTPSEKYQQLKKHTEDAGMKVKEEDGKIIVTRKRKR |
| Ga0315907_100724823 | 3300031758 | Freshwater | VPSKPAKRLTVAQKYQQLKSQTERAGMTVKEKDGKIIVSRKKKDK |
| Ga0315907_101966412 | 3300031758 | Freshwater | MAKKLTVTQKYSMLKKQTEQAGMMVMEKNGKLVVTRKKKKK |
| Ga0315909_101122181 | 3300031857 | Freshwater | MLKKYVKPLSVAEKYMQLKKQTEAAGMTVTEKDGKIIVS |
| Ga0315909_105317782 | 3300031857 | Freshwater | VPAKRLTVAEKYRQLKKQTEQAGMTVKEEDGKIVVSRKKKK |
| Ga0315909_105391843 | 3300031857 | Freshwater | MLKKYVKPLSVAEKYMQLKKQTEAAGMTVTEKDGKI |
| Ga0315909_105695672 | 3300031857 | Freshwater | MLKKYVKPLSVAEKYMQLKKQTEAAGMTVTEKDGKIIVSRRRR |
| Ga0315904_105895674 | 3300031951 | Freshwater | MPKAKLTVAQKYNQLKRQTESAGMKVSEKNGKIVVTRRKKK |
| Ga0315906_1001906912 | 3300032050 | Freshwater | MAKKLTTAQKYSQLKKQTEQAGMKVTERNGKLIVTRKKKK |
| Ga0315906_103580532 | 3300032050 | Freshwater | MLKKYVKPLSVAEKYMQLKKQTEAAGMIVTEKDGKIIVSRRRR |
| Ga0315902_102278863 | 3300032093 | Freshwater | MAKKLTSSEKYNQLKKQTEDAGMLVVEQDGKIVVLRKKKK |
| Ga0316202_103763241 | 3300032277 | Microbial Mat | MATTKKKLTPAQKYNQLKRQTESAGMKVKEVDGKIVVT |
| Ga0316204_104886813 | 3300032373 | Microbial Mat | VAKKLTPSEKYKQLKKHTENAGMKVVEKDGKIVVRRKMKK |
| Ga0316204_104886816 | 3300032373 | Microbial Mat | MATTKKKLTPAQKYSQLKRQTESAGMKVKEVDGKIVV |
| Ga0316617_1001131652 | 3300033557 | Soil | MKRLSTAQKYAQLKKQTEGAGMTVREKAGKIVVSRRKKKKRG |
| Ga0310130_0084216_474_602 | 3300034073 | Fracking Water | MASKKLSVAEKYRQLKAQTESAGMRVSEKSGKIVVTRKRKKK |
| Ga0348335_009199_83_214 | 3300034374 | Aqueous | MTKKLTPSEKYRQLKKHTEDAGMVVKEKAGKIVVTRKKKKNND |
| Ga0348336_117752_1_114 | 3300034375 | Aqueous | MKKKLTITQKWRQLKKQTEDAGMEVKEQNGKIVVTRKQ |
| Ga0348337_149524_2_118 | 3300034418 | Aqueous | TPSEKYKQLKKHTENAGMVVKEKEGKIVVTRKKKKNND |
| ⦗Top⦘ |