


| Basic Information | |
|---|---|
| Family ID | F006200 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 379 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MSKKEDWLETLVKKYSIPKEDKTEKRGILNETQLKNLKNGKN |
| Number of Associated Samples | 237 |
| Number of Associated Scaffolds | 379 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 7.39 % |
| % of genes near scaffold ends (potentially truncated) | 24.80 % |
| % of genes from short scaffolds (< 2000 bps) | 72.30 % |
| Associated GOLD sequencing projects | 209 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.30 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (41.161 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh (20.317 % of family members) |
| Environment Ontology (ENVO) | Unclassified (52.770 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (87.863 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 30.00% β-sheet: 0.00% Coil/Unstructured: 70.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.30 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 379 Family Scaffolds |
|---|---|---|
| PF00156 | Pribosyltran | 18.73 |
| PF00118 | Cpn60_TCP1 | 6.07 |
| PF01048 | PNP_UDP_1 | 4.75 |
| PF00970 | FAD_binding_6 | 4.22 |
| PF02585 | PIG-L | 2.11 |
| PF01182 | Glucosamine_iso | 1.58 |
| PF01555 | N6_N4_Mtase | 1.32 |
| PF13640 | 2OG-FeII_Oxy_3 | 1.32 |
| PF00034 | Cytochrom_C | 1.06 |
| PF00294 | PfkB | 0.79 |
| PF07728 | AAA_5 | 0.79 |
| PF09834 | DUF2061 | 0.79 |
| PF00175 | NAD_binding_1 | 0.79 |
| PF01521 | Fe-S_biosyn | 0.79 |
| PF08406 | CbbQ_C | 0.79 |
| PF01713 | Smr | 0.53 |
| PF00535 | Glycos_transf_2 | 0.53 |
| PF00464 | SHMT | 0.53 |
| PF00478 | IMPDH | 0.26 |
| PF02525 | Flavodoxin_2 | 0.26 |
| PF13578 | Methyltransf_24 | 0.26 |
| PF13186 | SPASM | 0.26 |
| PF02540 | NAD_synthase | 0.26 |
| PF03819 | MazG | 0.26 |
| PF00111 | Fer2 | 0.26 |
| PF01341 | Glyco_hydro_6 | 0.26 |
| PF13521 | AAA_28 | 0.26 |
| PF01467 | CTP_transf_like | 0.26 |
| PF13671 | AAA_33 | 0.26 |
| PF10504 | DUF2452 | 0.26 |
| PF00202 | Aminotran_3 | 0.26 |
| PF00085 | Thioredoxin | 0.26 |
| COG ID | Name | Functional Category | % Frequency in 379 Family Scaffolds |
|---|---|---|---|
| COG0459 | Chaperonin GroEL (HSP60 family) | Posttranslational modification, protein turnover, chaperones [O] | 6.07 |
| COG0775 | Nucleoside phosphorylase/nucleosidase, includes 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase MtnN and futalosine hydrolase MqnB | Nucleotide transport and metabolism [F] | 4.75 |
| COG0813 | Purine-nucleoside phosphorylase | Nucleotide transport and metabolism [F] | 4.75 |
| COG2820 | Uridine phosphorylase | Nucleotide transport and metabolism [F] | 4.75 |
| COG2120 | N-acetylglucosaminyl deacetylase, LmbE family | Carbohydrate transport and metabolism [G] | 2.11 |
| COG0363 | 6-phosphogluconolactonase/Glucosamine-6-phosphate isomerase/deaminase | Carbohydrate transport and metabolism [G] | 1.58 |
| COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 1.32 |
| COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 1.32 |
| COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 1.32 |
| COG0714 | MoxR-like ATPase | General function prediction only [R] | 0.79 |
| COG4841 | Uncharacterized conserved protein YneR, related to HesB/YadR/YfhF family | Function unknown [S] | 0.79 |
| COG0316 | Fe-S cluster assembly iron-binding protein IscA | Posttranslational modification, protein turnover, chaperones [O] | 0.79 |
| COG0112 | Glycine/serine hydroxymethyltransferase | Amino acid transport and metabolism [E] | 0.53 |
| COG0156 | 7-keto-8-aminopelargonate synthetase or related enzyme | Coenzyme transport and metabolism [H] | 0.53 |
| COG5297 | Cellulase/cellobiase CelA1 | Carbohydrate transport and metabolism [G] | 0.26 |
| COG0171 | NH3-dependent NAD+ synthetase | Coenzyme transport and metabolism [H] | 0.26 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 58.84 % |
| Unclassified | root | N/A | 41.16 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000101|DelMOSum2010_c10026170 | All Organisms → Viruses → Predicted Viral | 3288 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10035399 | All Organisms → Viruses → Predicted Viral | 2685 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10075622 | All Organisms → Viruses → Predicted Viral | 1521 | Open in IMG/M |
| 3300000115|DelMOSum2011_c10015435 | Not Available | 3815 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10199161 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidetes Order II. Incertae sedis → Rhodothermaceae → unclassified Rhodothermaceae → Rhodothermaceae bacterium TMED105 | 643 | Open in IMG/M |
| 3300000117|DelMOWin2010_c10138085 | Not Available | 823 | Open in IMG/M |
| 3300000117|DelMOWin2010_c10220766 | Not Available | 571 | Open in IMG/M |
| 3300000149|LPaug09P1610mDRAFT_c1019181 | All Organisms → cellular organisms → Bacteria | 857 | Open in IMG/M |
| 3300000168|LPjun09P1210mDRAFT_c1007135 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidetes Order II. Incertae sedis → Rhodothermaceae → unclassified Rhodothermaceae → Rhodothermaceae bacterium TMED105 | 938 | Open in IMG/M |
| 3300000168|LPjun09P1210mDRAFT_c1010056 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon | 768 | Open in IMG/M |
| 3300000265|LP_A_09_P04_10DRAFT_1009868 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 2098 | Open in IMG/M |
| 3300000401|BB_Man_B_Liq_inBBDRAFT_1027585 | Not Available | 661 | Open in IMG/M |
| 3300000929|NpDRAFT_10078328 | Not Available | 7306 | Open in IMG/M |
| 3300000973|BBAY93_10062007 | Not Available | 969 | Open in IMG/M |
| 3300001346|JGI20151J14362_10044161 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidetes Order II. Incertae sedis → Rhodothermaceae → unclassified Rhodothermaceae → Rhodothermaceae bacterium TMED105 | 2010 | Open in IMG/M |
| 3300001354|JGI20155J14468_10040371 | All Organisms → Viruses → Predicted Viral | 2096 | Open in IMG/M |
| 3300001472|JGI24004J15324_10032032 | Not Available | 1694 | Open in IMG/M |
| 3300001589|JGI24005J15628_10008689 | All Organisms → Viruses → Predicted Viral | 4769 | Open in IMG/M |
| 3300001589|JGI24005J15628_10074850 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidetes Order II. Incertae sedis → Rhodothermaceae → unclassified Rhodothermaceae → Rhodothermaceae bacterium TMED105 | 1210 | Open in IMG/M |
| 3300001589|JGI24005J15628_10188196 | Not Available | 590 | Open in IMG/M |
| 3300001965|GOS2243_1017125 | Not Available | 1637 | Open in IMG/M |
| 3300001965|GOS2243_1079599 | Not Available | 2259 | Open in IMG/M |
| 3300001967|GOS2242_1063321 | All Organisms → Viruses → Predicted Viral | 1835 | Open in IMG/M |
| 3300003216|JGI26079J46598_1007812 | All Organisms → Viruses → Predicted Viral | 3415 | Open in IMG/M |
| 3300003216|JGI26079J46598_1011921 | All Organisms → Viruses → Predicted Viral | 2542 | Open in IMG/M |
| 3300003216|JGI26079J46598_1034762 | Not Available | 1119 | Open in IMG/M |
| 3300003345|JGI26080J50196_1077379 | Not Available | 589 | Open in IMG/M |
| 3300003346|JGI26081J50195_1028823 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1205 | Open in IMG/M |
| 3300003427|JGI26084J50262_1054178 | All Organisms → cellular organisms → Bacteria | 942 | Open in IMG/M |
| 3300003427|JGI26084J50262_1058828 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Poribacteria → unclassified Candidatus Poribacteria → Candidatus Poribacteria bacterium | 884 | Open in IMG/M |
| 3300003427|JGI26084J50262_1081735 | Not Available | 688 | Open in IMG/M |
| 3300003620|JGI26273J51734_10009510 | All Organisms → Viruses → Predicted Viral | 4188 | Open in IMG/M |
| 3300004097|Ga0055584_100023907 | All Organisms → cellular organisms → Bacteria | 5997 | Open in IMG/M |
| 3300004097|Ga0055584_101727560 | Not Available | 646 | Open in IMG/M |
| 3300004457|Ga0066224_1080321 | Not Available | 931 | Open in IMG/M |
| 3300004457|Ga0066224_1179246 | Not Available | 1114 | Open in IMG/M |
| 3300004457|Ga0066224_1256183 | Not Available | 816 | Open in IMG/M |
| 3300004642|Ga0066612_1307724 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidetes Order II. Incertae sedis → Rhodothermaceae → unclassified Rhodothermaceae → Rhodothermaceae bacterium TMED105 | 1613 | Open in IMG/M |
| 3300005239|Ga0073579_1190067 | Not Available | 44038 | Open in IMG/M |
| 3300005239|Ga0073579_1441362 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 758 | Open in IMG/M |
| 3300005523|Ga0066865_10049313 | All Organisms → Viruses → Predicted Viral | 1458 | Open in IMG/M |
| 3300005837|Ga0078893_10255399 | All Organisms → cellular organisms → Bacteria | 11698 | Open in IMG/M |
| 3300005837|Ga0078893_10255790 | All Organisms → cellular organisms → Bacteria | 5485 | Open in IMG/M |
| 3300005837|Ga0078893_10255791 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidetes Order II. Incertae sedis → Rhodothermaceae → unclassified Rhodothermaceae → Rhodothermaceae bacterium TMED105 | 3376 | Open in IMG/M |
| 3300005913|Ga0075108_10022515 | All Organisms → Viruses → Predicted Viral | 2443 | Open in IMG/M |
| 3300005941|Ga0070743_10016086 | All Organisms → cellular organisms → Bacteria | 2620 | Open in IMG/M |
| 3300006164|Ga0075441_10049409 | All Organisms → Viruses → Predicted Viral | 1671 | Open in IMG/M |
| 3300006164|Ga0075441_10136257 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidetes Order II. Incertae sedis → Rhodothermaceae → unclassified Rhodothermaceae → Rhodothermaceae bacterium TMED105 | 930 | Open in IMG/M |
| 3300006357|Ga0075502_1577962 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 829 | Open in IMG/M |
| 3300006401|Ga0075506_1487483 | Not Available | 901 | Open in IMG/M |
| 3300006405|Ga0075510_10997851 | Not Available | 1022 | Open in IMG/M |
| 3300006484|Ga0070744_10103354 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 823 | Open in IMG/M |
| 3300006735|Ga0098038_1011304 | All Organisms → Viruses → Predicted Viral | 3495 | Open in IMG/M |
| 3300006735|Ga0098038_1062287 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 1331 | Open in IMG/M |
| 3300006737|Ga0098037_1063146 | All Organisms → Viruses → Predicted Viral | 1319 | Open in IMG/M |
| 3300006737|Ga0098037_1206916 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 641 | Open in IMG/M |
| 3300006752|Ga0098048_1007973 | All Organisms → Viruses → Predicted Viral | 3891 | Open in IMG/M |
| 3300006752|Ga0098048_1024435 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidetes Order II. Incertae sedis → Rhodothermaceae → unclassified Rhodothermaceae → Rhodothermaceae bacterium TMED105 | 1999 | Open in IMG/M |
| 3300006789|Ga0098054_1004868 | Not Available | 5949 | Open in IMG/M |
| 3300006789|Ga0098054_1025969 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidetes Order II. Incertae sedis → Rhodothermaceae → unclassified Rhodothermaceae → Rhodothermaceae bacterium TMED105 | 2311 | Open in IMG/M |
| 3300006921|Ga0098060_1208548 | Not Available | 533 | Open in IMG/M |
| 3300007516|Ga0105050_10019587 | Not Available | 6228 | Open in IMG/M |
| 3300007541|Ga0099848_1153084 | All Organisms → cellular organisms → Bacteria | 852 | Open in IMG/M |
| 3300007552|Ga0102818_1024470 | All Organisms → Viruses → Predicted Viral | 1192 | Open in IMG/M |
| 3300007555|Ga0102817_1041061 | All Organisms → Viruses → Predicted Viral | 1015 | Open in IMG/M |
| 3300007555|Ga0102817_1105611 | Not Available | 620 | Open in IMG/M |
| 3300007609|Ga0102945_1000034 | Not Available | 54600 | Open in IMG/M |
| 3300007609|Ga0102945_1004396 | All Organisms → Viruses → Predicted Viral | 3709 | Open in IMG/M |
| 3300007609|Ga0102945_1009639 | All Organisms → cellular organisms → Bacteria | 2340 | Open in IMG/M |
| 3300007609|Ga0102945_1036076 | Not Available | 1015 | Open in IMG/M |
| 3300007647|Ga0102855_1006499 | All Organisms → Viruses → Predicted Viral | 3257 | Open in IMG/M |
| 3300007647|Ga0102855_1099720 | Not Available | 779 | Open in IMG/M |
| 3300007655|Ga0102825_1136370 | Not Available | 509 | Open in IMG/M |
| 3300007718|Ga0102852_1126252 | Not Available | 517 | Open in IMG/M |
| 3300007863|Ga0105744_1007040 | All Organisms → cellular organisms → Bacteria | 2947 | Open in IMG/M |
| 3300007863|Ga0105744_1159766 | Not Available | 563 | Open in IMG/M |
| 3300007953|Ga0105738_1112468 | Not Available | 501 | Open in IMG/M |
| 3300007992|Ga0105748_10278245 | Not Available | 707 | Open in IMG/M |
| 3300008964|Ga0102889_1199450 | Not Available | 582 | Open in IMG/M |
| 3300008996|Ga0102831_1023754 | All Organisms → Viruses → Predicted Viral | 2090 | Open in IMG/M |
| 3300009000|Ga0102960_1060384 | Not Available | 1392 | Open in IMG/M |
| 3300009000|Ga0102960_1066660 | All Organisms → Viruses → Predicted Viral | 1321 | Open in IMG/M |
| 3300009000|Ga0102960_1117442 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidetes Order II. Incertae sedis → Rhodothermaceae → unclassified Rhodothermaceae → Rhodothermaceae bacterium TMED105 | 964 | Open in IMG/M |
| 3300009000|Ga0102960_1361419 | Not Available | 512 | Open in IMG/M |
| 3300009001|Ga0102963_1068897 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 1453 | Open in IMG/M |
| 3300009027|Ga0102957_1094811 | Not Available | 1037 | Open in IMG/M |
| 3300009027|Ga0102957_1229962 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidetes Order II. Incertae sedis → Rhodothermaceae → unclassified Rhodothermaceae → Rhodothermaceae bacterium TMED105 | 669 | Open in IMG/M |
| 3300009056|Ga0102860_1169593 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidetes Order II. Incertae sedis → Rhodothermaceae → unclassified Rhodothermaceae → Rhodothermaceae bacterium TMED105 | 620 | Open in IMG/M |
| 3300009058|Ga0102854_1136070 | Not Available | 703 | Open in IMG/M |
| 3300009071|Ga0115566_10222725 | All Organisms → Viruses → Predicted Viral | 1141 | Open in IMG/M |
| 3300009071|Ga0115566_10426629 | Not Available | 761 | Open in IMG/M |
| 3300009071|Ga0115566_10465834 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 720 | Open in IMG/M |
| 3300009076|Ga0115550_1294288 | Not Available | 522 | Open in IMG/M |
| 3300009079|Ga0102814_10181638 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 1148 | Open in IMG/M |
| 3300009172|Ga0114995_10004634 | All Organisms → cellular organisms → Bacteria | 9119 | Open in IMG/M |
| 3300009172|Ga0114995_10210390 | All Organisms → Viruses → Predicted Viral | 1078 | Open in IMG/M |
| 3300009172|Ga0114995_10392229 | Not Available | 761 | Open in IMG/M |
| 3300009193|Ga0115551_1108253 | All Organisms → Viruses → Predicted Viral | 1299 | Open in IMG/M |
| 3300009409|Ga0114993_10939673 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidetes Order II. Incertae sedis → Rhodothermaceae → unclassified Rhodothermaceae → Rhodothermaceae bacterium TMED105 | 618 | Open in IMG/M |
| 3300009420|Ga0114994_10022984 | All Organisms → cellular organisms → Bacteria | 4383 | Open in IMG/M |
| 3300009420|Ga0114994_10119089 | All Organisms → Viruses → Predicted Viral | 1794 | Open in IMG/M |
| 3300009420|Ga0114994_10121505 | All Organisms → Viruses → Predicted Viral | 1774 | Open in IMG/M |
| 3300009420|Ga0114994_10336989 | All Organisms → Viruses → Predicted Viral | 1002 | Open in IMG/M |
| 3300009420|Ga0114994_10438003 | Not Available | 864 | Open in IMG/M |
| 3300009433|Ga0115545_1032053 | All Organisms → Viruses → Predicted Viral | 2105 | Open in IMG/M |
| 3300009433|Ga0115545_1170641 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidetes Order II. Incertae sedis → Rhodothermaceae → unclassified Rhodothermaceae → Rhodothermaceae bacterium TMED105 | 752 | Open in IMG/M |
| 3300009440|Ga0115561_1129895 | All Organisms → Viruses → Predicted Viral | 1005 | Open in IMG/M |
| 3300009449|Ga0115558_1257153 | Not Available | 704 | Open in IMG/M |
| 3300009449|Ga0115558_1373811 | Not Available | 559 | Open in IMG/M |
| 3300009467|Ga0115565_10395630 | Not Available | 624 | Open in IMG/M |
| 3300009472|Ga0115554_1261302 | Not Available | 690 | Open in IMG/M |
| 3300009476|Ga0115555_1327543 | Not Available | 614 | Open in IMG/M |
| 3300009495|Ga0115571_1171139 | Not Available | 901 | Open in IMG/M |
| 3300009495|Ga0115571_1286639 | Not Available | 656 | Open in IMG/M |
| 3300009498|Ga0115568_10261822 | Not Available | 775 | Open in IMG/M |
| 3300009505|Ga0115564_10063784 | All Organisms → Viruses → Predicted Viral | 2147 | Open in IMG/M |
| 3300009505|Ga0115564_10161717 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidetes Order II. Incertae sedis → Rhodothermaceae → unclassified Rhodothermaceae → Rhodothermaceae bacterium TMED105 | 1194 | Open in IMG/M |
| 3300009543|Ga0115099_10315980 | All Organisms → Viruses → Predicted Viral | 1895 | Open in IMG/M |
| 3300009705|Ga0115000_10704435 | Not Available | 623 | Open in IMG/M |
| 3300010300|Ga0129351_1000406 | Not Available | 15899 | Open in IMG/M |
| 3300010389|Ga0136549_10076934 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Poribacteria → unclassified Candidatus Poribacteria → Candidatus Poribacteria bacterium | 1629 | Open in IMG/M |
| 3300010883|Ga0133547_10331641 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidetes Order II. Incertae sedis → Rhodothermaceae → unclassified Rhodothermaceae → Rhodothermaceae bacterium TMED105 | 3141 | Open in IMG/M |
| 3300011252|Ga0151674_1141366 | Not Available | 752 | Open in IMG/M |
| 3300012920|Ga0160423_10005903 | All Organisms → cellular organisms → Bacteria | 9933 | Open in IMG/M |
| 3300012920|Ga0160423_10026424 | All Organisms → Viruses → Predicted Viral | 4323 | Open in IMG/M |
| 3300012920|Ga0160423_10046607 | All Organisms → cellular organisms → Bacteria | 3160 | Open in IMG/M |
| 3300012920|Ga0160423_10156101 | All Organisms → Viruses → Predicted Viral | 1600 | Open in IMG/M |
| 3300012920|Ga0160423_10294697 | All Organisms → Viruses → Predicted Viral | 1117 | Open in IMG/M |
| 3300012936|Ga0163109_10675458 | Not Available | 756 | Open in IMG/M |
| 3300012954|Ga0163111_10338852 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 1347 | Open in IMG/M |
| 3300012954|Ga0163111_11483228 | Not Available | 671 | Open in IMG/M |
| 3300012954|Ga0163111_11794662 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidetes Order II. Incertae sedis → Rhodothermaceae → unclassified Rhodothermaceae → Rhodothermaceae bacterium TMED105 | 613 | Open in IMG/M |
| 3300017706|Ga0181377_1013589 | All Organisms → Viruses → Predicted Viral | 1901 | Open in IMG/M |
| 3300017706|Ga0181377_1076987 | Not Available | 599 | Open in IMG/M |
| 3300017708|Ga0181369_1028660 | All Organisms → cellular organisms → Bacteria → FCB group | 1319 | Open in IMG/M |
| 3300017714|Ga0181412_1144446 | Not Available | 538 | Open in IMG/M |
| 3300017717|Ga0181404_1012757 | All Organisms → Viruses → Predicted Viral | 2203 | Open in IMG/M |
| 3300017717|Ga0181404_1014251 | All Organisms → Viruses → Predicted Viral | 2077 | Open in IMG/M |
| 3300017742|Ga0181399_1041557 | All Organisms → Viruses → Predicted Viral | 1221 | Open in IMG/M |
| 3300017746|Ga0181389_1001620 | All Organisms → cellular organisms → Bacteria | 8772 | Open in IMG/M |
| 3300017748|Ga0181393_1173039 | Not Available | 531 | Open in IMG/M |
| 3300017751|Ga0187219_1012470 | All Organisms → Viruses → Predicted Viral | 3256 | Open in IMG/M |
| 3300017751|Ga0187219_1138239 | Not Available | 709 | Open in IMG/M |
| 3300017752|Ga0181400_1043221 | All Organisms → Viruses → Predicted Viral | 1414 | Open in IMG/M |
| 3300017756|Ga0181382_1057331 | Not Available | 1111 | Open in IMG/M |
| 3300017758|Ga0181409_1227900 | Not Available | 532 | Open in IMG/M |
| 3300017762|Ga0181422_1108313 | Not Available | 865 | Open in IMG/M |
| 3300017763|Ga0181410_1149009 | Not Available | 658 | Open in IMG/M |
| 3300017767|Ga0181406_1062874 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidetes Order II. Incertae sedis → Rhodothermaceae → unclassified Rhodothermaceae → Rhodothermaceae bacterium TMED105 | 1140 | Open in IMG/M |
| 3300017767|Ga0181406_1160141 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 674 | Open in IMG/M |
| 3300017776|Ga0181394_1143754 | Not Available | 744 | Open in IMG/M |
| 3300017776|Ga0181394_1176834 | Not Available | 656 | Open in IMG/M |
| 3300017781|Ga0181423_1273204 | Not Available | 627 | Open in IMG/M |
| 3300017782|Ga0181380_1269119 | Not Available | 562 | Open in IMG/M |
| 3300017783|Ga0181379_1029010 | All Organisms → Viruses → Predicted Viral | 2204 | Open in IMG/M |
| 3300017818|Ga0181565_10026413 | All Organisms → Viruses → Predicted Viral | 4283 | Open in IMG/M |
| 3300017818|Ga0181565_10026496 | All Organisms → Viruses → Predicted Viral | 4276 | Open in IMG/M |
| 3300017818|Ga0181565_10190187 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidetes Order II. Incertae sedis → Rhodothermaceae → unclassified Rhodothermaceae → Rhodothermaceae bacterium TMED105 | 1416 | Open in IMG/M |
| 3300017818|Ga0181565_10222864 | All Organisms → Viruses → Predicted Viral | 1289 | Open in IMG/M |
| 3300017824|Ga0181552_10018706 | All Organisms → Viruses → Predicted Viral | 4374 | Open in IMG/M |
| 3300017824|Ga0181552_10051035 | All Organisms → Viruses → Predicted Viral | 2430 | Open in IMG/M |
| 3300017824|Ga0181552_10107152 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidetes Order II. Incertae sedis → Rhodothermaceae → unclassified Rhodothermaceae → Rhodothermaceae bacterium TMED105 | 1540 | Open in IMG/M |
| 3300017824|Ga0181552_10123923 | Not Available | 1405 | Open in IMG/M |
| 3300017824|Ga0181552_10184896 | All Organisms → Viruses → Predicted Viral | 1086 | Open in IMG/M |
| 3300017824|Ga0181552_10211766 | Not Available | 995 | Open in IMG/M |
| 3300017824|Ga0181552_10379011 | Not Available | 681 | Open in IMG/M |
| 3300017824|Ga0181552_10393926 | Not Available | 665 | Open in IMG/M |
| 3300017824|Ga0181552_10404484 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 653 | Open in IMG/M |
| 3300017949|Ga0181584_10123768 | All Organisms → cellular organisms → Bacteria | 1752 | Open in IMG/M |
| 3300017949|Ga0181584_10754662 | Not Available | 578 | Open in IMG/M |
| 3300017949|Ga0181584_10833117 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 544 | Open in IMG/M |
| 3300017950|Ga0181607_10030190 | All Organisms → cellular organisms → Bacteria | 3930 | Open in IMG/M |
| 3300017950|Ga0181607_10059479 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 2548 | Open in IMG/M |
| 3300017950|Ga0181607_10356881 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 807 | Open in IMG/M |
| 3300017951|Ga0181577_10845775 | Not Available | 549 | Open in IMG/M |
| 3300017956|Ga0181580_10481590 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Poribacteria → unclassified Candidatus Poribacteria → Candidatus Poribacteria bacterium | 814 | Open in IMG/M |
| 3300017957|Ga0181571_10030137 | All Organisms → Viruses → Predicted Viral | 3882 | Open in IMG/M |
| 3300017957|Ga0181571_10201616 | All Organisms → Viruses → Predicted Viral | 1288 | Open in IMG/M |
| 3300017957|Ga0181571_10557557 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 695 | Open in IMG/M |
| 3300017962|Ga0181581_10335629 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidetes Order II. Incertae sedis → Rhodothermaceae → unclassified Rhodothermaceae → Rhodothermaceae bacterium TMED105 | 963 | Open in IMG/M |
| 3300017964|Ga0181589_10576826 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidetes Order II. Incertae sedis → Rhodothermaceae → unclassified Rhodothermaceae → Rhodothermaceae bacterium TMED105 | 718 | Open in IMG/M |
| 3300017967|Ga0181590_10332852 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 1095 | Open in IMG/M |
| 3300017967|Ga0181590_10599891 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla | 754 | Open in IMG/M |
| 3300017967|Ga0181590_10877649 | Not Available | 592 | Open in IMG/M |
| 3300017969|Ga0181585_10950445 | Not Available | 550 | Open in IMG/M |
| 3300017985|Ga0181576_10757408 | Not Available | 577 | Open in IMG/M |
| 3300017985|Ga0181576_10892577 | Not Available | 521 | Open in IMG/M |
| 3300017985|Ga0181576_10913871 | Not Available | 514 | Open in IMG/M |
| 3300017986|Ga0181569_10254880 | All Organisms → Viruses → Predicted Viral | 1224 | Open in IMG/M |
| 3300017986|Ga0181569_10349531 | All Organisms → Viruses → Predicted Viral | 1018 | Open in IMG/M |
| 3300018036|Ga0181600_10433808 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 632 | Open in IMG/M |
| 3300018049|Ga0181572_10311319 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidetes Order II. Incertae sedis → Rhodothermaceae → unclassified Rhodothermaceae → Rhodothermaceae bacterium TMED105 | 999 | Open in IMG/M |
| 3300018416|Ga0181553_10119933 | All Organisms → cellular organisms → Bacteria | 1599 | Open in IMG/M |
| 3300018416|Ga0181553_10158073 | All Organisms → Viruses → Predicted Viral | 1342 | Open in IMG/M |
| 3300018416|Ga0181553_10169819 | All Organisms → Viruses → Predicted Viral | 1283 | Open in IMG/M |
| 3300018417|Ga0181558_10037279 | All Organisms → Viruses → Predicted Viral | 3400 | Open in IMG/M |
| 3300018417|Ga0181558_10115582 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidetes Order II. Incertae sedis → Rhodothermaceae → unclassified Rhodothermaceae → Rhodothermaceae bacterium TMED105 | 1644 | Open in IMG/M |
| 3300018418|Ga0181567_10552039 | Not Available | 748 | Open in IMG/M |
| 3300018418|Ga0181567_10822422 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300018420|Ga0181563_10545622 | Not Available | 648 | Open in IMG/M |
| 3300018424|Ga0181591_10225767 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidetes Order II. Incertae sedis → Rhodothermaceae → unclassified Rhodothermaceae → Rhodothermaceae bacterium TMED105 | 1460 | Open in IMG/M |
| 3300018424|Ga0181591_10458594 | All Organisms → cellular organisms → Bacteria | 937 | Open in IMG/M |
| 3300018426|Ga0181566_10436953 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Poribacteria → unclassified Candidatus Poribacteria → Candidatus Poribacteria bacterium | 927 | Open in IMG/M |
| 3300018426|Ga0181566_10760225 | Not Available | 663 | Open in IMG/M |
| 3300018426|Ga0181566_11111631 | Not Available | 529 | Open in IMG/M |
| 3300018428|Ga0181568_10059273 | All Organisms → Viruses → Predicted Viral | 3240 | Open in IMG/M |
| 3300018428|Ga0181568_10316548 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidetes Order II. Incertae sedis → Rhodothermaceae → unclassified Rhodothermaceae → Rhodothermaceae bacterium TMED105 | 1270 | Open in IMG/M |
| 3300018428|Ga0181568_10426184 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidetes Order II. Incertae sedis → Rhodothermaceae → unclassified Rhodothermaceae → Rhodothermaceae bacterium TMED105 | 1065 | Open in IMG/M |
| 3300018876|Ga0181564_10753240 | Not Available | 511 | Open in IMG/M |
| 3300019459|Ga0181562_10366499 | Not Available | 702 | Open in IMG/M |
| 3300019459|Ga0181562_10450822 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 615 | Open in IMG/M |
| 3300019765|Ga0194024_1015211 | All Organisms → Viruses → Predicted Viral | 1625 | Open in IMG/M |
| 3300020055|Ga0181575_10048799 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidetes Order II. Incertae sedis → Rhodothermaceae → unclassified Rhodothermaceae → Rhodothermaceae bacterium TMED105 | 2705 | Open in IMG/M |
| 3300020055|Ga0181575_10403440 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Poribacteria → unclassified Candidatus Poribacteria → Candidatus Poribacteria bacterium | 752 | Open in IMG/M |
| 3300020165|Ga0206125_10002460 | All Organisms → cellular organisms → Bacteria | 19514 | Open in IMG/M |
| 3300020165|Ga0206125_10108672 | All Organisms → Viruses → Predicted Viral | 1163 | Open in IMG/M |
| 3300020182|Ga0206129_10180645 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidetes Order II. Incertae sedis → Rhodothermaceae → unclassified Rhodothermaceae → Rhodothermaceae bacterium TMED105 | 957 | Open in IMG/M |
| 3300020187|Ga0206130_10435857 | Not Available | 515 | Open in IMG/M |
| 3300020274|Ga0211658_1059300 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 789 | Open in IMG/M |
| 3300020274|Ga0211658_1107201 | Not Available | 547 | Open in IMG/M |
| 3300020274|Ga0211658_1116028 | Not Available | 519 | Open in IMG/M |
| 3300020347|Ga0211504_1027083 | All Organisms → Viruses → Predicted Viral | 1479 | Open in IMG/M |
| 3300020352|Ga0211505_1134723 | Not Available | 584 | Open in IMG/M |
| 3300020358|Ga0211689_1171952 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidetes Order II. Incertae sedis → Rhodothermaceae → unclassified Rhodothermaceae → Rhodothermaceae bacterium TMED105 | 596 | Open in IMG/M |
| 3300020379|Ga0211652_10091356 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidetes Order II. Incertae sedis → Rhodothermaceae → unclassified Rhodothermaceae → Rhodothermaceae bacterium TMED105 | 917 | Open in IMG/M |
| 3300020379|Ga0211652_10214807 | Not Available | 588 | Open in IMG/M |
| 3300020382|Ga0211686_10365796 | Not Available | 587 | Open in IMG/M |
| 3300020404|Ga0211659_10037512 | All Organisms → Viruses → Predicted Viral | 2326 | Open in IMG/M |
| 3300020408|Ga0211651_10027932 | All Organisms → Viruses → Predicted Viral | 2649 | Open in IMG/M |
| 3300020408|Ga0211651_10051071 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 1824 | Open in IMG/M |
| 3300020414|Ga0211523_10435702 | Not Available | 527 | Open in IMG/M |
| 3300020438|Ga0211576_10036680 | All Organisms → Viruses → Predicted Viral | 2868 | Open in IMG/M |
| 3300020438|Ga0211576_10070169 | Not Available | 1970 | Open in IMG/M |
| 3300020439|Ga0211558_10071297 | All Organisms → Viruses → Predicted Viral | 1715 | Open in IMG/M |
| 3300020439|Ga0211558_10075539 | All Organisms → Viruses → Predicted Viral | 1661 | Open in IMG/M |
| 3300020439|Ga0211558_10235838 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Poribacteria → unclassified Candidatus Poribacteria → Candidatus Poribacteria bacterium | 866 | Open in IMG/M |
| 3300020450|Ga0211641_10577813 | Not Available | 530 | Open in IMG/M |
| 3300020469|Ga0211577_10466013 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidetes Order II. Incertae sedis → Rhodothermaceae → unclassified Rhodothermaceae → Rhodothermaceae bacterium TMED105 | 771 | Open in IMG/M |
| 3300020474|Ga0211547_10102361 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidetes Order II. Incertae sedis → Rhodothermaceae → unclassified Rhodothermaceae → Rhodothermaceae bacterium TMED105 | 1501 | Open in IMG/M |
| 3300020595|Ga0206126_10273486 | Not Available | 767 | Open in IMG/M |
| 3300021085|Ga0206677_10001780 | Not Available | 19723 | Open in IMG/M |
| 3300021085|Ga0206677_10004204 | All Organisms → cellular organisms → Bacteria | 11848 | Open in IMG/M |
| 3300021085|Ga0206677_10012926 | All Organisms → cellular organisms → Bacteria | 5556 | Open in IMG/M |
| 3300021085|Ga0206677_10024003 | All Organisms → cellular organisms → Bacteria | 3584 | Open in IMG/M |
| 3300021085|Ga0206677_10025005 | All Organisms → Viruses → Predicted Viral | 3481 | Open in IMG/M |
| 3300021085|Ga0206677_10097669 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidetes Order II. Incertae sedis → Rhodothermaceae → unclassified Rhodothermaceae → Rhodothermaceae bacterium TMED105 | 1393 | Open in IMG/M |
| 3300021335|Ga0213867_1000032 | Not Available | 62384 | Open in IMG/M |
| 3300021356|Ga0213858_10014164 | All Organisms → Viruses → Predicted Viral | 3773 | Open in IMG/M |
| 3300021356|Ga0213858_10083484 | All Organisms → Viruses → Predicted Viral | 1559 | Open in IMG/M |
| 3300021356|Ga0213858_10146222 | All Organisms → Viruses → Predicted Viral | 1154 | Open in IMG/M |
| 3300021364|Ga0213859_10012495 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 3881 | Open in IMG/M |
| 3300021364|Ga0213859_10047584 | All Organisms → Viruses → Predicted Viral | 2036 | Open in IMG/M |
| 3300021365|Ga0206123_10159025 | All Organisms → Viruses → Predicted Viral | 1029 | Open in IMG/M |
| 3300021368|Ga0213860_10004439 | Not Available | 5742 | Open in IMG/M |
| 3300021375|Ga0213869_10000090 | Not Available | 71644 | Open in IMG/M |
| 3300021375|Ga0213869_10008563 | Not Available | 6256 | Open in IMG/M |
| 3300021375|Ga0213869_10030061 | All Organisms → Viruses → Predicted Viral | 2972 | Open in IMG/M |
| 3300021379|Ga0213864_10381568 | Not Available | 712 | Open in IMG/M |
| 3300021957|Ga0222717_10000083 | Not Available | 72939 | Open in IMG/M |
| 3300021957|Ga0222717_10011004 | All Organisms → cellular organisms → Bacteria | 6271 | Open in IMG/M |
| 3300021957|Ga0222717_10043052 | All Organisms → Viruses → Predicted Viral | 2946 | Open in IMG/M |
| 3300021957|Ga0222717_10116845 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidetes Order II. Incertae sedis → Rhodothermaceae → unclassified Rhodothermaceae → Rhodothermaceae bacterium TMED105 | 1654 | Open in IMG/M |
| 3300021958|Ga0222718_10007345 | All Organisms → cellular organisms → Bacteria | 8612 | Open in IMG/M |
| 3300021958|Ga0222718_10202008 | All Organisms → Viruses → Predicted Viral | 1085 | Open in IMG/M |
| 3300021959|Ga0222716_10001176 | Not Available | 22073 | Open in IMG/M |
| 3300021959|Ga0222716_10755746 | Not Available | 509 | Open in IMG/M |
| 3300021960|Ga0222715_10484221 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Poribacteria → unclassified Candidatus Poribacteria → Candidatus Poribacteria bacterium | 660 | Open in IMG/M |
| 3300021961|Ga0222714_10126042 | Not Available | 1573 | Open in IMG/M |
| 3300021961|Ga0222714_10589872 | Not Available | 556 | Open in IMG/M |
| 3300021964|Ga0222719_10181077 | All Organisms → Viruses → Predicted Viral | 1459 | Open in IMG/M |
| 3300021964|Ga0222719_10207885 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 1332 | Open in IMG/M |
| 3300021964|Ga0222719_10468050 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 765 | Open in IMG/M |
| 3300021964|Ga0222719_10817948 | Not Available | 510 | Open in IMG/M |
| (restricted) 3300022920|Ga0233426_10008415 | All Organisms → cellular organisms → Bacteria | 6786 | Open in IMG/M |
| (restricted) 3300022920|Ga0233426_10153343 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidetes Order II. Incertae sedis → Rhodothermaceae → unclassified Rhodothermaceae → Rhodothermaceae bacterium TMED105 | 975 | Open in IMG/M |
| (restricted) 3300022920|Ga0233426_10278175 | Not Available | 656 | Open in IMG/M |
| 3300022921|Ga0255765_1190848 | Not Available | 918 | Open in IMG/M |
| 3300022925|Ga0255773_10179863 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidetes Order II. Incertae sedis → Rhodothermaceae → unclassified Rhodothermaceae → Rhodothermaceae bacterium TMED105 | 982 | Open in IMG/M |
| 3300022927|Ga0255769_10137059 | Not Available | 1169 | Open in IMG/M |
| 3300023081|Ga0255764_10209699 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidetes Order II. Incertae sedis → Rhodothermaceae → unclassified Rhodothermaceae → Rhodothermaceae bacterium TMED105 | 956 | Open in IMG/M |
| 3300023081|Ga0255764_10298917 | Not Available | 739 | Open in IMG/M |
| 3300023084|Ga0255778_10166458 | All Organisms → Viruses → Predicted Viral | 1139 | Open in IMG/M |
| 3300023087|Ga0255774_10078497 | All Organisms → cellular organisms → Bacteria | 1938 | Open in IMG/M |
| 3300023110|Ga0255743_10143749 | All Organisms → Viruses → Predicted Viral | 1367 | Open in IMG/M |
| 3300023110|Ga0255743_10415622 | Not Available | 660 | Open in IMG/M |
| 3300023116|Ga0255751_10140100 | Not Available | 1436 | Open in IMG/M |
| 3300023116|Ga0255751_10466070 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidetes Order II. Incertae sedis → Rhodothermaceae → unclassified Rhodothermaceae → Rhodothermaceae bacterium TMED105 | 607 | Open in IMG/M |
| 3300023119|Ga0255762_10256631 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidetes Order II. Incertae sedis → Rhodothermaceae → unclassified Rhodothermaceae → Rhodothermaceae bacterium TMED105 | 932 | Open in IMG/M |
| 3300023172|Ga0255766_10226820 | Not Available | 998 | Open in IMG/M |
| 3300023176|Ga0255772_10015500 | Not Available | 6269 | Open in IMG/M |
| 3300023176|Ga0255772_10107389 | All Organisms → cellular organisms → Bacteria | 1744 | Open in IMG/M |
| 3300023176|Ga0255772_10392216 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidetes Order II. Incertae sedis → Rhodothermaceae → unclassified Rhodothermaceae → Rhodothermaceae bacterium TMED105 | 702 | Open in IMG/M |
| 3300023178|Ga0255759_10061691 | All Organisms → Viruses → Predicted Viral | 2739 | Open in IMG/M |
| 3300024191|Ga0228636_1124493 | Not Available | 571 | Open in IMG/M |
| 3300024242|Ga0228673_1078061 | Not Available | 588 | Open in IMG/M |
| (restricted) 3300024255|Ga0233438_10036811 | All Organisms → Viruses → Predicted Viral | 2648 | Open in IMG/M |
| (restricted) 3300024255|Ga0233438_10062053 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 1839 | Open in IMG/M |
| (restricted) 3300024264|Ga0233444_10088194 | All Organisms → Viruses → Predicted Viral | 1666 | Open in IMG/M |
| (restricted) 3300024264|Ga0233444_10124191 | Not Available | 1298 | Open in IMG/M |
| 3300024301|Ga0233451_10163977 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Poribacteria → unclassified Candidatus Poribacteria → Candidatus Poribacteria bacterium | 994 | Open in IMG/M |
| 3300024332|Ga0228659_1094137 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 649 | Open in IMG/M |
| 3300024346|Ga0244775_10001746 | Not Available | 24639 | Open in IMG/M |
| 3300024348|Ga0244776_10130807 | All Organisms → Viruses → Predicted Viral | 1847 | Open in IMG/M |
| 3300024428|Ga0233396_1146748 | Not Available | 523 | Open in IMG/M |
| 3300025070|Ga0208667_1013627 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 1761 | Open in IMG/M |
| 3300025083|Ga0208791_1019392 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidetes Order II. Incertae sedis → Rhodothermaceae → unclassified Rhodothermaceae → Rhodothermaceae bacterium TMED105 | 1409 | Open in IMG/M |
| 3300025084|Ga0208298_1004757 | Not Available | 3920 | Open in IMG/M |
| 3300025086|Ga0208157_1048102 | All Organisms → Viruses → Predicted Viral | 1156 | Open in IMG/M |
| 3300025102|Ga0208666_1026112 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidetes Order II. Incertae sedis → Rhodothermaceae → unclassified Rhodothermaceae → Rhodothermaceae bacterium TMED105 | 1804 | Open in IMG/M |
| 3300025137|Ga0209336_10014032 | All Organisms → Viruses → Predicted Viral | 3047 | Open in IMG/M |
| 3300025137|Ga0209336_10036532 | All Organisms → Viruses → Predicted Viral | 1611 | Open in IMG/M |
| 3300025138|Ga0209634_1003561 | Not Available | 10458 | Open in IMG/M |
| 3300025138|Ga0209634_1014221 | All Organisms → Viruses → Predicted Viral | 4640 | Open in IMG/M |
| 3300025138|Ga0209634_1162676 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidetes Order II. Incertae sedis → Rhodothermaceae → unclassified Rhodothermaceae → Rhodothermaceae bacterium TMED105 | 896 | Open in IMG/M |
| 3300025138|Ga0209634_1207578 | Not Available | 743 | Open in IMG/M |
| 3300025151|Ga0209645_1141531 | Not Available | 748 | Open in IMG/M |
| 3300025608|Ga0209654_1021329 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidetes Order II. Incertae sedis → Rhodothermaceae → unclassified Rhodothermaceae → Rhodothermaceae bacterium TMED105 | 2396 | Open in IMG/M |
| 3300025636|Ga0209136_1006937 | Not Available | 5580 | Open in IMG/M |
| 3300025636|Ga0209136_1037750 | All Organisms → Viruses → Predicted Viral | 1732 | Open in IMG/M |
| 3300025658|Ga0209659_1166569 | Not Available | 646 | Open in IMG/M |
| 3300025684|Ga0209652_1002351 | Not Available | 14705 | Open in IMG/M |
| 3300025690|Ga0209505_1107177 | Not Available | 788 | Open in IMG/M |
| 3300025695|Ga0209653_1001843 | Not Available | 16315 | Open in IMG/M |
| 3300025695|Ga0209653_1126905 | Not Available | 783 | Open in IMG/M |
| 3300025695|Ga0209653_1172507 | Not Available | 616 | Open in IMG/M |
| 3300025696|Ga0209532_1037878 | All Organisms → Viruses → Predicted Viral | 2064 | Open in IMG/M |
| 3300025699|Ga0209715_1047132 | Not Available | 1873 | Open in IMG/M |
| 3300025704|Ga0209602_1082446 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidetes Order II. Incertae sedis → Rhodothermaceae → unclassified Rhodothermaceae → Rhodothermaceae bacterium TMED105 | 1191 | Open in IMG/M |
| 3300025705|Ga0209374_1158681 | Not Available | 631 | Open in IMG/M |
| 3300025712|Ga0209305_1134042 | Not Available | 765 | Open in IMG/M |
| 3300025767|Ga0209137_1074808 | All Organisms → Viruses → Predicted Viral | 1463 | Open in IMG/M |
| 3300025809|Ga0209199_1176273 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidetes Order II. Incertae sedis → Rhodothermaceae → unclassified Rhodothermaceae → Rhodothermaceae bacterium TMED105 | 768 | Open in IMG/M |
| 3300025809|Ga0209199_1263744 | Not Available | 556 | Open in IMG/M |
| 3300025822|Ga0209714_1185305 | Not Available | 507 | Open in IMG/M |
| 3300025870|Ga0209666_1399111 | Not Available | 512 | Open in IMG/M |
| 3300025879|Ga0209555_10026236 | All Organisms → Viruses → Predicted Viral | 2781 | Open in IMG/M |
| 3300025879|Ga0209555_10275872 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300025892|Ga0209630_10087040 | Not Available | 1723 | Open in IMG/M |
| 3300026097|Ga0209953_1000774 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 10961 | Open in IMG/M |
| 3300026097|Ga0209953_1000922 | Not Available | 9718 | Open in IMG/M |
| 3300026097|Ga0209953_1001690 | All Organisms → cellular organisms → Bacteria | 6530 | Open in IMG/M |
| 3300026138|Ga0209951_1089649 | Not Available | 636 | Open in IMG/M |
| 3300026470|Ga0247599_1015200 | All Organisms → Viruses → Predicted Viral | 1591 | Open in IMG/M |
| 3300027280|Ga0208972_1056058 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidetes Order II. Incertae sedis → Rhodothermaceae → unclassified Rhodothermaceae → Rhodothermaceae bacterium TMED105 | 765 | Open in IMG/M |
| 3300027522|Ga0209384_1046041 | All Organisms → Viruses → Predicted Viral | 1198 | Open in IMG/M |
| 3300027668|Ga0209482_1007280 | All Organisms → cellular organisms → Bacteria | 5691 | Open in IMG/M |
| 3300027752|Ga0209192_10220074 | Not Available | 714 | Open in IMG/M |
| 3300027779|Ga0209709_10002170 | Not Available | 17447 | Open in IMG/M |
| 3300027779|Ga0209709_10019081 | Not Available | 4552 | Open in IMG/M |
| 3300027813|Ga0209090_10013487 | Not Available | 4872 | Open in IMG/M |
| 3300027976|Ga0209702_10017738 | Not Available | 6218 | Open in IMG/M |
| 3300028008|Ga0228674_1227087 | Not Available | 590 | Open in IMG/M |
| 3300028111|Ga0233397_1075979 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidetes Order II. Incertae sedis → Rhodothermaceae → unclassified Rhodothermaceae → Rhodothermaceae bacterium TMED105 | 890 | Open in IMG/M |
| 3300028115|Ga0233450_10277671 | Not Available | 726 | Open in IMG/M |
| 3300028136|Ga0228608_1210649 | Not Available | 504 | Open in IMG/M |
| 3300028196|Ga0257114_1311380 | Not Available | 540 | Open in IMG/M |
| 3300028197|Ga0257110_1000334 | Not Available | 23878 | Open in IMG/M |
| 3300028197|Ga0257110_1052565 | Not Available | 1772 | Open in IMG/M |
| 3300028273|Ga0228640_1055001 | Not Available | 780 | Open in IMG/M |
| 3300028287|Ga0257126_1227216 | Not Available | 567 | Open in IMG/M |
| 3300029318|Ga0185543_1005304 | All Organisms → Viruses → Predicted Viral | 3390 | Open in IMG/M |
| 3300031140|Ga0308024_1003881 | All Organisms → Viruses → Predicted Viral | 4942 | Open in IMG/M |
| 3300031142|Ga0308022_1090939 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidetes Order II. Incertae sedis → Rhodothermaceae → unclassified Rhodothermaceae → Rhodothermaceae bacterium TMED105 | 917 | Open in IMG/M |
| 3300031143|Ga0308025_1159097 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 795 | Open in IMG/M |
| 3300031143|Ga0308025_1278198 | Not Available | 547 | Open in IMG/M |
| 3300031167|Ga0308023_1004477 | All Organisms → Viruses → Predicted Viral | 3269 | Open in IMG/M |
| 3300031167|Ga0308023_1091216 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 562 | Open in IMG/M |
| 3300031519|Ga0307488_10017279 | Not Available | 5831 | Open in IMG/M |
| 3300031519|Ga0307488_10056931 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidetes Order II. Incertae sedis → Rhodothermaceae → unclassified Rhodothermaceae → Rhodothermaceae bacterium TMED105 | 2999 | Open in IMG/M |
| 3300031519|Ga0307488_10420155 | Not Available | 821 | Open in IMG/M |
| 3300031519|Ga0307488_10528617 | Not Available | 698 | Open in IMG/M |
| 3300031602|Ga0307993_1162748 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 559 | Open in IMG/M |
| 3300031629|Ga0307985_10377108 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 548 | Open in IMG/M |
| 3300031630|Ga0308004_10281686 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidetes Order II. Incertae sedis → Rhodothermaceae → unclassified Rhodothermaceae → Rhodothermaceae bacterium TMED105 | 648 | Open in IMG/M |
| 3300031644|Ga0308001_10056869 | All Organisms → Viruses → Predicted Viral | 1682 | Open in IMG/M |
| 3300031705|Ga0308003_1039164 | All Organisms → Viruses → Predicted Viral | 1704 | Open in IMG/M |
| 3300031766|Ga0315322_10361440 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidetes Order II. Incertae sedis → Rhodothermaceae → unclassified Rhodothermaceae → Rhodothermaceae bacterium TMED105 | 979 | Open in IMG/M |
| 3300031848|Ga0308000_10216556 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidetes Order II. Incertae sedis → Rhodothermaceae → unclassified Rhodothermaceae → Rhodothermaceae bacterium TMED105 | 725 | Open in IMG/M |
| 3300034073|Ga0310130_0127707 | Not Available | 772 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 20.32% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 11.87% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 7.39% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 6.60% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 6.60% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 5.28% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 5.28% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 3.96% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 3.96% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 3.43% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 3.17% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 2.37% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 1.58% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 1.58% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 1.85% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 1.85% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 1.85% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 1.06% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 1.06% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 1.06% |
| Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 1.06% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 1.06% |
| Marine Surface Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine Surface Water | 0.79% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.79% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.79% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 0.53% |
| Marine | Environmental → Aquatic → Marine → Inlet → Unclassified → Marine | 0.53% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.26% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.26% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.26% |
| Freshwater And Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine | 0.26% |
| Saline Lake | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake | 0.26% |
| Bioluminescent Bay | Environmental → Aquatic → Non-Marine Saline And Alkaline → Unclassified → Unclassified → Bioluminescent Bay | 0.26% |
| Marine Methane Seep Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Methane Seep Sediment | 0.26% |
| Fracking Water | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water | 0.26% |
| Macroalgal Surface | Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface | 0.26% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
| 3300000115 | Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011 | Environmental | Open in IMG/M |
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
| 3300000149 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - August 2009 P16 10m | Environmental | Open in IMG/M |
| 3300000168 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - June 2009 P12 10m | Environmental | Open in IMG/M |
| 3300000265 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - sample_A_09_P04_10 | Environmental | Open in IMG/M |
| 3300000401 | Marine microbial community from La Parguera, Puerto Rico - BB Mangrove B Liquid | Environmental | Open in IMG/M |
| 3300000929 | Marine plume microbial communities from the Columbia River - 15 PSU | Environmental | Open in IMG/M |
| 3300000973 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY93 | Host-Associated | Open in IMG/M |
| 3300001346 | Pelagic Microbial community sample from North Sea - COGITO 998_met_01 | Environmental | Open in IMG/M |
| 3300001354 | Pelagic Microbial community sample from North Sea - COGITO 998_met_05 | Environmental | Open in IMG/M |
| 3300001472 | Marine viral communities from the Pacific Ocean - LP-32 | Environmental | Open in IMG/M |
| 3300001589 | Marine viral communities from the Pacific Ocean - LP-40 | Environmental | Open in IMG/M |
| 3300001965 | Marine microbial communities from Coastal Floreana, Equador - GS028 | Environmental | Open in IMG/M |
| 3300001967 | Marine microbial communities from Devil's Crown, Floreana Island, Equador - GS027 | Environmental | Open in IMG/M |
| 3300003216 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_59LU_5_DNA | Environmental | Open in IMG/M |
| 3300003345 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_90LU_22_DNA | Environmental | Open in IMG/M |
| 3300003346 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_74LU_5_DNA | Environmental | Open in IMG/M |
| 3300003427 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_116LU_22_DNA | Environmental | Open in IMG/M |
| 3300003620 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_125m_DNA | Environmental | Open in IMG/M |
| 3300004097 | Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaG | Environmental | Open in IMG/M |
| 3300004457 | Marine viral communities from Newfoundland, Canada MC-1 | Environmental | Open in IMG/M |
| 3300004642 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI047_10m_RNA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005239 | Environmental Genome Shotgun Sequencing: Ocean Microbial Populations from the Gulf of Maine | Environmental | Open in IMG/M |
| 3300005523 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F12-01SV265 | Environmental | Open in IMG/M |
| 3300005837 | Exploring phylogenetic diversity in Port Hacking ocean in Sydney, Australia - Port Hacking PH4 TJ4-TJ18 | Environmental | Open in IMG/M |
| 3300005913 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UK1 | Environmental | Open in IMG/M |
| 3300005941 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 | Environmental | Open in IMG/M |
| 3300006164 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNA | Environmental | Open in IMG/M |
| 3300006357 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006401 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006405 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
| 3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
| 3300006737 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006789 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG | Environmental | Open in IMG/M |
| 3300006921 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG | Environmental | Open in IMG/M |
| 3300007516 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01 | Environmental | Open in IMG/M |
| 3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
| 3300007552 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.571 | Environmental | Open in IMG/M |
| 3300007555 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.555 | Environmental | Open in IMG/M |
| 3300007609 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2_restored_H2O_MG | Environmental | Open in IMG/M |
| 3300007647 | Estuarine microbial communities from the Columbia River estuary - metaG 1370B-02 | Environmental | Open in IMG/M |
| 3300007655 | Estuarine microbial communities from the Columbia River estuary - High salinity metaG S.579 | Environmental | Open in IMG/M |
| 3300007718 | Estuarine microbial communities from the Columbia River estuary - metaG 1370A-3 | Environmental | Open in IMG/M |
| 3300007863 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1459B_0.2um | Environmental | Open in IMG/M |
| 3300007953 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1373A_3um | Environmental | Open in IMG/M |
| 3300007992 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461AB_0.2um | Environmental | Open in IMG/M |
| 3300008964 | Estuarine microbial communities from the Columbia River estuary - metaG 1551A-02 | Environmental | Open in IMG/M |
| 3300008996 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747 | Environmental | Open in IMG/M |
| 3300009000 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_H2O_MG | Environmental | Open in IMG/M |
| 3300009001 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG | Environmental | Open in IMG/M |
| 3300009027 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_H2O_MG | Environmental | Open in IMG/M |
| 3300009056 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-3 | Environmental | Open in IMG/M |
| 3300009058 | Estuarine microbial communities from the Columbia River estuary - metaG 1370A-02 | Environmental | Open in IMG/M |
| 3300009071 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 | Environmental | Open in IMG/M |
| 3300009076 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100511 | Environmental | Open in IMG/M |
| 3300009079 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741 | Environmental | Open in IMG/M |
| 3300009172 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 | Environmental | Open in IMG/M |
| 3300009193 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110321 | Environmental | Open in IMG/M |
| 3300009409 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_150 | Environmental | Open in IMG/M |
| 3300009420 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 | Environmental | Open in IMG/M |
| 3300009433 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 | Environmental | Open in IMG/M |
| 3300009440 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110512 | Environmental | Open in IMG/M |
| 3300009449 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110426 | Environmental | Open in IMG/M |
| 3300009467 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110530 | Environmental | Open in IMG/M |
| 3300009472 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110404 | Environmental | Open in IMG/M |
| 3300009476 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110407 | Environmental | Open in IMG/M |
| 3300009495 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 | Environmental | Open in IMG/M |
| 3300009498 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120426 | Environmental | Open in IMG/M |
| 3300009505 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110523 | Environmental | Open in IMG/M |
| 3300009543 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M2_3um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009705 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128 | Environmental | Open in IMG/M |
| 3300010300 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNA | Environmental | Open in IMG/M |
| 3300010389 | Marine sediment microbial communities from methane seeps within Baltimore Canyon, US Atlantic Margin - Baltimore Canyon MUC-11 12-14 cmbsf | Environmental | Open in IMG/M |
| 3300010883 | western Arctic Ocean co-assembly | Environmental | Open in IMG/M |
| 3300011252 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_4, permeate | Environmental | Open in IMG/M |
| 3300012920 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaG | Environmental | Open in IMG/M |
| 3300012936 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St13 metaG | Environmental | Open in IMG/M |
| 3300012954 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaG | Environmental | Open in IMG/M |
| 3300017706 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_13 viral metaG | Environmental | Open in IMG/M |
| 3300017708 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_04 viral metaG | Environmental | Open in IMG/M |
| 3300017714 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15 | Environmental | Open in IMG/M |
| 3300017717 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 27 SPOT_SRF_2011-10-25 | Environmental | Open in IMG/M |
| 3300017742 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 22 SPOT_SRF_2011-05-21 | Environmental | Open in IMG/M |
| 3300017746 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 12 SPOT_SRF_2010-06-29 | Environmental | Open in IMG/M |
| 3300017748 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 16 SPOT_SRF_2010-10-21 | Environmental | Open in IMG/M |
| 3300017751 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 (version 2) | Environmental | Open in IMG/M |
| 3300017752 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 23 SPOT_SRF_2011-06-22 | Environmental | Open in IMG/M |
| 3300017756 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 | Environmental | Open in IMG/M |
| 3300017758 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 32 SPOT_SRF_2012-05-30 | Environmental | Open in IMG/M |
| 3300017762 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 45 SPOT_SRF_2013-07-18 | Environmental | Open in IMG/M |
| 3300017763 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 33 SPOT_SRF_2012-06-20 | Environmental | Open in IMG/M |
| 3300017767 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 29 SPOT_SRF_2011-12-20 | Environmental | Open in IMG/M |
| 3300017776 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 17 SPOT_SRF_2010-11-23 | Environmental | Open in IMG/M |
| 3300017781 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14 | Environmental | Open in IMG/M |
| 3300017782 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19 | Environmental | Open in IMG/M |
| 3300017783 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 2 SPOT_SRF_2009-07-10 | Environmental | Open in IMG/M |
| 3300017818 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101401AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017824 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017949 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071406AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017950 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017951 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017956 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071403BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017957 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101407AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017962 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071404AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017964 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071410BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017967 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017969 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071407BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017985 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101412BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017986 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101405AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018036 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041406US metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018049 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101408AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018416 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018417 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011507BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018418 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101403AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018420 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018424 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018426 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101402AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018428 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101404AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018876 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011513CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019459 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011511BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019765 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW13Sep16_MG | Environmental | Open in IMG/M |
| 3300020055 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101411CT metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020165 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160331_1 | Environmental | Open in IMG/M |
| 3300020182 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160502_2 | Environmental | Open in IMG/M |
| 3300020187 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160512_1 | Environmental | Open in IMG/M |
| 3300020274 | Marine microbial communities from Tara Oceans - TARA_B100000900 (ERX556029-ERR598943) | Environmental | Open in IMG/M |
| 3300020347 | Marine microbial communities from Tara Oceans - TARA_B100000497 (ERX556109-ERR598994) | Environmental | Open in IMG/M |
| 3300020352 | Marine microbial communities from Tara Oceans - TARA_B100000497 (ERX556084-ERR599144) | Environmental | Open in IMG/M |
| 3300020358 | Marine microbial communities from Tara Oceans - TARA_B100000768 (ERX555925-ERR599009) | Environmental | Open in IMG/M |
| 3300020379 | Marine microbial communities from Tara Oceans - TARA_B100000902 (ERX556001-ERR599168) | Environmental | Open in IMG/M |
| 3300020382 | Marine microbial communities from Tara Oceans - TARA_B100000780 (ERX556058-ERR599059) | Environmental | Open in IMG/M |
| 3300020404 | Marine microbial communities from Tara Oceans - TARA_B100000900 (ERX555954-ERR598978) | Environmental | Open in IMG/M |
| 3300020408 | Marine microbial communities from Tara Oceans - TARA_B100000925 (ERX555963-ERR599118) | Environmental | Open in IMG/M |
| 3300020414 | Marine microbial communities from Tara Oceans - TARA_B100000035 (ERX556019-ERR599028) | Environmental | Open in IMG/M |
| 3300020438 | Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942) | Environmental | Open in IMG/M |
| 3300020439 | Marine microbial communities from Tara Oceans - TARA_B100001939 (ERX556062-ERR599029) | Environmental | Open in IMG/M |
| 3300020450 | Marine microbial communities from Tara Oceans - TARA_B100000575 (ERX555933-ERR599077) | Environmental | Open in IMG/M |
| 3300020469 | Marine microbial communities from Tara Oceans - TARA_B100001093 (ERX555967-ERR599052) | Environmental | Open in IMG/M |
| 3300020474 | Marine prokaryotic communities collected during Tara Oceans survey from station TARA_151 - TARA_B100001564 (ERX555957-ERR598976) | Environmental | Open in IMG/M |
| 3300020595 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160412_1 | Environmental | Open in IMG/M |
| 3300021085 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 | Environmental | Open in IMG/M |
| 3300021335 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO540 | Environmental | Open in IMG/M |
| 3300021356 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO245 | Environmental | Open in IMG/M |
| 3300021364 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO304 | Environmental | Open in IMG/M |
| 3300021365 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160316_1 | Environmental | Open in IMG/M |
| 3300021368 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO550 | Environmental | Open in IMG/M |
| 3300021375 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO132 | Environmental | Open in IMG/M |
| 3300021379 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO247 | Environmental | Open in IMG/M |
| 3300021957 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18D | Environmental | Open in IMG/M |
| 3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
| 3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
| 3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300021964 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34D | Environmental | Open in IMG/M |
| 3300022920 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_118_April2016_10_MG | Environmental | Open in IMG/M |
| 3300022921 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041407BS metaG | Environmental | Open in IMG/M |
| 3300022925 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG | Environmental | Open in IMG/M |
| 3300022927 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG | Environmental | Open in IMG/M |
| 3300023081 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071406AT metaG | Environmental | Open in IMG/M |
| 3300023084 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405CT metaG | Environmental | Open in IMG/M |
| 3300023087 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101407AT metaG | Environmental | Open in IMG/M |
| 3300023110 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101405AT metaG | Environmental | Open in IMG/M |
| 3300023116 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG | Environmental | Open in IMG/M |
| 3300023119 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101401AT metaG | Environmental | Open in IMG/M |
| 3300023172 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071403BT metaG | Environmental | Open in IMG/M |
| 3300023176 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG | Environmental | Open in IMG/M |
| 3300023178 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101404AT metaG | Environmental | Open in IMG/M |
| 3300024191 | Seawater microbial communities from Monterey Bay, California, United States - 45D | Environmental | Open in IMG/M |
| 3300024242 | Seawater microbial communities from Monterey Bay, California, United States - 91D | Environmental | Open in IMG/M |
| 3300024255 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_123_September2016_10_MG | Environmental | Open in IMG/M |
| 3300024264 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_124_October2016_10_MG | Environmental | Open in IMG/M |
| 3300024301 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011504CT (spades assembly) | Environmental | Open in IMG/M |
| 3300024332 | Seawater microbial communities from Monterey Bay, California, United States - 73D | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300024348 | 0.2um to 3um size fraction coassembly | Environmental | Open in IMG/M |
| 3300024428 | Seawater microbial communities from Monterey Bay, California, United States - 32D | Environmental | Open in IMG/M |
| 3300025070 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025083 | Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025084 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025086 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025102 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025137 | Marine viral communities from the Pacific Ocean - LP-32 (SPAdes) | Environmental | Open in IMG/M |
| 3300025138 | Marine viral communities from the Pacific Ocean - LP-40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025151 | Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025608 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_161SG_22_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025636 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_90LU_22_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025658 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI072_LV_10m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025684 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_74LU_5_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025690 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110331 (SPAdes) | Environmental | Open in IMG/M |
| 3300025695 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_116LU_22_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025696 | Pelagic Microbial community sample from North Sea - COGITO 998_met_02 (SPAdes) | Environmental | Open in IMG/M |
| 3300025699 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120503 (SPAdes) | Environmental | Open in IMG/M |
| 3300025704 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120524 (SPAdes) | Environmental | Open in IMG/M |
| 3300025705 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI075_LV_DNA_10m (SPAdes) | Environmental | Open in IMG/M |
| 3300025712 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110321 (SPAdes) | Environmental | Open in IMG/M |
| 3300025767 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_105LU_22_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025809 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110523 (SPAdes) | Environmental | Open in IMG/M |
| 3300025822 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110414 (SPAdes) | Environmental | Open in IMG/M |
| 3300025870 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_125m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025879 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_85LU_5_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025892 | Pelagic Microbial community sample from North Sea - COGITO 998_met_01 (SPAdes) | Environmental | Open in IMG/M |
| 3300026097 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2_restored_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300026138 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300026470 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 73R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300027280 | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_48_BLW_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300027522 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG058-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027668 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG104-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027752 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300027779 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300027813 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300027976 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01 (SPAdes) | Environmental | Open in IMG/M |
| 3300028008 | Seawater microbial communities from Monterey Bay, California, United States - 1D_r | Environmental | Open in IMG/M |
| 3300028111 | Seawater microbial communities from Monterey Bay, California, United States - 35D | Environmental | Open in IMG/M |
| 3300028115 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501CT (spades assembly) | Environmental | Open in IMG/M |
| 3300028136 | Seawater microbial communities from Monterey Bay, California, United States - 9D | Environmental | Open in IMG/M |
| 3300028196 | Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI112_10m | Environmental | Open in IMG/M |
| 3300028197 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2015_P26_10m | Environmental | Open in IMG/M |
| 3300028273 | Seawater microbial communities from Monterey Bay, California, United States - 51D | Environmental | Open in IMG/M |
| 3300028287 | Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI060_120m | Environmental | Open in IMG/M |
| 3300029318 | Marine giant viral communities collected during Tara Oceans survey from station TARA_038 - TARA_Y100000289 | Environmental | Open in IMG/M |
| 3300031140 | Marine microbial communities from water near the shore, Antarctic Ocean - #420 | Environmental | Open in IMG/M |
| 3300031142 | Marine microbial communities from water near the shore, Antarctic Ocean - #353 | Environmental | Open in IMG/M |
| 3300031143 | Marine microbial communities from water near the shore, Antarctic Ocean - #422 | Environmental | Open in IMG/M |
| 3300031167 | Marine microbial communities from water near the shore, Antarctic Ocean - #418 | Environmental | Open in IMG/M |
| 3300031519 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2 | Environmental | Open in IMG/M |
| 3300031602 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #260 | Environmental | Open in IMG/M |
| 3300031629 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #80 | Environmental | Open in IMG/M |
| 3300031630 | Marine microbial communities from water near the shore, Antarctic Ocean - #38 | Environmental | Open in IMG/M |
| 3300031644 | Marine microbial communities from water near the shore, Antarctic Ocean - #5 | Environmental | Open in IMG/M |
| 3300031705 | Marine microbial communities from water near the shore, Antarctic Ocean - #36 | Environmental | Open in IMG/M |
| 3300031766 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 21515 | Environmental | Open in IMG/M |
| 3300031848 | Marine microbial communities from water near the shore, Antarctic Ocean - #3 | Environmental | Open in IMG/M |
| 3300034073 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XL | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2010_100261707 | 3300000101 | Marine | MANKTEDWLEELVKKYSIPTEENKQKRGVLNETQLKNLKDGKN* |
| DelMOSum2010_100353996 | 3300000101 | Marine | MSDWMERLVKKYSVPTNDTTDKRGMLNETQLNNLRNGKDKKTT* |
| DelMOSum2010_100756222 | 3300000101 | Marine | MANKTEDWLEELVKKYSIPTEEKTDKRGILNESQLNNLKNGKN* |
| DelMOSum2011_100154354 | 3300000115 | Marine | MANKTEDWLEELVKKYSIPTEEKTDKRGMLNETQLKNLKNGKN* |
| DelMOSpr2010_101991612 | 3300000116 | Marine | MSETKMSDWMERLVKKYSVPTNDTTDKRGMLNETQLNNLRNGKDKKTT* |
| DelMOWin2010_101380852 | 3300000117 | Marine | MNKENWLETLVKKYSLPKEEQKEKRGILSETQLKNLKNGKN* |
| DelMOWin2010_102207661 | 3300000117 | Marine | DWLEELVKKYSIPTEEKTDKRGMLNETQLKNLKNGKN* |
| LPaug09P1610mDRAFT_10191813 | 3300000149 | Marine | MSDWMERLVKKYSVPTNDTTDKRGMLNETQLKNLRNGKDKKTT* |
| LPjun09P1210mDRAFT_10071353 | 3300000168 | Marine | MAKTKQEEWLHELVKKYSIPTNDKTDKRGMLNETQLKNLKNGKN* |
| LPjun09P1210mDRAFT_10100562 | 3300000168 | Marine | MANNTQDWLEQLVKKYSIPTEETNEKRGVLNETQLKNLKNGKN* |
| LP_A_09_P04_10DRAFT_10098682 | 3300000265 | Marine | MSKTKEDWLQELVKKYSIPTDDKTEKRGILSETQMKNLKNGKN* |
| BB_Man_B_Liq_inBBDRAFT_10275853 | 3300000401 | Bioluminescent Bay | MSKKDDWLETLVKKYSLPKEDKTEKRGILSETQLKNLKDGKN* |
| NpDRAFT_100783288 | 3300000929 | Freshwater And Marine | MNKQDEWLERLVKNYSIPSEDKKEKRGVLNEEQLKNLKNGKN* |
| BBAY93_100620073 | 3300000973 | Macroalgal Surface | MSKTKQDWLETLVKKYSLPKEEQKEKRGILSETQLKNLKND* |
| JGI20151J14362_100441616 | 3300001346 | Pelagic Marine | MSKKEDWLEELVKKYSVPTNDKIEKRGILNESQLKNLKDGKN* |
| JGI20155J14468_100403712 | 3300001354 | Pelagic Marine | MSKXKQDWLEELVKKYSIPTEEKTDKRGMLNETQLKNLKNGKN* |
| JGI24004J15324_100320321 | 3300001472 | Marine | MAKTKQEEWLHELVKKYSIPTNDNTDKRGMLNETQLKNLKNGKN* |
| JGI24005J15628_100086893 | 3300001589 | Marine | MAKTKQEEWLHELVKKYSIPTNDKTDKRGILNETQLKNLKNGKN* |
| JGI24005J15628_100748502 | 3300001589 | Marine | MANNTQDWLEQLVKKYSIPTEETNEKRGVLNESQLKNLKDGKS* |
| JGI24005J15628_101881962 | 3300001589 | Marine | MANSTEDWLEELVKKYSIPTEEIKEKRGVLNETQLNNLKNGKN* |
| GOS2243_10171254 | 3300001965 | Marine | MSKTQDWLEELVKKYSIPTDDKTEKRGILNETQLKNLKNGKS* |
| GOS2243_10795996 | 3300001965 | Marine | MSKKQDWLETLVKKYSLPKEDKTEKRGMLSETQLKNLKDGKDKKTT* |
| GOS2242_10633212 | 3300001967 | Marine | MSDWMERLVKKYSVPTNETKKRGILSETQVKNLKDGKD* |
| JGI26079J46598_10078123 | 3300003216 | Marine | MNKQDQWLERLVRNYSIPTEEKKEKRGVLNEEQLKNLKNGKS* |
| JGI26079J46598_10119214 | 3300003216 | Marine | MSKQDEWLEKLVKNYSIPSEEKKEKRGVLNEEQLKNLKNGKN* |
| JGI26079J46598_10347623 | 3300003216 | Marine | MNKQDQWLERLVRNYSIPPEEKKEKRGVLNEEQLKNLKNGKN* |
| JGI26080J50196_10773792 | 3300003345 | Marine | MSKQDEWLEKLVKNYSIPSEDKKEKRGVLNEEQLKNLKNGKN* |
| JGI26081J50195_10288232 | 3300003346 | Marine | MSKQDEWLERLVKNYSIPSEEKKEKRGVLNEEQLKNLKNGKN* |
| JGI26084J50262_10541782 | 3300003427 | Marine | MNKQDQWLERLVRNYSIPSEEKKEKRGVLNEEQLKNLKNGKS* |
| JGI26084J50262_10588283 | 3300003427 | Marine | MNKKQDWLETLVKKYSIPKGDKTEKRGILTETQLKNLKNGKS* |
| JGI26084J50262_10817353 | 3300003427 | Marine | MSKKEDWLETLVKKYSIPKEDKTEKRGILSETQLKNLKNGKS* |
| JGI26273J51734_100095108 | 3300003620 | Marine | MANKKEDWLETLVKKYSIPTEEKTDKRGILNESQLKNLKNGKS* |
| Ga0055584_1000239072 | 3300004097 | Pelagic Marine | MSDWMERLVKKYSVPTNDKKEKRGILNETQLNNLKNGKN* |
| Ga0055584_1017275603 | 3300004097 | Pelagic Marine | MSKTQDWLETLVKKYSIPKGDKTKKRGILSETQMKNLKNGKN* |
| Ga0066224_10803214 | 3300004457 | Marine | MSKTKHDWLVELVKKYSLPTNDKTEKRGILSETQMKNLKNGKN* |
| Ga0066224_11792463 | 3300004457 | Marine | MANKTEDWLEELVKKYSIPTEETNEKRGVLNEAQLNNLKNGKN* |
| Ga0066224_12561832 | 3300004457 | Marine | MSKQKQEWLHELVKNYSIPTEEKTNKRGVLNETQLKNLQNGKN* |
| Ga0066612_13077244 | 3300004642 | Marine | MANSTEDWLEELVKKYSIPTEETKEKRGVLNETQLINLKNGKN* |
| Ga0073579_119006733 | 3300005239 | Marine | MSKQKQDWLEELVKKYSIPTEEKTDKRGMLNETQLKNLKNGKN* |
| Ga0073579_14413624 | 3300005239 | Marine | MSKTKQDWLEELVKKYSIPTEEKPDKRGMLNETQLKNLKDGKN* |
| Ga0066865_100493132 | 3300005523 | Marine | MSDWMERLVKKYSVPTDNKTEKRGILSETQLKNLKNGKN* |
| Ga0078893_1025539920 | 3300005837 | Marine Surface Water | MSKKEDWLETLVKKYSLPKEDKTEKRGILSETQLKNLKNGKN* |
| Ga0078893_102557903 | 3300005837 | Marine Surface Water | MNKNDWLETLVKKYSLPKEDKKEKRGILSETQLKNLKNGKN* |
| Ga0078893_102557912 | 3300005837 | Marine Surface Water | MSKTQDWLEELVKKYSIPTDDKTEKRGILSETQMKNLKDGKN* |
| Ga0075108_100225156 | 3300005913 | Saline Lake | RQNEWLEELVKKYSIPTDDKTEKRGILNETQLKNLKDGKE* |
| Ga0070743_100160864 | 3300005941 | Estuarine | MSKDKDWLERLVKNYQIPSEEKTQKRGLLSETQLKNLKNGKN* |
| Ga0075441_100494091 | 3300006164 | Marine | MSKTQEDWLEELVSKYSIPANDKEITDKRGMLSENQLKNLSNGKS* |
| Ga0075441_101362573 | 3300006164 | Marine | MSEKKMSDWMERLVKKYSVPVNTETDRRGILNESQVKNLKDGKS* |
| Ga0075502_15779624 | 3300006357 | Aqueous | MSKKEDWLETLVKKYSIPKDDKTEKRGILNETQLKNLKNGKN* |
| Ga0075506_14874832 | 3300006401 | Aqueous | MSEKKMSDWMERLVKKYSVPTNDKKEKRGILNETQLNNLKNGKN* |
| Ga0075510_109978513 | 3300006405 | Aqueous | MDKKNWLETLVKKYSLPKDDKTDKRGILSETQLKNLKNGKN* |
| Ga0070744_101033545 | 3300006484 | Estuarine | MSKTKQDWLEELVKKYSIPTDDKSEKRGMLSETQMKNLKNGKN* |
| Ga0098038_10113045 | 3300006735 | Marine | MSDWMERLVKKYSVPTNETKKRGILSESQVKNLKDGKD* |
| Ga0098038_10622873 | 3300006735 | Marine | MSETKMSDWMERLVKKYSIPTNDTTDKRGMLNETQLKNLRNGKDKKTT* |
| Ga0098037_10631463 | 3300006737 | Marine | MSETKMSDWMERLVKKYSVPTNETKKRGILSESQVKNLKDGKD* |
| Ga0098037_12069164 | 3300006737 | Marine | MSDWMERLVKKYSIPTNDTTDKRGMLNETQLKNLRNG |
| Ga0098048_10079735 | 3300006752 | Marine | MANSKQDWLEELVKKYSIPTEEKTDKRGMLNETQLKNLKNGKS* |
| Ga0098048_10244354 | 3300006752 | Marine | MSKTKEDWLQELVKKYSIPTDDKTEKRGILSETQMKNLKDGKN* |
| Ga0098054_10048688 | 3300006789 | Marine | MANSKQDWLEELVKKYSIPTKEKTDKRGMLNETQLKNLKNGKS* |
| Ga0098054_10259692 | 3300006789 | Marine | MSKTKQDWLEDLVKKYSIPTDDKTDKRGILNETQLKNLKNGKN* |
| Ga0098060_12085483 | 3300006921 | Marine | SKQDWLEELVKKYSIPTKEKTDKRGMLNETQLKNLKNGKS* |
| Ga0105050_1001958711 | 3300007516 | Freshwater | MSRQNEWLEELVKKYSIPTNDKTEKRGILNETQLKNLKDGKE* |
| Ga0099848_11530843 | 3300007541 | Aqueous | MSKKEDWLEKLVKNYSLPKEGKKEKRGILNETQLKNLKNGKS* |
| Ga0102818_10244704 | 3300007552 | Estuarine | MANKTEDWLEQLVKKYSIPTQEKTDKRGILNESQLKNLKDGKN* |
| Ga0102817_10410614 | 3300007555 | Estuarine | MANKKEDWLETLVKKYSIPTEEKTDKRGILNESQLKNLKDGKN* |
| Ga0102817_11056113 | 3300007555 | Estuarine | MANKREEWLHELVKKYSIPTEEKTDKRGILNETQLKNLKNGKN* |
| Ga0102945_100003456 | 3300007609 | Pond Water | MSREKEWLEELVKKYSIPKNDKTEKRGILNETQLKNLKNGKN* |
| Ga0102945_10043968 | 3300007609 | Pond Water | MSKKDDWLEQLVRNYSLPKEEGKKEKRGILSETQLKNLKNGKN* |
| Ga0102945_10096393 | 3300007609 | Pond Water | MSKKDDWLEQLVKNYSLPKEEDRKEKRGILSETQLKNLKNGKN* |
| Ga0102945_10360763 | 3300007609 | Pond Water | MGKEDEWLEQLVKKYSLPKQEGKREKRGILSETQLKNIKNGKN* |
| Ga0102855_10064994 | 3300007647 | Estuarine | MANKTEDWLEQLVKKYSIPTQEKTDKRGILNESQLNNLKNGKN* |
| Ga0102855_10997202 | 3300007647 | Estuarine | MAKTKQEEWLHELVKKYSIPTNDNTDKRGILNETQLKNLKNGKN* |
| Ga0102825_11363701 | 3300007655 | Estuarine | MSKTKQDWLEELVKKYSIPTEENKQKRGVLNETQLKNLKDGKN* |
| Ga0102852_11262521 | 3300007718 | Estuarine | MANKKEDWLETLVKKYSIPTEEKTDKRGILNESQLKNLK |
| Ga0105744_10070402 | 3300007863 | Estuary Water | MSKTKQAWLENLVKKYSIPADDKTDKRGMLNETQLNNLKNGKN* |
| Ga0105744_11597662 | 3300007863 | Estuary Water | MANKKEDWLETLVKEYSIPTEEKTDKRGILNESQLKNLKNGKS* |
| Ga0105738_11124682 | 3300007953 | Estuary Water | MANKKEDWLETLVKEYSIPTEEKTDKRGILNESQLKNLKDGKN* |
| Ga0105748_102782453 | 3300007992 | Estuary Water | MSKTKEDWLQELVKKYSIPKGDKTEKRGILSETQMKNLKNGKN* |
| Ga0102889_11994503 | 3300008964 | Estuarine | MANKTDDWLEELVKKYSIPTEETKEKRGVLNETQLNNLKNGKN* |
| Ga0102831_10237546 | 3300008996 | Estuarine | WLERLVKNYQIPSEEKTQKRGLLSETQLKNLKNGKN* |
| Ga0102960_10603843 | 3300009000 | Pond Water | MSKNKEDWLEELVKKYSIPADDKTEKRGILNETQLKNLKNGKN* |
| Ga0102960_10666604 | 3300009000 | Pond Water | MSKNKEDWLETLVKKYSIPKDDKTEKRGILNETQLKNLKNGKN* |
| Ga0102960_11174422 | 3300009000 | Pond Water | MNKENWLETLVKKYSLPKEDKKEKRGILSETQLKNLKNGKN* |
| Ga0102960_13614192 | 3300009000 | Pond Water | MSKNKEDWLEELVKKYSIPTDDKTEKRGILSETQMKNLKDGKN* |
| Ga0102963_10688972 | 3300009001 | Pond Water | MSKNKEDWLEELVKKYSISADDKTEKRGILNETQLKNLKNGKN* |
| Ga0102957_10948113 | 3300009027 | Pond Water | MSKKEDWLETLVKKYSLPKDDKTEKRGILNETQLKNLKNGKN* |
| Ga0102957_12299623 | 3300009027 | Pond Water | MSKNKEDWLEELVKKYSIPTDDKTEKRGILSETQMKNLKNGKN* |
| Ga0102860_11695931 | 3300009056 | Estuarine | CNMSKTKQDWLENLVKKYSIPADDKTDKRGMLNETQLNNLKNGKN* |
| Ga0102854_11360703 | 3300009058 | Estuarine | MSKTKQDWLEELVKKYSIPTEEKSDKRGILNETQLKNLKNGKN* |
| Ga0115566_102227252 | 3300009071 | Pelagic Marine | MSKTKQDWLEELVKKYSIPTEEKTDKRGILNETQLKNLKNGKN* |
| Ga0115566_104266292 | 3300009071 | Pelagic Marine | MSKTKQDWLETLVKKYSLPKEEQKEKRGILSETQLKNLKNGKN* |
| Ga0115566_104658341 | 3300009071 | Pelagic Marine | MSKKQDWLEELVKKYSIPTEEKTDKRGMLNETQLKN |
| Ga0115550_12942882 | 3300009076 | Pelagic Marine | MNKQDQWLERLVRNYSIPTEEKKEKRGVLNEEQLKNLKNGKN* |
| Ga0102814_101816385 | 3300009079 | Estuarine | MSKTKQDWLEELVKKYSIPTDDKTEKRGILSETQMKNLKNGKN* |
| Ga0114995_1000463410 | 3300009172 | Marine | MSKTTEDWLEELVKKYSIPTEETKEKRGVLNETQLKNLQNGKN* |
| Ga0114995_102103904 | 3300009172 | Marine | MANSTEDWLEELVKKYSIPTEETNEKRGVLNEAQLNNLKNGKN* |
| Ga0114995_103922294 | 3300009172 | Marine | MANKAEDWLEELVKKYSIPTEETNEKRGVLNEAQLNNLKNGKN* |
| Ga0115551_11082532 | 3300009193 | Pelagic Marine | MSKTKQDWLEELVKKYSIPTEEKTDKRGMLNETQLKNLKNGKN* |
| Ga0114993_109396733 | 3300009409 | Marine | EDWLEELVKKYSIPTEETKEKRGVLNETQLKNLQNGKN* |
| Ga0114994_100229848 | 3300009420 | Marine | MIKTKEEWLIELVRKYSIPTNDITEKRGILSETQLKNLNNGKS* |
| Ga0114994_101190892 | 3300009420 | Marine | MANNTEDWLEELVKKYSIPTEEIKEKRGVLNETQLNNLKNGKN* |
| Ga0114994_101215053 | 3300009420 | Marine | MNKTTEDWLIELVRKYSIPPNDTEEKEKRGMLSETQLKNLSNGKN* |
| Ga0114994_103369892 | 3300009420 | Marine | MANKKEDWLEQLVKKYSIPTEETNEKRGVLNETQLNNLKNGKN* |
| Ga0114994_104380033 | 3300009420 | Marine | MSKQKQEWLHELVKNYSIPTEEKTNKRGVLNETQLNNLKNGKN* |
| Ga0115545_10320531 | 3300009433 | Pelagic Marine | MSKTKQDWLEELVKKYSIPTEEKTDKRGILNETQLKNLKNG |
| Ga0115545_11706413 | 3300009433 | Pelagic Marine | LEELVKKYSIPTEEKTDKRGMLNETQLKNLKDGKN* |
| Ga0115561_11298954 | 3300009440 | Pelagic Marine | MSKQKQDWLEELVKKYSIPTEEKTDKRGILNETQLKNLKNGKN* |
| Ga0115558_12571533 | 3300009449 | Pelagic Marine | NMSKTKQDWLEELVKKYSIPTEEKTDKRGILNETQLKNLKNGKN* |
| Ga0115558_13738111 | 3300009449 | Pelagic Marine | MSKTKQDWLEELVKKYSIPTEEKTDKRGMLNQTQLKNLKNGKN* |
| Ga0115565_103956301 | 3300009467 | Pelagic Marine | CNMSKTKQDWLEELVKKYSIPTEEKTDKRGMLNETQLKNLKNGKN* |
| Ga0115554_12613023 | 3300009472 | Pelagic Marine | MSKTKQDWLETLVKKYSLPKEEQKEKRGILSETQLKNLKN |
| Ga0115555_13275432 | 3300009476 | Pelagic Marine | MSKTKQDWLETLVKKYSLPEEEQKEKRGILSETQLKNLKNGKN* |
| Ga0115571_11711394 | 3300009495 | Pelagic Marine | MANNTEDWLEELVKKYSIPTEETKEKRGVLNETQLNNLKNGKN* |
| Ga0115571_12866392 | 3300009495 | Pelagic Marine | MSKTKQDWLEELVKKYSIPTEETTDKRGILNEKQLKNLK |
| Ga0115568_102618223 | 3300009498 | Pelagic Marine | LEELVKKYSIPTEEKTDKRGMLNETQLKNLKNGKN* |
| Ga0115564_100637845 | 3300009505 | Pelagic Marine | MSKQKQDWLEELVKKYSIPTEEKTDKRGMLNETQLKNLKDGKN* |
| Ga0115564_101617174 | 3300009505 | Pelagic Marine | KMSKQKQDWLEELVKKYSIPTEEKTDKRGMLNETQLKNLKNGKN* |
| Ga0115099_103159805 | 3300009543 | Marine | MSKTQDWLEELVKKYSIPTNDKTEKRGILNETQLKNLKNGKS* |
| Ga0115000_107044352 | 3300009705 | Marine | MANNTQDWLEQLVKKYSIPTEEIKEKRGVLNETQLNNLKNGKN* |
| Ga0129351_100040613 | 3300010300 | Freshwater To Marine Saline Gradient | MDKKNWLETLVKKYSLPKDDKTDKRGILSETQLKNLKNGKS* |
| Ga0136549_100769343 | 3300010389 | Marine Methane Seep Sediment | MSKKDDWLEKLVKNYSLPKEEGKKEKRGILNETQLKNLKNGKS* |
| Ga0133547_103316414 | 3300010883 | Marine | MNKTTEDWLIELVRKYSIPSNDTEEKEKRGMLSETQLKNLSNGKN* |
| Ga0151674_11413663 | 3300011252 | Marine | MANSTEDWLEELVKKYSVPTEESKEKRGVLNETQLNNLKNGKN* |
| Ga0160423_1000590319 | 3300012920 | Surface Seawater | MSEKKMSDWMERLVKKYSVPTDNKTEKRGILSETQLKNLKNGKD* |
| Ga0160423_100264247 | 3300012920 | Surface Seawater | MSKKEDWLETLVKKYSLPKEEQKEKRGILSETQLKNLKQGKSN* |
| Ga0160423_100466077 | 3300012920 | Surface Seawater | MSETKMSDWMERLIKKYSIPTNLKTDKRGILNETQLKNLKNGKN* |
| Ga0160423_101561012 | 3300012920 | Surface Seawater | MDKKDWLETLVKKYSLPKNDKTEKRGILSETQLKNLKQGKSN* |
| Ga0160423_102946972 | 3300012920 | Surface Seawater | MSETKMSDWMERLVKKYSVPTNETKKRGILSETQVKNLKDGKD* |
| Ga0163109_106754583 | 3300012936 | Surface Seawater | MSKKQEWLETLVKKYSIPKGDKTEKRGILNETQLKNLKNGKN* |
| Ga0163111_103388525 | 3300012954 | Surface Seawater | MSEKKMSDWMERLVKKYSVPVDDKTDKRGILSETQLKNLKQGKSN* |
| Ga0163111_114832282 | 3300012954 | Surface Seawater | MSETKMSDWMERLIKKYSVPTNETKKRGILNEAQVKNLKDGKE* |
| Ga0163111_117946621 | 3300012954 | Surface Seawater | KMSDWMERLIKKYSIPTNLKTDKRGILNETQLKNLKNGKN* |
| Ga0181377_10135895 | 3300017706 | Marine | MSDKKMSDWMERLVKKYSVPANDKSEKRGILNETQLKNLKNGKS |
| Ga0181377_10769872 | 3300017706 | Marine | MANSKQDWLEELVKKYSIPTEEKTDKRGMLNETQLKNLKNGKN |
| Ga0181369_10286606 | 3300017708 | Marine | MSKKQDWLETLVKKYSLPKEDKTEKRGMLNETQLKNLKDGKN |
| Ga0181412_11444461 | 3300017714 | Seawater | KQDWLEELVKKYSIPTEEKSDKRGILNETQLKNLKNGKN |
| Ga0181404_10127577 | 3300017717 | Seawater | MNKNDWLETLVKKYSLPKEQQKEKRGILSETQLKNLKNGKS |
| Ga0181404_10142511 | 3300017717 | Seawater | MANSKEDWLEELVKKYSIPTEEKTDKRGILNETQLKNLKNGKN |
| Ga0181399_10415574 | 3300017742 | Seawater | MSKTKQDWLETLVKKYSLPKEEQKEKRGILSETQLKNF |
| Ga0181389_100162015 | 3300017746 | Seawater | MSKTKQDWLETLVKKYSLPKEQQKEKRGILSETQLKNLKNGKS |
| Ga0181393_11730392 | 3300017748 | Seawater | MSKTKQDWLETLVKKYSLPKEEQKKKRGILSETQLKNLKNGKS |
| Ga0187219_10124708 | 3300017751 | Seawater | SKTKQDWLEELVKKYSIPTEEKSDKRGILNETQLKNLKDGKN |
| Ga0187219_11382393 | 3300017751 | Seawater | MSKTKEDWLQELVKKYSIPKGDKTKKRGILSETQMKNLKNGKN |
| Ga0181400_10432214 | 3300017752 | Seawater | MNKNDWLETLVKKYSLPKEQQKEKRGILSETKLKNLKNGKS |
| Ga0181382_10573313 | 3300017756 | Seawater | MNKNDWLETLVKKYSLPKEEQKEKRGILSETQLKNLKNGKS |
| Ga0181409_12279003 | 3300017758 | Seawater | DWLETLVKKYSLPKEDKTEKRGILSETQLKNLKDGKN |
| Ga0181422_11083132 | 3300017762 | Seawater | MANKKEDWLEALVKEYSIPTEEKTDKRGILNESQLKNLKDGKN |
| Ga0181410_11490091 | 3300017763 | Seawater | MSKTKQDWLEELVKKYSIPTEENKQKRGVLNETQLKNLKDGKN |
| Ga0181406_10628745 | 3300017767 | Seawater | KTKQDWLETLVKKYSLPKEEQKEKRGILSETQLKNLKNGKS |
| Ga0181406_11601414 | 3300017767 | Seawater | MSKTKQDWLETLVKKYSLPKEEQKEKRGILSETQLKNL |
| Ga0181394_11437543 | 3300017776 | Seawater | MSKKKQDWLEELVKKYSIPTEEKSDKRGILNETQLKNLKDGKN |
| Ga0181394_11768342 | 3300017776 | Seawater | MANKREECLHELVKKYSIPTEEKTDKRGILNETQLKNLKNGKN |
| Ga0181423_12732042 | 3300017781 | Seawater | MAKTKQEEWLHELVKKYSIPTNDNTDKRGILNETQLKNLKNGK |
| Ga0181380_12691191 | 3300017782 | Seawater | EWLHELVKKYSIPTEEKTDKRGILNETQLKNLKNGKN |
| Ga0181379_10290106 | 3300017783 | Seawater | MSKKEDWLETLVKKYSLPKEDKTEKRGILSETQLKNLKDGKN |
| Ga0181565_100264133 | 3300017818 | Salt Marsh | MSKKDDWLEQLVKNYSLPKEEGKKEKRGILSETQLKNLKNGKN |
| Ga0181565_100264966 | 3300017818 | Salt Marsh | MSKKEDWLETLVKKYSIPKEDKTEKRGILTETQLKNLKNGKS |
| Ga0181565_101901874 | 3300017818 | Salt Marsh | MNKNDWLETLVKKYSLPKEDKKEKRGILSEIQLKNLKNGKN |
| Ga0181565_102228643 | 3300017818 | Salt Marsh | MNKKEDWLETLVKKYSIPKGDKTEKRGILTETQLKNLKNGKS |
| Ga0181552_100187069 | 3300017824 | Salt Marsh | MSDWMERLVKKYSVPTNDKKEKRGILNETQLNNLKNGKN |
| Ga0181552_100510353 | 3300017824 | Salt Marsh | MNRKEEWLERLVRNYSIPTEEKKEKRGVLNEEQLKNLKNGKN |
| Ga0181552_101071525 | 3300017824 | Salt Marsh | MSDKKMSDWMERLVKKYSIPTNDKTEKRGILNETQLKNLKNGKN |
| Ga0181552_101239233 | 3300017824 | Salt Marsh | MSKNKEDWLETLVKKYSIPKEDKSEKRGILSETQLKNLKDGKN |
| Ga0181552_101848963 | 3300017824 | Salt Marsh | MNKQDQWLERLVRNYSIPTEEKKEKRGVLNEEQLKNLKNGKS |
| Ga0181552_102117662 | 3300017824 | Salt Marsh | MNKQDQWLERLVRNYSIPTEEKKEKRGVLNEEQLKNLKNGKN |
| Ga0181552_103790112 | 3300017824 | Salt Marsh | MNKENWLETLVKKYSLPKEDKKEKRGILSETQLKNLKNGKS |
| Ga0181552_103939261 | 3300017824 | Salt Marsh | KEDWLETLVKKYSIPKGDKTEKRGILNETQLKNLKNGKN |
| Ga0181552_104044844 | 3300017824 | Salt Marsh | MSKNKEDWLETLVKKYSIPKGDKTEKRGILNETQLKNLKNGKN |
| Ga0181584_101237683 | 3300017949 | Salt Marsh | MNKKEDWLETLVKKYSIPKDDKTEKRGILNETQLKNLKNGKN |
| Ga0181584_107546621 | 3300017949 | Salt Marsh | MNKNDWLETLVKKYSLPKEDKKEKRGILSETQLKNLKNGKN |
| Ga0181584_108331172 | 3300017949 | Salt Marsh | MSKNKEDWLETLVKKYSIPKDDKTEKRGILNETQLKNLKNGKN |
| Ga0181607_100301903 | 3300017950 | Salt Marsh | MSKKEDWLETLVKKYSLPKGDKTEKRGILNETQLKNLKNGKN |
| Ga0181607_100594792 | 3300017950 | Salt Marsh | MSKKEDWLETLVKKYSIPKDDKTEKRGILNETQLKNLKNGKN |
| Ga0181607_103568812 | 3300017950 | Salt Marsh | MSKKEDWLETLVKKYSIPKEDKTEKRGILNETQLKNLKNGKN |
| Ga0181577_108457753 | 3300017951 | Salt Marsh | MSKEQDWLETLVKKYSLPKEDKTPKRGILSETQLKNLKNGKE |
| Ga0181580_104815901 | 3300017956 | Salt Marsh | MSKTKQDWLETLVKKYSLPKEEQKEKRGILSETQLKNLKNGKN |
| Ga0181571_100301376 | 3300017957 | Salt Marsh | MSKKQDWLETLVKKYSIPKEDKTEKRGILTETQLKNLKNGKS |
| Ga0181571_102016162 | 3300017957 | Salt Marsh | MSKKDDWLEKLVKNYSLPKEEGKKEKRGILSETQLKNLKNGKN |
| Ga0181571_105575573 | 3300017957 | Salt Marsh | MNKNDWLETLVKKYSLPKEDKKEKRGILSETQLNNLKNGKN |
| Ga0181581_103356292 | 3300017962 | Salt Marsh | MSKTKQDWLETLVKKYSLPKEDKKEKRGILSETQLKNLKNGKN |
| Ga0181589_105768261 | 3300017964 | Salt Marsh | KNKEDWLETLVKKYSIPKGDKTEKRGILNETQLKNLKNGKN |
| Ga0181590_103328522 | 3300017967 | Salt Marsh | MNKNNWLETLVKKYSLPKEDKKEKRGILSETQLKNLKNGKN |
| Ga0181590_105998912 | 3300017967 | Salt Marsh | MTNKKQDWLEQLVKNYSIPKEDKSEKRGILSETQLKNLKNGKN |
| Ga0181590_108776492 | 3300017967 | Salt Marsh | MNKENWLETLVKKYSLPKEDKKEKRGILSETQLKNLKNGKE |
| Ga0181585_109504452 | 3300017969 | Salt Marsh | MSKTDWLETLVKKYSLPKEDKTPKRGILSETQLKNLKNGKE |
| Ga0181576_107574083 | 3300017985 | Salt Marsh | SKKEDWLETLVKKYSIPKEDKTEKRGILTETQLKNLKNGKN |
| Ga0181576_108925772 | 3300017985 | Salt Marsh | MSDKKMSDWMERLVKKYSIPANDKSEKRGMLNETQLRNLKNGKK |
| Ga0181576_109138712 | 3300017985 | Salt Marsh | MSKKEDWLETLVKKYSIPKEDKTEKRGILTETQLKNLKNG |
| Ga0181569_102548803 | 3300017986 | Salt Marsh | MSKEQDWLEKLVKKYSIPTDDKTPKRGILSETQLKNLKNGKN |
| Ga0181569_103495311 | 3300017986 | Salt Marsh | QDWLETLVKKYSIPKGDKTEKRGILTETQLKNLKNGKS |
| Ga0181600_104338081 | 3300018036 | Salt Marsh | MSKKEDWLETLVKKYSIPKEDKTEKRGILNETQLKNL |
| Ga0181572_103113191 | 3300018049 | Salt Marsh | DWLETLVKKYSIPKGDKTEKRGILTETQLKNLKNGKS |
| Ga0181553_101199333 | 3300018416 | Salt Marsh | MSKKEDWLETLVKKYSIPKDDKTEKRGILNETQLKNLKNG |
| Ga0181553_101580732 | 3300018416 | Salt Marsh | MNKEKDWLERLVKNYQIPSEEKTQKRGLLSETQLKNLKNGKN |
| Ga0181553_101698191 | 3300018416 | Salt Marsh | SKKEDWLETLVKKYSIPKGDKTEKRGILNETQLKNLKNGKN |
| Ga0181558_100372791 | 3300018417 | Salt Marsh | MSKKEDWLETLVKKYSLPKEDKTEKRGILSETQLKNLKNGKN |
| Ga0181558_101155824 | 3300018417 | Salt Marsh | MSKKEDWLETLVKKYSIPKEDKSEKRGILSETQLKNLKDGKN |
| Ga0181567_105520392 | 3300018418 | Salt Marsh | MSKENWLETLVKKYSLPKEDKKEKRGILSETQLNNLKNGKN |
| Ga0181567_108224221 | 3300018418 | Salt Marsh | MNKKQDWLETLVKKYSIPKDDKTEKRGILNETQLKNLKNGKN |
| Ga0181563_105456222 | 3300018420 | Salt Marsh | MSKKEDWLETLEKKYSIPKEDKTEKRGILTETQLKNLKNGKS |
| Ga0181591_102257675 | 3300018424 | Salt Marsh | MTKMTNKKQDWLETLVKKYSIPKGDKTEKRGILTETQLKNLKNGKS |
| Ga0181591_104585941 | 3300018424 | Salt Marsh | MSKKEDWLETLVKKYSIPKEDKTEKRGILTETQLKN |
| Ga0181566_104369532 | 3300018426 | Salt Marsh | MSKKDDWLEQLVKNYSLPKEEGKKQKRGILSETQLKNLKNGKN |
| Ga0181566_107602252 | 3300018426 | Salt Marsh | MSDKKMSDWMERLVKKYSIPANDKSEKRGMLNETQLRNLKNGKN |
| Ga0181566_111116312 | 3300018426 | Salt Marsh | MSKEQDWLETLVKKYSLPKEDKKEKRGILSETQLKNLKDGKD |
| Ga0181568_100592733 | 3300018428 | Salt Marsh | MQHISKNVVSVINQTQNLKIKMSKEQDWLETLVKKYSLPKEDKKEKRGILSETQLKNLKDGKD |
| Ga0181568_103165483 | 3300018428 | Salt Marsh | MSKKEDWLETLVKKYSLPKEDKKEKRGILSETQLNNLKNGKN |
| Ga0181568_104261843 | 3300018428 | Salt Marsh | MNKNDWLETLVKKYSLPKENKKEKRGILSETQLKNLKNGKN |
| Ga0181564_107532402 | 3300018876 | Salt Marsh | MSKKEDWLETLVKKYSIPKDDKTEKRGILSETQLKNLKNGKN |
| Ga0181562_103664993 | 3300019459 | Salt Marsh | LQMSKNKEDWLETLVKKYSIPKGDKTEKRGILNETQLKNLKNGKN |
| Ga0181562_104508224 | 3300019459 | Salt Marsh | MSKKEDWLETLVKKYSIPKGDKTEKRGILNETQLKNLKNGKN |
| Ga0194024_10152114 | 3300019765 | Freshwater | MSEKKMSDWMERLVKKYSVPTNDKKEKRGILNEAQLNNLKNGKN |
| Ga0181575_100487995 | 3300020055 | Salt Marsh | MSKKEDWLETLVKKYSLPKENKKEKRGILSETQLKNLKNGKN |
| Ga0181575_104034403 | 3300020055 | Salt Marsh | MNKKQDWLETLVKKYSIPKGDKTEKRGILTETQLKNLKNGKS |
| Ga0206125_100024605 | 3300020165 | Seawater | MSKKEDWLEELVKKYSVPTNDKIEKRGILNESQLKNLKDGKN |
| Ga0206125_101086722 | 3300020165 | Seawater | MSKTKQDWLEELVKKYSIPTEEKTDKRGILNETQLKNLKNGKN |
| Ga0206129_101806451 | 3300020182 | Seawater | LEELVKKYSVPTNDKIEKRGILNESQLKNLKDGKN |
| Ga0206130_104358571 | 3300020187 | Seawater | MSKTKEDWLEELVKKYSIPTEETKEKRGVLNETQLKNLKNGKN |
| Ga0211658_10593003 | 3300020274 | Marine | MSKKQEWLETLVKKYSIPKEDKTEKRGILSETQLKNLKN |
| Ga0211658_11072012 | 3300020274 | Marine | MSETKMSDWMERLVKKYSVPTNETKKRGILSETQVKNLKDGKD |
| Ga0211658_11160282 | 3300020274 | Marine | MSEKKMSDWMERLVKKYSVPTDNKTEKRGILSETQLKNLKNGKD |
| Ga0211504_10270834 | 3300020347 | Marine | MANSKQDWLEELVKKYSIPTEEKTDKRGMLNETQLKNLKNGKS |
| Ga0211505_11347231 | 3300020352 | Marine | KXCNMSKSKQDWLEDLVKKYSIPTDDKTDKRGILNETQLKNLKNGKN |
| Ga0211689_11719521 | 3300020358 | Marine | SKQNEKWLEELVKKYSIPTEENKEKRGVLNETQLKNLKNGKN |
| Ga0211652_100913563 | 3300020379 | Marine | MSKTQDWLEELVKKYSIPTDDKTEKRGILNETQLKNLKNGKS |
| Ga0211652_102148072 | 3300020379 | Marine | MSKKQEWLETLVKKYSIPKEDKTEKRGILSETQLKNLKNGKN |
| Ga0211686_103657962 | 3300020382 | Marine | MSKENEKWLEQLVKKYSIPTEETNEKRGVLNETQLKNLKNGKN |
| Ga0211659_100375126 | 3300020404 | Marine | MSKKQDWLETLVKKYSLPKEDKTEKRGMLSETQLKNLKDGKDKKTT |
| Ga0211651_100279323 | 3300020408 | Marine | MSDWMERLVKKYSVPTNETKKRGILSETQVKNLKDGKD |
| Ga0211651_100510713 | 3300020408 | Marine | MSKKEDWLETLVKKYSLPKEEQKEKRGILSETQLKNLKQGKSN |
| Ga0211523_104357023 | 3300020414 | Marine | NMSKTDWLETLVKKYSLPKEEKKEKRGILSETQLKNLKNGKN |
| Ga0211576_100366803 | 3300020438 | Marine | MSKTKEDWLQELVKKYSIPTDDKTEKRGILSETQMKNLKNGKN |
| Ga0211576_100701692 | 3300020438 | Marine | MAKTKQEEWLHELVKKYSIPTNDNTDKRGILNETQLKNLKNGKN |
| Ga0211558_100712974 | 3300020439 | Marine | MSKENWLETLVKKYSLPKEEQKEKRGILSETQLKNLKNGKN |
| Ga0211558_100755394 | 3300020439 | Marine | MSKKEDWLETLVKKYSLPKEDKKEKRGILSETQLKNLKNGKN |
| Ga0211558_102358383 | 3300020439 | Marine | MSKTDWLETLVKKYSLPKEEKKEKRGILSETQLKNLKNGKN |
| Ga0211641_105778132 | 3300020450 | Marine | MSETKMSDWMERLIKKYSVPTNETKKRGILNEAQVKNLKDGKE |
| Ga0211577_104660133 | 3300020469 | Marine | MANKREEWLHELVKKYSIPTEEKTDKRGILNETQLKNLKNGKN |
| Ga0211547_101023614 | 3300020474 | Marine | MSDWMERLVKKYSVPTNEKTQKRGILNESQLKNLKDGKS |
| Ga0206126_102734861 | 3300020595 | Seawater | MSKQKQDWLEELVKKYSIPTEEKTDKRGMLNETQLKNLKD |
| Ga0206677_1000178020 | 3300021085 | Seawater | MSKTKQDWLEELVKKYSIPTEEKSDKRGILNETQLKNLKDGKN |
| Ga0206677_1000420420 | 3300021085 | Seawater | MANKKEDWLETLVKKYSIPTEEKTDKRGILNESQLKNLKDGKN |
| Ga0206677_100129262 | 3300021085 | Seawater | MSKTKQDWLEELVKKYSIPTEEKSDKRGILNETQLKNLKNGKN |
| Ga0206677_100240033 | 3300021085 | Seawater | MSKTQDWLEELVKKYSIPTNDKTEKRGILNETQLKNLKNGKS |
| Ga0206677_100250056 | 3300021085 | Seawater | MANSKEDWLEELVKKYSIPTEEKTDKRGMLNETQLKNLKDGKN |
| Ga0206677_100976694 | 3300021085 | Seawater | MSKTQDWLETLVKKYSIPKGDKTKKRGILSETQMKNLKNGKN |
| Ga0213867_100003237 | 3300021335 | Seawater | MSKTKQDWLETLVKKYSLPKEEQKEKRGILSETQLKNLKNGKS |
| Ga0213858_100141646 | 3300021356 | Seawater | MKKNDWLETLVKKYSLPKEDKKEKRGILSETQLKNLKNGKN |
| Ga0213858_100834844 | 3300021356 | Seawater | MNKNDWLETLVKKYSIPKEDKKEKRGILSETQLKNLKNGKN |
| Ga0213858_101462223 | 3300021356 | Seawater | MNKKEDWLETLVKKYSLPKEEQKEKRGILSETQLKNLKNGKN |
| Ga0213859_100124956 | 3300021364 | Seawater | MSKTKQDWLEELVKKYSIPTDDKTEKRGILNETQLKNLKNGKN |
| Ga0213859_100475843 | 3300021364 | Seawater | MSKKEDWLETLVKKYSIPKGDKTEKRGILTETQLKNLKNGKS |
| Ga0206123_101590252 | 3300021365 | Seawater | MSKQKQDWLEELVKKYSIPTEEKTDKRGMLNETQLKNLKNGKN |
| Ga0213860_100044395 | 3300021368 | Seawater | MDKKNWLETLVKKYSLPKDDKTDKRGILSETQLKNLKNGKS |
| Ga0213869_1000009081 | 3300021375 | Seawater | MSKTKQDWLEELVKKYSIPTEEKPDKRGMLNETQLKNLKDGKN |
| Ga0213869_100085638 | 3300021375 | Seawater | MSDWMERLVKKYSVPTNDTTDKRGMLNETQLNNLRNGKDKKTT |
| Ga0213869_100300614 | 3300021375 | Seawater | MANKTEDWLEELVKKYSIPTEEKTDKRGMLNETQLKNLKNGKN |
| Ga0213864_103815682 | 3300021379 | Seawater | MSKNKEDWLETLVKKYSLPKEDKSEKRGILSETQLKNLKDGKN |
| Ga0222717_10000083134 | 3300021957 | Estuarine Water | MSKNKEDWLEELVKKYSIPTDDKTEKRGILSETQMKNLKDGKN |
| Ga0222717_100110048 | 3300021957 | Estuarine Water | MANKKEDWLETLVKEYSIPTEEKTDKRGILNESQLKNLKDGKN |
| Ga0222717_100430522 | 3300021957 | Estuarine Water | MSKTKQDWLEELVKKYSIPTDDKSEKRGMLSETQMKNLKNGKN |
| Ga0222717_101168452 | 3300021957 | Estuarine Water | MSKTKQAWLENLVKKYSIPADDKTDKRGMLNETQLNNLKNGKN |
| Ga0222718_1000734510 | 3300021958 | Estuarine Water | MSKTQDWLETLVKKYSIPKGDKTEKRGILSETQMKNLKNGKN |
| Ga0222718_102020084 | 3300021958 | Estuarine Water | QEEWLHELVKKYSIPTNDNTDKRGILNETQLKNLKNGKN |
| Ga0222716_1000117610 | 3300021959 | Estuarine Water | MSKENDWLEKLVKKYSLPKGDKSEKRGILSETQLKNLKNGKD |
| Ga0222716_107557461 | 3300021959 | Estuarine Water | MSKKEDWLETLVKKYSIPKEDKSEKRGILSETQLKNLKNGKS |
| Ga0222715_104842213 | 3300021960 | Estuarine Water | MSRQNDWLEKLVKNYSLPKEEGKKEKRGILNETQLKNLKNGKT |
| Ga0222714_101260425 | 3300021961 | Estuarine Water | MSKTKEDWLEKLVKNYSLPKPETKKEKRGILSETQLKNLKNGKS |
| Ga0222714_105898723 | 3300021961 | Estuarine Water | MSKEQDWLEKLVKKYSLPKGDKSEKRGILSETQLKNLKNGKD |
| Ga0222719_101810774 | 3300021964 | Estuarine Water | MSKKEDWLETLVKKYSLPKDDKTEKRGILNETQLKNLKNGKN |
| Ga0222719_102078855 | 3300021964 | Estuarine Water | MSKNKEDWLETLVKKYSLPKEDKTEKRGILNETQLKNLKNGKN |
| Ga0222719_104680504 | 3300021964 | Estuarine Water | MSKNKEDWLEELVKKYSIPADDKTEKRGILNETQLKNLKNGKN |
| Ga0222719_108179482 | 3300021964 | Estuarine Water | MSKQDDWLEKLVKNYSLPKEEGKKEKRGLLSETQLKNLKNGKN |
| (restricted) Ga0233426_100084152 | 3300022920 | Seawater | MANSTEDWLEELVKKYSIPTEETKEKRGVLNETQLINLKNGKN |
| (restricted) Ga0233426_101533433 | 3300022920 | Seawater | MANKKEDWLETLVKKYSIPTEEKTDKRGILNESQLKNLKNGKS |
| (restricted) Ga0233426_102781752 | 3300022920 | Seawater | MSKTKQDWLEELVKKYSIPTEEKTDKRGILNESQLNNLKNGKN |
| Ga0255765_11908481 | 3300022921 | Salt Marsh | WLETLVKKYSIPKEDKTEKRGILNETQLKNLKNGKN |
| Ga0255773_101798633 | 3300022925 | Salt Marsh | KLIMSKKEDWLETLVKKYSIPKEDKTEKRGILTETQLKNLKNGKS |
| Ga0255769_101370591 | 3300022927 | Salt Marsh | DWLETLVKKYSLPKGDKTEKRGILNETQLKNLKNGKN |
| Ga0255764_102096993 | 3300023081 | Salt Marsh | QTMSKNKEDWLETLVKKYSIPKGDKTEKRGILNETQLKNLKNGKN |
| Ga0255764_102989171 | 3300023081 | Salt Marsh | MSKNKEDWLETLVKKYSLPKGDKTEKRGILNETQLKNLKNGKN |
| Ga0255778_101664586 | 3300023084 | Salt Marsh | MSKNKEDWLETLVKKYSIPKEDKSEKRGILSETQLKNL |
| Ga0255774_100784975 | 3300023087 | Salt Marsh | KKDDWLEQLVKNYSLPKEEGKKEKRGILSETQLKNLKNGKN |
| Ga0255743_101437491 | 3300023110 | Salt Marsh | LEKLVKKYSIPTDDKTPKRGILSETQLKNLKNGKN |
| Ga0255743_104156221 | 3300023110 | Salt Marsh | NKNDWLETLVKKYSLPKEDKKEKRGILSETQLKNLKNGKN |
| Ga0255751_101401004 | 3300023116 | Salt Marsh | MREKKMSDWMERLVKKYSVPTNDKKEKRGILNETQLNNLKNGKN |
| Ga0255751_104660701 | 3300023116 | Salt Marsh | EDWLETLVKKYSIPKGDKTEKRGILNETQLKNLKNGKN |
| Ga0255762_102566313 | 3300023119 | Salt Marsh | KKQDWLETLVKKYSIPKGDKTEKRGILTETQLKNLKNGKS |
| Ga0255766_102268201 | 3300023172 | Salt Marsh | WMERLVKKYSVPTNDKKEKRGILNETQLNNLKNGKN |
| Ga0255772_1001550014 | 3300023176 | Salt Marsh | LETLVKKYSLPKENKKEKRGILSETQLKNLKNGKN |
| Ga0255772_101073891 | 3300023176 | Salt Marsh | MSKKEDWLETLVKKYSIPKEDKTEKRGILTKTQLKNL |
| Ga0255772_103922161 | 3300023176 | Salt Marsh | KEDWLETLVKKYSIPKDDKTEKRGILNETQLKNLKNGKN |
| Ga0255759_100616911 | 3300023178 | Salt Marsh | NQTQNLKIKMSKEQDWLETLVKKYSLPKEDKKEKRGILSETQLKNLKDGKD |
| Ga0228636_11244931 | 3300024191 | Seawater | HKXCNMAKTKQEEWLHELVKKYSIPTNDNTDKRGILNETQLKNLKNGKN |
| Ga0228673_10780613 | 3300024242 | Seawater | KEDWLETLVKKYSIPTEEKTDKRGILNESQLKNLKDGKN |
| (restricted) Ga0233438_100368112 | 3300024255 | Seawater | MSKQKQEWLHELVKNYSIPTEEKPNKRGVLNETQLNNLKNGKN |
| (restricted) Ga0233438_100620537 | 3300024255 | Seawater | MANKTDDWLEELVKKYSIPTEETKEKRGVLNETQLINLKNGKN |
| (restricted) Ga0233444_100881946 | 3300024264 | Seawater | MSKQKQEWLHELVKNYSIPTEEKTNKRGVLNETQLNNLKNGKN |
| (restricted) Ga0233444_101241912 | 3300024264 | Seawater | MAKTKQEEWLHELVKKYSIPTNDSTDKRGMLNETQLKNLKNGKN |
| Ga0233451_101639774 | 3300024301 | Salt Marsh | MSEKKMSDWMERLVKKYSVPTNDKKEKRGILNETQLNNLKNGKN |
| Ga0228659_10941371 | 3300024332 | Seawater | MSKTKEDWLQELVKKYSIPTDDKTEKRGILSETQMKNLK |
| Ga0244775_1000174622 | 3300024346 | Estuarine | MSKDKDWLERLVKNYQIPSEEKTQKRGLLSETQLKNLKNGKN |
| Ga0244776_101308072 | 3300024348 | Estuarine | MANKTEDWLEQLVKKYSIPTQEKTDKRGILNESQLNNLKNGKN |
| Ga0233396_11467482 | 3300024428 | Seawater | MSKTKQDWLEELVKKYSIPTEEKTDKRGMLNETQLKNLKDGKN |
| Ga0208667_10136273 | 3300025070 | Marine | MSKTKEDWLQELVKKYSIPTDDKTEKRGILSETQMKNLKDGKN |
| Ga0208791_10193922 | 3300025083 | Marine | MANSKQDWLEELVKKYSIPTKEKTDKRGMLNETQLKNLKNGKS |
| Ga0208298_10047576 | 3300025084 | Marine | MSKTKQDWLEDLVKKYSIPTDDKTDKRGILNETQLKNLKNGKN |
| Ga0208157_10481023 | 3300025086 | Marine | MSETKMSDWMERLVKKYSVPTNETKKRGILSESQVKNLKDGKD |
| Ga0208666_10261122 | 3300025102 | Marine | MSDWMERLVKKYSVPTNETKKRGILSESQVKNLKDGKD |
| Ga0209336_100140322 | 3300025137 | Marine | MAKTKQEEWLHELVKKYSIPTNDKTDKRGILNETQLKNLKNGKN |
| Ga0209336_100365322 | 3300025137 | Marine | MSETKMSDWMERLVKKYSVPTNDTTDKRGMLNETQLKNLRNGKDKKTT |
| Ga0209634_100356117 | 3300025138 | Marine | MANNTQDWLEQLVKKYSIPTEETNEKRGVLNETQLKNLKNGKN |
| Ga0209634_10142211 | 3300025138 | Marine | EEWLHELVKKYSIPTNDNTDKRGMLNETQLKNLKNGKN |
| Ga0209634_11626763 | 3300025138 | Marine | MANNTQDWLEQLVKKYSIPTEETNEKRGVLNESQLKNLKDGKS |
| Ga0209634_12075783 | 3300025138 | Marine | MANSTEDWLEELVKKYSIPTEEIKEKRGVLNETQLNNLKNGKN |
| Ga0209645_11415312 | 3300025151 | Marine | MSDWMERLVKKYSVPTDNKTEKRGILSETQLKNLKNGKN |
| Ga0209654_10213294 | 3300025608 | Marine | MSKNKEDWLEELVKKYSIPTNDKTEKRGILNETQLKNLKNGKE |
| Ga0209136_10069373 | 3300025636 | Marine | MSKQDEWLEKLVKNYSIPSEEKKEKRGVLNEEQLKNLKNGKN |
| Ga0209136_10377506 | 3300025636 | Marine | MSKQDEWLEKLVKNYSIPTEDKKEKRGVLNEEQLKNLKNGKN |
| Ga0209659_11665693 | 3300025658 | Marine | MANKKEDWLETLVKKYSIPTEEKTDKRGILNESQLKN |
| Ga0209652_100235123 | 3300025684 | Marine | MNKQDQWLDRLVRNYSIPTEEKKEKRGVLNEEQLKNLKNGKN |
| Ga0209505_11071773 | 3300025690 | Pelagic Marine | MSKTKQDWLEELVKKYSIPTEEKTDKRGMLNETQLKNLKNGKN |
| Ga0209653_100184321 | 3300025695 | Marine | MSKKEDWLETLVKKYSIPKEDKTEKRGILSETQLKNLKNGKS |
| Ga0209653_11269053 | 3300025695 | Marine | WLERLVKNYSIPSEEKKEKRGVLNEEQLKNLKNGKN |
| Ga0209653_11725071 | 3300025695 | Marine | MNKQDQWLERLVKNYSIPSEEKKEKRGVLNEEQLKNLKNGKN |
| Ga0209532_10378782 | 3300025696 | Pelagic Marine | MANNTEDWLEELVKKYSIPTEETKEKRGVLNETQLNNLKNGKN |
| Ga0209715_10471323 | 3300025699 | Pelagic Marine | MSKTKQDWLEELVKKYSIPTEEKTDKRGMLNETQL |
| Ga0209602_10824464 | 3300025704 | Pelagic Marine | LEELVKKYSIPTEEKTDKRGMLNETQLKNLKNGKN |
| Ga0209374_11586813 | 3300025705 | Marine | MANSTEDWLEELVKKYSIPTEEKTDKRGILNESQLNNLKNGKN |
| Ga0209305_11340421 | 3300025712 | Pelagic Marine | MSKQKQDWLEELVKKYSIPTEEKTDKRGMLNETQLK |
| Ga0209137_10748081 | 3300025767 | Marine | MNKQDEWLERLVKNYSIPSEEKKEKRGVLNEEQLK |
| Ga0209199_11762731 | 3300025809 | Pelagic Marine | LKXCNMSKTKQDWLEELVKKYSIPTEEKTDKRGILNETQLKNLKNGKN |
| Ga0209199_12637441 | 3300025809 | Pelagic Marine | QKQDWLEELVKKYSIPTEEKTDKRGMLNETQLKNLKDGKN |
| Ga0209714_11853052 | 3300025822 | Pelagic Marine | MSKTKQDWLEELVKKYSIPTEEKTDKRGILNETQLKNLKNGK |
| Ga0209666_13991111 | 3300025870 | Marine | NSTEDWLEELVKKYSIPTEETKEKRGVLNETQLINLKNGKN |
| Ga0209555_100262362 | 3300025879 | Marine | MNKQDQWLERLVRNYSIPSEEKKEKRGVLNEEQLKNLKNGKS |
| Ga0209555_102758723 | 3300025879 | Marine | MSKQDEWLEKLVKNYSIPTEDNKEKRGVLNEEQLKNLKNGKN |
| Ga0209630_100870401 | 3300025892 | Pelagic Marine | MSKQKQDWLEELVKKYSIPTEEKTDKRGMLNETQLKNLKNGK |
| Ga0209953_10007748 | 3300026097 | Pond Water | MSREKEWLEELVKKYSIPKNDKTEKRGILNETQLKNLKNGKN |
| Ga0209953_10009224 | 3300026097 | Pond Water | MGKEDEWLEQLVKKYSLPKQEGKREKRGILSETQLKNIKNGKN |
| Ga0209953_10016909 | 3300026097 | Pond Water | MSKKDDWLEQLVRNYSLPKEEGKKEKRGILSETQLKNLKNGKN |
| Ga0209951_10896492 | 3300026138 | Pond Water | MNKENWLETLVKKYSLPKEDKKEKRGILSETQLKNLKNGKN |
| Ga0247599_10152001 | 3300026470 | Seawater | LHELVKKYSIPTNDNTDKRGILNETQLKNLKNGKN |
| Ga0208972_10560581 | 3300027280 | Marine | KQAWLENLVKKYSIPADDKTDKRGMLNETQLNNLKNGKN |
| Ga0209384_10460413 | 3300027522 | Marine | MSKTQEDWLEELVSKYSIPANDKEITDKRGMLSENQLKNLSNGKS |
| Ga0209482_100728011 | 3300027668 | Marine | MSDWMERLVKKYSVPVNTETDRRGILNESQVKNLKDGKS |
| Ga0209192_102200743 | 3300027752 | Marine | MANKAEDWLEELVKKYSIPTEETNEKRGVLNEAQLNNLKN |
| Ga0209709_1000217021 | 3300027779 | Marine | MNKTTEDWLIELVRKYSIPSNDTEEKEKRGMLSETQLKNLSNGKN |
| Ga0209709_100190819 | 3300027779 | Marine | MIKTKEEWLIELVRKYSIPTNDITEKRGILSETQLKNLNNGKS |
| Ga0209090_100134879 | 3300027813 | Marine | MNKTTEDWLIELVRKYSIPPNDTEEKEKRGMLSETQLKNLSNGKN |
| Ga0209702_100177386 | 3300027976 | Freshwater | MSRQNEWLEELVKKYSIPTNDKTEKRGILNETQLKNLKDGKE |
| Ga0228674_12270871 | 3300028008 | Seawater | MSKTKQDWLEELVKKYSIPTEEKSDKRGILNETQLKN |
| Ga0233397_10759791 | 3300028111 | Seawater | EEWLHELVKKYSIPTNDNTDKRGILNETQLKNLKNGKN |
| Ga0233450_102776713 | 3300028115 | Salt Marsh | MNEKKMSDWMERLVKKYSVPTNDKKEKRGILNETQLNNLKNGKN |
| Ga0228608_12106493 | 3300028136 | Seawater | KNDWLETLVKKYSLPKEQQKEKRGILSETQLKNLKNGKS |
| Ga0257114_13113803 | 3300028196 | Marine | STEDWLEELVKKYSIPTEETKEKRGVLNETQLINLKNGKN |
| Ga0257110_100033431 | 3300028197 | Marine | MSDWMERLVKKYSVPTNDTTDKRGMLNETQLKNLRNGKDKKTT |
| Ga0257110_10525652 | 3300028197 | Marine | MAKTKQEEWLHELVKKYSIPTNDNTDKRGMLNETQLKNLKNGKN |
| Ga0228640_10550013 | 3300028273 | Seawater | MANKKEDWLETLVKKYSIPTEEKTDKRGMLNETQLKNLKDGKN |
| Ga0257126_12272161 | 3300028287 | Marine | MANKKEDWLETLVKKYSIPTEEKTDKRGILNESQLNNLKNGKN |
| Ga0185543_10053044 | 3300029318 | Marine | MSKTDWLETLVKKYSLPKEEKKEKRGILSETQLKNLKNGKD |
| Ga0308024_10038819 | 3300031140 | Marine | MSKTTEDWLEELVGKYSIPSDDTEVKDKRGMLSENQLKNLSNGKS |
| Ga0308022_10909391 | 3300031142 | Marine | MSEKKMSDWMERLVKKYSVPVNTETDRRGILNESQVKNLKDGKS |
| Ga0308025_11590971 | 3300031143 | Marine | MSKTKEDWLEELVGKYSIPSDDTEVKDKRGMLSENQ |
| Ga0308025_12781982 | 3300031143 | Marine | MSKENEKWLEQLVKKYSIPTEENKVKRGVLNETQLKNLKNGKN |
| Ga0308023_10044772 | 3300031167 | Marine | MSKTKEDWLEELVGKYSIPSDDTEVKDKRGMLSENQLKNLSNGKS |
| Ga0308023_10912161 | 3300031167 | Marine | MSKTTEDWLEELVGKYSIPSDDTEVKDKRGMLSENQLKNLSNGK |
| Ga0307488_100172796 | 3300031519 | Sackhole Brine | MANNTEDWLEELVKKYSIPTEEIKEKRGVLNETQLNNLKNGKN |
| Ga0307488_100569317 | 3300031519 | Sackhole Brine | MAKTKQEEWLHELVKKYSIPTNDKTDKRGMLNETQLKNLKNGKN |
| Ga0307488_104201553 | 3300031519 | Sackhole Brine | MANKKEDWLEQLVKKYSIPTEETNEKRGVLNETQLNNLKNGKN |
| Ga0307488_105286172 | 3300031519 | Sackhole Brine | MSKTTEDWLEELVKKYSIPTEETKEKRGVLNEAQLKNLQNGKN |
| Ga0307993_11627481 | 3300031602 | Marine | MSKTKEDWLEELVGKYSIPSDDTEVKDKRGMLSENQLKNLSN |
| Ga0307985_103771082 | 3300031629 | Marine | MSKTTEDWLEELVGKYSIPSDDTEVKDKRGMLSENQLKN |
| Ga0308004_102816863 | 3300031630 | Marine | LEELVGKYSIPSDDTEVKDKRGMLSENQLKNLSNGKS |
| Ga0308001_100568695 | 3300031644 | Marine | KTINMSKTQEDWLEELVSKYSIPANDKEITDKRGMLSENQLKNLSNGKS |
| Ga0308003_10391641 | 3300031705 | Marine | DWLEELVSKYSIPANDKEITDKRGMLSENQLKNLSNGKS |
| Ga0315322_103614401 | 3300031766 | Seawater | KTQDWLETLVKKYSIPKGDKTKKRGILSETQMKNLKNGKN |
| Ga0308000_102165563 | 3300031848 | Marine | EELVSKYSIPANDKEITDKRGMLSENQLKNLSNGKS |
| Ga0310130_0127707_277_405 | 3300034073 | Fracking Water | MSKEKDWLERLVKNYQIPSEEKPQKRGLLSETQLKNLKNGKN |
| ⦗Top⦘ |