


| Basic Information | |
|---|---|
| Family ID | F005999 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 384 |
| Average Sequence Length | 47 residues |
| Representative Sequence | MMRLLRPPHSGIFLRSFRLHSAHYARETIAKICSLWVALATAIISQTGS |
| Number of Associated Samples | 197 |
| Number of Associated Scaffolds | 383 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 66.49 % |
| % of genes near scaffold ends (potentially truncated) | 60.68 % |
| % of genes from short scaffolds (< 2000 bps) | 70.31 % |
| Associated GOLD sequencing projects | 161 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.42 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (72.396 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (32.292 % of family members) |
| Environment Ontology (ENVO) | Unclassified (51.823 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (53.385 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 48.05% β-sheet: 0.00% Coil/Unstructured: 51.95% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.42 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 383 Family Scaffolds |
|---|---|---|
| PF00005 | ABC_tran | 1.57 |
| PF04264 | YceI | 1.31 |
| PF04354 | ZipA_C | 1.04 |
| PF00903 | Glyoxalase | 1.04 |
| PF13511 | DUF4124 | 1.04 |
| PF00106 | adh_short | 1.04 |
| PF01725 | Ham1p_like | 1.04 |
| PF01197 | Ribosomal_L31 | 1.04 |
| PF00873 | ACR_tran | 1.04 |
| PF02518 | HATPase_c | 0.78 |
| PF00561 | Abhydrolase_1 | 0.78 |
| PF08281 | Sigma70_r4_2 | 0.78 |
| PF02541 | Ppx-GppA | 0.78 |
| PF00406 | ADK | 0.78 |
| PF00293 | NUDIX | 0.78 |
| PF06580 | His_kinase | 0.78 |
| PF01966 | HD | 0.78 |
| PF00848 | Ring_hydroxyl_A | 0.78 |
| PF02826 | 2-Hacid_dh_C | 0.78 |
| PF04279 | IspA | 0.78 |
| PF00575 | S1 | 0.78 |
| PF03466 | LysR_substrate | 0.78 |
| PF00579 | tRNA-synt_1b | 0.52 |
| PF01343 | Peptidase_S49 | 0.52 |
| PF13412 | HTH_24 | 0.52 |
| PF00578 | AhpC-TSA | 0.52 |
| PF03054 | tRNA_Me_trans | 0.52 |
| PF04337 | DUF480 | 0.52 |
| PF12779 | WXXGXW | 0.52 |
| PF02397 | Bac_transf | 0.52 |
| PF01040 | UbiA | 0.52 |
| PF08388 | GIIM | 0.52 |
| PF01479 | S4 | 0.52 |
| PF00285 | Citrate_synt | 0.52 |
| PF03741 | TerC | 0.52 |
| PF00210 | Ferritin | 0.52 |
| PF00484 | Pro_CA | 0.52 |
| PF01568 | Molydop_binding | 0.52 |
| PF12627 | PolyA_pol_RNAbd | 0.52 |
| PF01168 | Ala_racemase_N | 0.52 |
| PF01546 | Peptidase_M20 | 0.52 |
| PF00486 | Trans_reg_C | 0.52 |
| PF00043 | GST_C | 0.52 |
| PF01694 | Rhomboid | 0.52 |
| PF13401 | AAA_22 | 0.52 |
| PF11390 | FdsD | 0.52 |
| PF04340 | DUF484 | 0.52 |
| PF00355 | Rieske | 0.52 |
| PF01467 | CTP_transf_like | 0.52 |
| PF03588 | Leu_Phe_trans | 0.52 |
| PF04519 | Bactofilin | 0.52 |
| PF07726 | AAA_3 | 0.52 |
| PF03880 | DbpA | 0.52 |
| PF12833 | HTH_18 | 0.52 |
| PF00543 | P-II | 0.52 |
| PF08482 | HrpB_C | 0.52 |
| PF07715 | Plug | 0.52 |
| PF02798 | GST_N | 0.52 |
| PF08534 | Redoxin | 0.52 |
| PF06253 | MTTB | 0.52 |
| PF14759 | Reductase_C | 0.52 |
| PF13419 | HAD_2 | 0.52 |
| PF02627 | CMD | 0.26 |
| PF00582 | Usp | 0.26 |
| PF00196 | GerE | 0.26 |
| PF01063 | Aminotran_4 | 0.26 |
| PF13241 | NAD_binding_7 | 0.26 |
| PF13561 | adh_short_C2 | 0.26 |
| PF01979 | Amidohydro_1 | 0.26 |
| PF14492 | EFG_III | 0.26 |
| PF00108 | Thiolase_N | 0.26 |
| PF03461 | TRCF | 0.26 |
| PF01019 | G_glu_transpept | 0.26 |
| PF10101 | DUF2339 | 0.26 |
| PF13660 | DUF4147 | 0.26 |
| PF02709 | Glyco_transf_7C | 0.26 |
| PF16658 | RF3_C | 0.26 |
| PF04403 | PqiA | 0.26 |
| PF07075 | DUF1343 | 0.26 |
| PF01494 | FAD_binding_3 | 0.26 |
| PF01556 | DnaJ_C | 0.26 |
| PF02371 | Transposase_20 | 0.26 |
| PF00970 | FAD_binding_6 | 0.26 |
| PF13604 | AAA_30 | 0.26 |
| PF01782 | RimM | 0.26 |
| PF01795 | Methyltransf_5 | 0.26 |
| PF01740 | STAS | 0.26 |
| PF01471 | PG_binding_1 | 0.26 |
| PF00128 | Alpha-amylase | 0.26 |
| PF04023 | FeoA | 0.26 |
| PF00067 | p450 | 0.26 |
| PF01161 | PBP | 0.26 |
| PF07277 | SapC | 0.26 |
| PF12826 | HHH_2 | 0.26 |
| PF00004 | AAA | 0.26 |
| PF12900 | Pyridox_ox_2 | 0.26 |
| PF04241 | DUF423 | 0.26 |
| PF04909 | Amidohydro_2 | 0.26 |
| PF00691 | OmpA | 0.26 |
| PF01012 | ETF | 0.26 |
| PF00348 | polyprenyl_synt | 0.26 |
| PF02133 | Transp_cyt_pur | 0.26 |
| PF05036 | SPOR | 0.26 |
| PF01553 | Acyltransferase | 0.26 |
| PF02629 | CoA_binding | 0.26 |
| PF13290 | CHB_HEX_C_1 | 0.26 |
| PF13417 | GST_N_3 | 0.26 |
| PF06853 | DUF1249 | 0.26 |
| PF00291 | PALP | 0.26 |
| PF01266 | DAO | 0.26 |
| PF13977 | TetR_C_6 | 0.26 |
| PF01370 | Epimerase | 0.26 |
| PF00929 | RNase_T | 0.26 |
| PF01145 | Band_7 | 0.26 |
| PF01869 | BcrAD_BadFG | 0.26 |
| PF00772 | DnaB | 0.26 |
| PF04055 | Radical_SAM | 0.26 |
| PF01641 | SelR | 0.26 |
| PF00902 | TatC | 0.26 |
| PF13387 | DUF4105 | 0.26 |
| PF09976 | TPR_21 | 0.26 |
| PF03544 | TonB_C | 0.26 |
| PF07722 | Peptidase_C26 | 0.26 |
| PF09500 | YiiD_C | 0.26 |
| PF02463 | SMC_N | 0.26 |
| PF00453 | Ribosomal_L20 | 0.26 |
| PF02537 | CRCB | 0.26 |
| PF00209 | SNF | 0.26 |
| PF01258 | zf-dskA_traR | 0.26 |
| PF01128 | IspD | 0.26 |
| PF00324 | AA_permease | 0.26 |
| PF03840 | SecG | 0.26 |
| PF02975 | Me-amine-dh_L | 0.26 |
| PF05345 | He_PIG | 0.26 |
| PF04262 | Glu_cys_ligase | 0.26 |
| PF11946 | DUF3463 | 0.26 |
| PF12697 | Abhydrolase_6 | 0.26 |
| PF08530 | PepX_C | 0.26 |
| PF12867 | DinB_2 | 0.26 |
| PF02254 | TrkA_N | 0.26 |
| PF02653 | BPD_transp_2 | 0.26 |
| PF05685 | Uma2 | 0.26 |
| PF10417 | 1-cysPrx_C | 0.26 |
| PF07977 | FabA | 0.26 |
| PF04011 | LemA | 0.26 |
| PF13645 | YkuD_2 | 0.26 |
| PF13727 | CoA_binding_3 | 0.26 |
| PF01541 | GIY-YIG | 0.26 |
| PF02737 | 3HCDH_N | 0.26 |
| PF05362 | Lon_C | 0.26 |
| PF05977 | MFS_3 | 0.26 |
| PF02965 | Met_synt_B12 | 0.26 |
| PF02424 | ApbE | 0.26 |
| PF16881 | LIAS_N | 0.26 |
| PF07992 | Pyr_redox_2 | 0.26 |
| PF06831 | H2TH | 0.26 |
| PF04168 | Alpha-E | 0.26 |
| PF01963 | TraB_PrgY_gumN | 0.26 |
| PF00982 | Glyco_transf_20 | 0.26 |
| PF05199 | GMC_oxred_C | 0.26 |
| PF00230 | MIP | 0.26 |
| PF08442 | ATP-grasp_2 | 0.26 |
| PF05088 | Bac_GDH | 0.26 |
| PF13279 | 4HBT_2 | 0.26 |
| PF00479 | G6PD_N | 0.26 |
| PF16344 | DUF4974 | 0.26 |
| PF00528 | BPD_transp_1 | 0.26 |
| PF00749 | tRNA-synt_1c | 0.26 |
| PF00464 | SHMT | 0.26 |
| PF01011 | PQQ | 0.26 |
| PF01381 | HTH_3 | 0.26 |
| PF01712 | dNK | 0.26 |
| PF13176 | TPR_7 | 0.26 |
| PF01757 | Acyl_transf_3 | 0.26 |
| PF14574 | RACo_C_ter | 0.26 |
| PF05195 | AMP_N | 0.26 |
| PF02274 | ADI | 0.26 |
| PF10150 | RNase_E_G | 0.26 |
| PF01176 | eIF-1a | 0.26 |
| PF00768 | Peptidase_S11 | 0.26 |
| PF12911 | OppC_N | 0.26 |
| PF03938 | OmpH | 0.26 |
| PF06980 | DUF1302 | 0.26 |
| PF00121 | TIM | 0.26 |
| PF00218 | IGPS | 0.26 |
| PF07690 | MFS_1 | 0.26 |
| PF07883 | Cupin_2 | 0.26 |
| PF13343 | SBP_bac_6 | 0.26 |
| PF08673 | RsbU_N | 0.26 |
| PF13537 | GATase_7 | 0.26 |
| PF00326 | Peptidase_S9 | 0.26 |
| PF00126 | HTH_1 | 0.26 |
| PF03641 | Lysine_decarbox | 0.26 |
| PF07732 | Cu-oxidase_3 | 0.26 |
| PF13506 | Glyco_transf_21 | 0.26 |
| PF00577 | Usher | 0.26 |
| PF03061 | 4HBT | 0.26 |
| PF00033 | Cytochrome_B | 0.26 |
| PF00478 | IMPDH | 0.26 |
| PF00581 | Rhodanese | 0.26 |
| PF00034 | Cytochrom_C | 0.26 |
| PF06418 | CTP_synth_N | 0.26 |
| PF00732 | GMC_oxred_N | 0.26 |
| PF01042 | Ribonuc_L-PSP | 0.26 |
| PF00152 | tRNA-synt_2 | 0.26 |
| PF00266 | Aminotran_5 | 0.26 |
| PF06537 | DHOR | 0.26 |
| PF00589 | Phage_integrase | 0.26 |
| PF00656 | Peptidase_C14 | 0.26 |
| PF06052 | 3-HAO | 0.26 |
| PF12626 | PolyA_pol_arg_C | 0.26 |
| PF01904 | DUF72 | 0.26 |
| PF14748 | P5CR_dimer | 0.26 |
| PF00701 | DHDPS | 0.26 |
| PF00809 | Pterin_bind | 0.26 |
| PF02517 | Rce1-like | 0.26 |
| PF07676 | PD40 | 0.26 |
| PF02590 | SPOUT_MTase | 0.26 |
| PF00593 | TonB_dep_Rec | 0.26 |
| PF02896 | PEP-utilizers_C | 0.26 |
| PF00694 | Aconitase_C | 0.26 |
| PF05957 | DUF883 | 0.26 |
| PF00069 | Pkinase | 0.26 |
| PF00590 | TP_methylase | 0.26 |
| PF00202 | Aminotran_3 | 0.26 |
| PF01103 | Omp85 | 0.26 |
| PF05960 | DUF885 | 0.26 |
| PF02913 | FAD-oxidase_C | 0.26 |
| PF01182 | Glucosamine_iso | 0.26 |
| PF01583 | APS_kinase | 0.26 |
| PF13365 | Trypsin_2 | 0.26 |
| PF06026 | Rib_5-P_isom_A | 0.26 |
| COG ID | Name | Functional Category | % Frequency in 383 Family Scaffolds |
|---|---|---|---|
| COG0248 | Exopolyphosphatase/pppGpp-phosphohydrolase | Signal transduction mechanisms [T] | 1.57 |
| COG0513 | Superfamily II DNA and RNA helicase | Replication, recombination and repair [L] | 1.57 |
| COG4638 | Phenylpropionate dioxygenase or related ring-hydroxylating dioxygenase, large terminal subunit | Inorganic ion transport and metabolism [P] | 1.57 |
| COG2353 | Polyisoprenoid-binding periplasmic protein YceI | General function prediction only [R] | 1.31 |
| COG0127 | Inosine/xanthosine triphosphate pyrophosphatase, all-alpha NTP-PPase family | Nucleotide transport and metabolism [F] | 1.04 |
| COG0254 | Ribosomal protein L31 | Translation, ribosomal structure and biogenesis [J] | 1.04 |
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 1.04 |
| COG0616 | Periplasmic serine protease, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 1.04 |
| COG3115 | Cell division protein ZipA, interacts with FtsZ | Cell cycle control, cell division, chromosome partitioning [D] | 1.04 |
| COG0563 | Adenylate kinase or related kinase | Nucleotide transport and metabolism [F] | 0.78 |
| COG2917 | Intracellular septation protein A | Cell cycle control, cell division, chromosome partitioning [D] | 0.78 |
| COG2972 | Sensor histidine kinase YesM | Signal transduction mechanisms [T] | 0.78 |
| COG3275 | Sensor histidine kinase, LytS/YehU family | Signal transduction mechanisms [T] | 0.78 |
| COG0115 | Branched-chain amino acid aminotransferase/4-amino-4-deoxychorismate lyase | Amino acid transport and metabolism [E] | 0.52 |
| COG0162 | Tyrosyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.52 |
| COG0180 | Tryptophanyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.52 |
| COG0288 | Carbonic anhydrase | Inorganic ion transport and metabolism [P] | 0.52 |
| COG0329 | 4-hydroxy-tetrahydrodipicolinate synthase/N-acetylneuraminate lyase | Cell wall/membrane/envelope biogenesis [M] | 0.52 |
| COG0347 | Nitrogen regulatory protein PII | Signal transduction mechanisms [T] | 0.52 |
| COG0372 | Citrate synthase | Energy production and conversion [C] | 0.52 |
| COG0435 | Glutathionyl-hydroquinone reductase | Energy production and conversion [C] | 0.52 |
| COG0458 | Carbamoylphosphate synthase large subunit | Amino acid transport and metabolism [E] | 0.52 |
| COG0482 | tRNA U34 2-thiouridine synthase MnmA/TrmU, contains the PP-loop ATPase domain | Translation, ribosomal structure and biogenesis [J] | 0.52 |
| COG0625 | Glutathione S-transferase | Posttranslational modification, protein turnover, chaperones [O] | 0.52 |
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 0.52 |
| COG0705 | Membrane-associated serine protease, rhomboid family | Posttranslational modification, protein turnover, chaperones [O] | 0.52 |
| COG0861 | Tellurite resistance membrane protein TerC | Inorganic ion transport and metabolism [P] | 0.52 |
| COG1197 | Transcription-repair coupling factor (superfamily II helicase) | Transcription [K] | 0.52 |
| COG1643 | HrpA-like RNA helicase | Translation, ribosomal structure and biogenesis [J] | 0.52 |
| COG1664 | Cytoskeletal protein CcmA, bactofilin family | Cytoskeleton [Z] | 0.52 |
| COG2148 | Sugar transferase involved in LPS biosynthesis (colanic, teichoic acid) | Cell wall/membrane/envelope biogenesis [M] | 0.52 |
| COG2208 | Phosphoserine phosphatase RsbU, regulator of sigma subunit | Transcription [K] | 0.52 |
| COG2303 | Choline dehydrogenase or related flavoprotein | Lipid transport and metabolism [I] | 0.52 |
| COG2360 | Leu/Phe-tRNA-protein transferase | Posttranslational modification, protein turnover, chaperones [O] | 0.52 |
| COG3132 | Uncharacterized conserved protein YceH, UPF0502 family | Function unknown [S] | 0.52 |
| COG3159 | Uncharacterized conserved protein YigA, DUF484 family | Function unknown [S] | 0.52 |
| COG3188 | Outer membrane usher protein FimD/PapC | Cell motility [N] | 0.52 |
| COG5598 | Trimethylamine:corrinoid methyltransferase | Coenzyme transport and metabolism [H] | 0.52 |
| COG0006 | Xaa-Pro aminopeptidase | Amino acid transport and metabolism [E] | 0.26 |
| COG0008 | Glutamyl- or glutaminyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.26 |
| COG0017 | Aspartyl/asparaginyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.26 |
| COG0026 | Phosphoribosylaminoimidazole carboxylase (NCAIR synthetase) | Nucleotide transport and metabolism [F] | 0.26 |
| COG0045 | Succinyl-CoA synthetase, beta subunit | Energy production and conversion [C] | 0.26 |
| COG0112 | Glycine/serine hydroxymethyltransferase | Amino acid transport and metabolism [E] | 0.26 |
| COG0120 | Ribose 5-phosphate isomerase | Carbohydrate transport and metabolism [G] | 0.26 |
| COG0134 | Indole-3-glycerol phosphate synthase | Amino acid transport and metabolism [E] | 0.26 |
| COG0142 | Geranylgeranyl pyrophosphate synthase | Coenzyme transport and metabolism [H] | 0.26 |
| COG0149 | Triosephosphate isomerase | Carbohydrate transport and metabolism [G] | 0.26 |
| COG0151 | Phosphoribosylamine-glycine ligase | Nucleotide transport and metabolism [F] | 0.26 |
| COG0156 | 7-keto-8-aminopelargonate synthetase or related enzyme | Coenzyme transport and metabolism [H] | 0.26 |
| COG0173 | Aspartyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.26 |
| COG0183 | Acetyl-CoA acetyltransferase | Lipid transport and metabolism [I] | 0.26 |
| COG0229 | Peptide methionine sulfoxide reductase MsrB | Posttranslational modification, protein turnover, chaperones [O] | 0.26 |
| COG0239 | Fluoride ion exporter CrcB/FEX, affects chromosome condensation | Cell cycle control, cell division, chromosome partitioning [D] | 0.26 |
| COG0240 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.26 |
| COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 0.26 |
| COG0266 | Formamidopyrimidine-DNA glycosylase | Replication, recombination and repair [L] | 0.26 |
| COG0275 | 16S rRNA C1402 N4-methylase RsmH | Translation, ribosomal structure and biogenesis [J] | 0.26 |
| COG0277 | FAD/FMN-containing lactate dehydrogenase/glycolate oxidase | Energy production and conversion [C] | 0.26 |
| COG0287 | Prephenate dehydrogenase | Amino acid transport and metabolism [E] | 0.26 |
| COG0292 | Ribosomal protein L20 | Translation, ribosomal structure and biogenesis [J] | 0.26 |
| COG0296 | 1,4-alpha-glucan branching enzyme | Carbohydrate transport and metabolism [G] | 0.26 |
| COG0305 | Replicative DNA helicase | Replication, recombination and repair [L] | 0.26 |
| COG0361 | Translation initiation factor IF-1 | Translation, ribosomal structure and biogenesis [J] | 0.26 |
| COG0363 | 6-phosphogluconolactonase/Glucosamine-6-phosphate isomerase/deaminase | Carbohydrate transport and metabolism [G] | 0.26 |
| COG0364 | Glucose-6-phosphate 1-dehydrogenase | Carbohydrate transport and metabolism [G] | 0.26 |
| COG0366 | Glycosidase/amylase (phosphorylase) | Carbohydrate transport and metabolism [G] | 0.26 |
| COG0380 | Trehalose-6-phosphate synthase, GT20 family | Carbohydrate transport and metabolism [G] | 0.26 |
| COG0405 | Gamma-glutamyltranspeptidase | Amino acid transport and metabolism [E] | 0.26 |
| COG0466 | ATP-dependent Lon protease, bacterial type | Posttranslational modification, protein turnover, chaperones [O] | 0.26 |
| COG0484 | DnaJ-class molecular chaperone with C-terminal Zn finger domain | Posttranslational modification, protein turnover, chaperones [O] | 0.26 |
| COG0504 | CTP synthase (UTP-ammonia lyase) | Nucleotide transport and metabolism [F] | 0.26 |
| COG0529 | Adenylylsulfate kinase or related kinase | Inorganic ion transport and metabolism [P] | 0.26 |
| COG0531 | Serine transporter YbeC, amino acid:H+ symporter family | Amino acid transport and metabolism [E] | 0.26 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.26 |
| COG0580 | Glycerol uptake facilitator or related aquaporin (Major Intrinsic protein Family) | Carbohydrate transport and metabolism [G] | 0.26 |
| COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 0.26 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.26 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 0.26 |
| COG0677 | UDP-N-acetyl-D-mannosaminuronate dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 0.26 |
| COG0733 | Na+-dependent transporter, SNF family | General function prediction only [R] | 0.26 |
| COG0746 | Molybdopterin-guanine dinucleotide biosynthesis protein A | Coenzyme transport and metabolism [H] | 0.26 |
| COG0764 | 3-hydroxymyristoyl/3-hydroxydecanoyl-(acyl carrier protein) dehydratase | Lipid transport and metabolism [I] | 0.26 |
| COG0805 | Twin-arginine protein secretion pathway component TatC | Intracellular trafficking, secretion, and vesicular transport [U] | 0.26 |
| COG0806 | Ribosomal 30S subunit maturation factor RimM, required for 16S rRNA processing | Translation, ribosomal structure and biogenesis [J] | 0.26 |
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 0.26 |
| COG0833 | Amino acid permease | Amino acid transport and metabolism [E] | 0.26 |
| COG1004 | UDP-glucose 6-dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 0.26 |
| COG1042 | Acyl-CoA synthetase (NDP forming) | Energy production and conversion [C] | 0.26 |
| COG1067 | Predicted ATP-dependent protease | Posttranslational modification, protein turnover, chaperones [O] | 0.26 |
| COG1113 | L-asparagine transporter or related permease | Amino acid transport and metabolism [E] | 0.26 |
| COG1115 | Na+/alanine symporter | Amino acid transport and metabolism [E] | 0.26 |
| COG1190 | Lysyl-tRNA synthetase, class II | Translation, ribosomal structure and biogenesis [J] | 0.26 |
| COG1207 | Bifunctional protein GlmU, N-acetylglucosamine-1-phosphate-uridyltransferase/glucosamine-1-phosphate-acetyltransferase | Cell wall/membrane/envelope biogenesis [M] | 0.26 |
| COG1211 | 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase | Lipid transport and metabolism [I] | 0.26 |
| COG1250 | 3-hydroxyacyl-CoA dehydrogenase | Lipid transport and metabolism [I] | 0.26 |
| COG1266 | Membrane protease YdiL, CAAX protease family | Posttranslational modification, protein turnover, chaperones [O] | 0.26 |
| COG1290 | Cytochrome b subunit of the bc complex | Energy production and conversion [C] | 0.26 |
| COG1314 | Protein translocase subunit SecG | Intracellular trafficking, secretion, and vesicular transport [U] | 0.26 |
| COG1410 | Methionine synthase I, cobalamin-binding domain | Amino acid transport and metabolism [E] | 0.26 |
| COG1428 | Deoxyadenosine/deoxycytidine kinase | Nucleotide transport and metabolism [F] | 0.26 |
| COG1477 | FAD:protein FMN transferase ApbE | Posttranslational modification, protein turnover, chaperones [O] | 0.26 |
| COG1523 | Pullulanase/glycogen debranching enzyme | Carbohydrate transport and metabolism [G] | 0.26 |
| COG1576 | 23S rRNA pseudoU1915 N3-methylase RlmH | Translation, ribosomal structure and biogenesis [J] | 0.26 |
| COG1611 | Nucleotide monophosphate nucleosidase PpnN/YdgH, Lonely Guy (LOG) family | Nucleotide transport and metabolism [F] | 0.26 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.26 |
| COG1704 | Magnetosome formation protein MamQ, lipoprotein antigen LemA family | Cell wall/membrane/envelope biogenesis [M] | 0.26 |
| COG1734 | RNA polymerase-binding transcription factor DksA | Transcription [K] | 0.26 |
| COG1748 | Saccharopine dehydrogenase, NADP-dependent | Amino acid transport and metabolism [E] | 0.26 |
| COG1750 | Predicted archaeal serine protease, S18 family | General function prediction only [R] | 0.26 |
| COG1801 | Sugar isomerase-related protein YecE, UPF0759/DUF72 family | General function prediction only [R] | 0.26 |
| COG1834 | N-Dimethylarginine dimethylaminohydrolase | Amino acid transport and metabolism [E] | 0.26 |
| COG1881 | Uncharacterized conserved protein, phosphatidylethanolamine-binding protein (PEBP) family | General function prediction only [R] | 0.26 |
| COG1916 | Pheromone shutdown protein TraB, contains GTxH motif (function unknown) | Function unknown [S] | 0.26 |
| COG1918 | Fe2+ transport protein FeoA | Inorganic ion transport and metabolism [P] | 0.26 |
| COG2025 | Electron transfer flavoprotein, alpha subunit FixB | Energy production and conversion [C] | 0.26 |
| COG2068 | CTP:molybdopterin cytidylyltransferase MocA | Coenzyme transport and metabolism [H] | 0.26 |
| COG2084 | 3-hydroxyisobutyrate dehydrogenase or related beta-hydroxyacid dehydrogenase | Lipid transport and metabolism [I] | 0.26 |
| COG2086 | Electron transfer flavoprotein, alpha and beta subunits | Energy production and conversion [C] | 0.26 |
| COG2124 | Cytochrome P450 | Defense mechanisms [V] | 0.26 |
| COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 0.26 |
| COG2132 | Multicopper oxidase with three cupredoxin domains (includes cell division protein FtsP and spore coat protein CotA) | Cell cycle control, cell division, chromosome partitioning [D] | 0.26 |
| COG2235 | Arginine deiminase | Amino acid transport and metabolism [E] | 0.26 |
| COG2269 | Elongation factor P--beta-lysine ligase (EF-P beta-lysylation pathway) | Translation, ribosomal structure and biogenesis [J] | 0.26 |
| COG2307 | Uncharacterized conserved protein, Alpha-E superfamily | Function unknown [S] | 0.26 |
| COG2363 | Uncharacterized membrane protein YgdD, TMEM256/DUF423 family | Function unknown [S] | 0.26 |
| COG2814 | Predicted arabinose efflux permease AraJ, MFS family | Carbohydrate transport and metabolism [G] | 0.26 |
| COG2825 | Periplasmic chaperone for outer membrane proteins, Skp family | Cell wall/membrane/envelope biogenesis [M] | 0.26 |
| COG2902 | NAD-specific glutamate dehydrogenase | Amino acid transport and metabolism [E] | 0.26 |
| COG2918 | Gamma-glutamylcysteine synthetase | Coenzyme transport and metabolism [H] | 0.26 |
| COG2936 | Predicted acyl esterase | General function prediction only [R] | 0.26 |
| COG2995 | Intermembrane transporter PqiABC subunit PqiA | Cell wall/membrane/envelope biogenesis [M] | 0.26 |
| COG3151 | Uncharacterized conserved protein YqiB, DUF1249 family | Function unknown [S] | 0.26 |
| COG3280 | Maltooligosyltrehalose synthase | Carbohydrate transport and metabolism [G] | 0.26 |
| COG3480 | Predicted secreted protein YlbL, contains PDZ domain | Signal transduction mechanisms [T] | 0.26 |
| COG3488 | Uncharacterized conserved protein with two CxxC motifs, DUF1111 family | General function prediction only [R] | 0.26 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.26 |
| COG3876 | Exo-beta-N-acetylmuramidase YbbC/NamZ, DUF1343 family | Cell wall/membrane/envelope biogenesis [M] | 0.26 |
| COG4249 | Uncharacterized conserved protein, contains caspase domain | General function prediction only [R] | 0.26 |
| COG4449 | Predicted protease, Abi (CAAX) family | General function prediction only [R] | 0.26 |
| COG4575 | Membrane-anchored ribosome-binding protein ElaB, inhibits growth in stationary phase, YqjD/DUF883 family | Translation, ribosomal structure and biogenesis [J] | 0.26 |
| COG4636 | Endonuclease, Uma2 family (restriction endonuclease fold) | General function prediction only [R] | 0.26 |
| COG4706 | Predicted 3-hydroxylacyl-ACP dehydratase, HotDog domain | Lipid transport and metabolism [I] | 0.26 |
| COG4805 | Uncharacterized conserved protein, DUF885 family | Function unknown [S] | 0.26 |
| COG4874 | Uncharacterized conserved protein | Function unknown [S] | 0.26 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 72.92 % |
| Unclassified | root | N/A | 27.08 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001405|JGI20186J14852_1012252 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 503 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100058274 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 3533 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100319611 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1435 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100688397 | Not Available | 900 | Open in IMG/M |
| 3300002568|C688J35102_119071496 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300002886|JGI25612J43240_1025177 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 877 | Open in IMG/M |
| 3300002906|JGI25614J43888_10051734 | Not Available | 1234 | Open in IMG/M |
| 3300002907|JGI25613J43889_10032167 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1485 | Open in IMG/M |
| 3300002907|JGI25613J43889_10093388 | Not Available | 791 | Open in IMG/M |
| 3300002910|JGI25615J43890_1064223 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300002910|JGI25615J43890_1099568 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300002914|JGI25617J43924_10156477 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 779 | Open in IMG/M |
| 3300002914|JGI25617J43924_10295707 | Not Available | 556 | Open in IMG/M |
| 3300002917|JGI25616J43925_10022686 | All Organisms → cellular organisms → Bacteria | 2783 | Open in IMG/M |
| 3300002917|JGI25616J43925_10100201 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1196 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10086912 | Not Available | 1233 | Open in IMG/M |
| 3300004080|Ga0062385_10878856 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300004082|Ga0062384_100163989 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1274 | Open in IMG/M |
| 3300004092|Ga0062389_104929638 | Not Available | 503 | Open in IMG/M |
| 3300004153|Ga0063455_101049927 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 596 | Open in IMG/M |
| 3300004635|Ga0062388_100241476 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1462 | Open in IMG/M |
| 3300004635|Ga0062388_101919663 | Not Available | 610 | Open in IMG/M |
| 3300005329|Ga0070683_100011689 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales | 7602 | Open in IMG/M |
| 3300005329|Ga0070683_100224020 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1787 | Open in IMG/M |
| 3300005329|Ga0070683_100355759 | Not Available | 1394 | Open in IMG/M |
| 3300005331|Ga0070670_100240106 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1577 | Open in IMG/M |
| 3300005331|Ga0070670_100645187 | All Organisms → cellular organisms → Bacteria | 949 | Open in IMG/M |
| 3300005331|Ga0070670_100906397 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
| 3300005332|Ga0066388_100155028 | Not Available | 2873 | Open in IMG/M |
| 3300005334|Ga0068869_100268950 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1367 | Open in IMG/M |
| 3300005335|Ga0070666_10060062 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2572 | Open in IMG/M |
| 3300005335|Ga0070666_10505312 | Not Available | 876 | Open in IMG/M |
| 3300005355|Ga0070671_100001604 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 17025 | Open in IMG/M |
| 3300005355|Ga0070671_100146904 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1990 | Open in IMG/M |
| 3300005355|Ga0070671_100327585 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1305 | Open in IMG/M |
| 3300005355|Ga0070671_102040701 | Not Available | 511 | Open in IMG/M |
| 3300005367|Ga0070667_100644746 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 978 | Open in IMG/M |
| 3300005436|Ga0070713_100218148 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1730 | Open in IMG/M |
| 3300005436|Ga0070713_101844778 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 587 | Open in IMG/M |
| 3300005455|Ga0070663_101100841 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
| 3300005529|Ga0070741_10029780 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 7716 | Open in IMG/M |
| 3300005529|Ga0070741_10056879 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4621 | Open in IMG/M |
| 3300005537|Ga0070730_10687494 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rudaea → Rudaea cellulosilytica | 649 | Open in IMG/M |
| 3300005539|Ga0068853_100318914 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1440 | Open in IMG/M |
| 3300005539|Ga0068853_100321545 | All Organisms → cellular organisms → Bacteria | 1434 | Open in IMG/M |
| 3300005541|Ga0070733_10212944 | All Organisms → cellular organisms → Bacteria | 1266 | Open in IMG/M |
| 3300005541|Ga0070733_10323270 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae | 1021 | Open in IMG/M |
| 3300005541|Ga0070733_10928371 | Not Available | 585 | Open in IMG/M |
| 3300005548|Ga0070665_100594570 | All Organisms → cellular organisms → Bacteria | 1119 | Open in IMG/M |
| 3300005563|Ga0068855_100646074 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1137 | Open in IMG/M |
| 3300005563|Ga0068855_101754178 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300005563|Ga0068855_101829347 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 616 | Open in IMG/M |
| 3300005563|Ga0068855_101945940 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 595 | Open in IMG/M |
| 3300005577|Ga0068857_102253808 | Not Available | 535 | Open in IMG/M |
| 3300005578|Ga0068854_100444415 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 1082 | Open in IMG/M |
| 3300005578|Ga0068854_102040978 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 529 | Open in IMG/M |
| 3300005614|Ga0068856_100150490 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2336 | Open in IMG/M |
| 3300005614|Ga0068856_100896937 | Not Available | 905 | Open in IMG/M |
| 3300005614|Ga0068856_100974070 | Not Available | 866 | Open in IMG/M |
| 3300005614|Ga0068856_101591196 | Not Available | 667 | Open in IMG/M |
| 3300005616|Ga0068852_100904854 | All Organisms → cellular organisms → Bacteria | 899 | Open in IMG/M |
| 3300005617|Ga0068859_100065250 | All Organisms → cellular organisms → Bacteria | 3675 | Open in IMG/M |
| 3300005617|Ga0068859_102311420 | Not Available | 593 | Open in IMG/M |
| 3300005618|Ga0068864_101571512 | Not Available | 661 | Open in IMG/M |
| 3300005712|Ga0070764_10095982 | All Organisms → cellular organisms → Bacteria | 1578 | Open in IMG/M |
| 3300005719|Ga0068861_101549469 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 652 | Open in IMG/M |
| 3300005841|Ga0068863_102575562 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 518 | Open in IMG/M |
| 3300005842|Ga0068858_100009797 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 9120 | Open in IMG/M |
| 3300005842|Ga0068858_100015338 | All Organisms → cellular organisms → Bacteria | 7208 | Open in IMG/M |
| 3300005842|Ga0068858_100061164 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3481 | Open in IMG/M |
| 3300005842|Ga0068858_100424726 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1278 | Open in IMG/M |
| 3300005842|Ga0068858_100636649 | All Organisms → cellular organisms → Bacteria | 1036 | Open in IMG/M |
| 3300005842|Ga0068858_100820092 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 908 | Open in IMG/M |
| 3300005842|Ga0068858_101085815 | Not Available | 785 | Open in IMG/M |
| 3300005843|Ga0068860_101480699 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
| 3300005844|Ga0068862_100359636 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1352 | Open in IMG/M |
| 3300005844|Ga0068862_102274576 | Not Available | 554 | Open in IMG/M |
| 3300005985|Ga0081539_10121607 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1296 | Open in IMG/M |
| 3300005994|Ga0066789_10017465 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae | 3178 | Open in IMG/M |
| 3300006169|Ga0082029_1129806 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 514 | Open in IMG/M |
| 3300006237|Ga0097621_100728706 | Not Available | 914 | Open in IMG/M |
| 3300006237|Ga0097621_101791195 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 585 | Open in IMG/M |
| 3300006755|Ga0079222_12394880 | Not Available | 529 | Open in IMG/M |
| 3300006804|Ga0079221_11601631 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300006871|Ga0075434_101131649 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 796 | Open in IMG/M |
| 3300006893|Ga0073928_10002191 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 34656 | Open in IMG/M |
| 3300006893|Ga0073928_10304111 | All Organisms → cellular organisms → Bacteria | 1196 | Open in IMG/M |
| 3300006893|Ga0073928_10457727 | All Organisms → cellular organisms → Bacteria | 922 | Open in IMG/M |
| 3300006893|Ga0073928_10540055 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 830 | Open in IMG/M |
| 3300006893|Ga0073928_10565917 | All Organisms → cellular organisms → Bacteria | 807 | Open in IMG/M |
| 3300006893|Ga0073928_11161826 | Not Available | 521 | Open in IMG/M |
| 3300006893|Ga0073928_11171087 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300007004|Ga0079218_11002100 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter | 837 | Open in IMG/M |
| 3300007258|Ga0099793_10206738 | Not Available | 942 | Open in IMG/M |
| 3300007265|Ga0099794_10032951 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2434 | Open in IMG/M |
| 3300007265|Ga0099794_10188535 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1054 | Open in IMG/M |
| 3300007265|Ga0099794_10443258 | Not Available | 680 | Open in IMG/M |
| 3300007265|Ga0099794_10557240 | Not Available | 605 | Open in IMG/M |
| 3300007788|Ga0099795_10000176 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 10588 | Open in IMG/M |
| 3300007788|Ga0099795_10000512 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 7296 | Open in IMG/M |
| 3300007788|Ga0099795_10048717 | Not Available | 1535 | Open in IMG/M |
| 3300009038|Ga0099829_10521024 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 987 | Open in IMG/M |
| 3300009038|Ga0099829_10569340 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 942 | Open in IMG/M |
| 3300009038|Ga0099829_11056795 | Not Available | 673 | Open in IMG/M |
| 3300009088|Ga0099830_11384204 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 585 | Open in IMG/M |
| 3300009090|Ga0099827_11429027 | Not Available | 602 | Open in IMG/M |
| 3300009093|Ga0105240_11116868 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 838 | Open in IMG/M |
| 3300009093|Ga0105240_12783123 | Not Available | 503 | Open in IMG/M |
| 3300009095|Ga0079224_100628000 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1541 | Open in IMG/M |
| 3300009143|Ga0099792_10002724 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 6802 | Open in IMG/M |
| 3300009143|Ga0099792_10003584 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 6059 | Open in IMG/M |
| 3300009143|Ga0099792_10005783 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanosarcinales → Candidatus Methanoperedenaceae → Candidatus Methanoperedens → Candidatus Methanoperedens nitroreducens | 4956 | Open in IMG/M |
| 3300009143|Ga0099792_10014123 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3434 | Open in IMG/M |
| 3300009143|Ga0099792_10606891 | Not Available | 698 | Open in IMG/M |
| 3300009177|Ga0105248_11301244 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 822 | Open in IMG/M |
| 3300009500|Ga0116229_10376935 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1188 | Open in IMG/M |
| 3300009500|Ga0116229_11558814 | Not Available | 521 | Open in IMG/M |
| 3300009545|Ga0105237_12407429 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 537 | Open in IMG/M |
| 3300009551|Ga0105238_10963772 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 873 | Open in IMG/M |
| 3300009659|Ga0123328_1254618 | Not Available | 650 | Open in IMG/M |
| 3300009709|Ga0116227_10328079 | All Organisms → cellular organisms → Bacteria | 1170 | Open in IMG/M |
| 3300009709|Ga0116227_11007578 | Not Available | 627 | Open in IMG/M |
| 3300009709|Ga0116227_11028913 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300010159|Ga0099796_10000744 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5805 | Open in IMG/M |
| 3300010159|Ga0099796_10020675 | Not Available | 2015 | Open in IMG/M |
| 3300010159|Ga0099796_10165284 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 880 | Open in IMG/M |
| 3300010361|Ga0126378_12682533 | Not Available | 569 | Open in IMG/M |
| 3300010375|Ga0105239_10342567 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1687 | Open in IMG/M |
| 3300010375|Ga0105239_11728488 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
| 3300010375|Ga0105239_13439176 | Not Available | 515 | Open in IMG/M |
| 3300010399|Ga0134127_12520049 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 594 | Open in IMG/M |
| 3300010877|Ga0126356_10651879 | Not Available | 799 | Open in IMG/M |
| 3300011269|Ga0137392_10047660 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 3210 | Open in IMG/M |
| 3300011269|Ga0137392_10293264 | Not Available | 1344 | Open in IMG/M |
| 3300011269|Ga0137392_11325810 | Not Available | 579 | Open in IMG/M |
| 3300011270|Ga0137391_10286545 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas panacisoli | 1422 | Open in IMG/M |
| 3300011271|Ga0137393_10024084 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → unclassified Pseudomonas → Pseudomonas sp. 9Ag | 4502 | Open in IMG/M |
| 3300011271|Ga0137393_10024140 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 4498 | Open in IMG/M |
| 3300011271|Ga0137393_10112130 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2239 | Open in IMG/M |
| 3300011271|Ga0137393_10235546 | Not Available | 1551 | Open in IMG/M |
| 3300011271|Ga0137393_10875950 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
| 3300011271|Ga0137393_11525037 | Not Available | 558 | Open in IMG/M |
| 3300011271|Ga0137393_11575758 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 546 | Open in IMG/M |
| 3300012189|Ga0137388_10858457 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 840 | Open in IMG/M |
| 3300012189|Ga0137388_11199490 | Not Available | 697 | Open in IMG/M |
| 3300012189|Ga0137388_11240235 | Not Available | 684 | Open in IMG/M |
| 3300012189|Ga0137388_11536869 | Not Available | 602 | Open in IMG/M |
| 3300012189|Ga0137388_11662993 | Not Available | 573 | Open in IMG/M |
| 3300012202|Ga0137363_10001698 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 12859 | Open in IMG/M |
| 3300012202|Ga0137363_10003971 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 9055 | Open in IMG/M |
| 3300012203|Ga0137399_10438310 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1092 | Open in IMG/M |
| 3300012351|Ga0137386_11091438 | Not Available | 564 | Open in IMG/M |
| 3300012351|Ga0137386_11194836 | Not Available | 532 | Open in IMG/M |
| 3300012359|Ga0137385_10217385 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1664 | Open in IMG/M |
| 3300012359|Ga0137385_10463009 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1076 | Open in IMG/M |
| 3300012359|Ga0137385_10868677 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
| 3300012362|Ga0137361_10039024 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 3837 | Open in IMG/M |
| 3300012362|Ga0137361_11908008 | Not Available | 511 | Open in IMG/M |
| 3300012363|Ga0137390_10096525 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2919 | Open in IMG/M |
| 3300012363|Ga0137390_10120263 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2601 | Open in IMG/M |
| 3300012363|Ga0137390_10260375 | Not Available | 1720 | Open in IMG/M |
| 3300012363|Ga0137390_10747391 | All Organisms → cellular organisms → Bacteria | 938 | Open in IMG/M |
| 3300012363|Ga0137390_10769985 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 921 | Open in IMG/M |
| 3300012683|Ga0137398_10000589 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 13356 | Open in IMG/M |
| 3300012683|Ga0137398_10005123 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales | 6112 | Open in IMG/M |
| 3300012683|Ga0137398_10024625 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3320 | Open in IMG/M |
| 3300012683|Ga0137398_10634936 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 740 | Open in IMG/M |
| 3300012683|Ga0137398_10841334 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
| 3300012685|Ga0137397_10042996 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae | 3232 | Open in IMG/M |
| 3300012685|Ga0137397_10912764 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 651 | Open in IMG/M |
| 3300012918|Ga0137396_11131384 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 557 | Open in IMG/M |
| 3300012923|Ga0137359_10149040 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2085 | Open in IMG/M |
| 3300012924|Ga0137413_10134299 | Not Available | 1595 | Open in IMG/M |
| 3300012924|Ga0137413_10156940 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1492 | Open in IMG/M |
| 3300012924|Ga0137413_10335126 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter gossypii | 1068 | Open in IMG/M |
| 3300012924|Ga0137413_10353714 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1043 | Open in IMG/M |
| 3300012924|Ga0137413_10488217 | All Organisms → cellular organisms → Bacteria | 904 | Open in IMG/M |
| 3300012924|Ga0137413_11081008 | Not Available | 633 | Open in IMG/M |
| 3300012925|Ga0137419_10110512 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1921 | Open in IMG/M |
| 3300012925|Ga0137419_10172120 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales | 1581 | Open in IMG/M |
| 3300012925|Ga0137419_10173177 | Not Available | 1577 | Open in IMG/M |
| 3300012927|Ga0137416_10000054 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 40057 | Open in IMG/M |
| 3300012927|Ga0137416_11342795 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
| 3300012929|Ga0137404_10029865 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4020 | Open in IMG/M |
| 3300012929|Ga0137404_10397759 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1214 | Open in IMG/M |
| 3300012929|Ga0137404_10425349 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1175 | Open in IMG/M |
| 3300012929|Ga0137404_10471521 | Not Available | 1116 | Open in IMG/M |
| 3300012929|Ga0137404_10491545 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1094 | Open in IMG/M |
| 3300012929|Ga0137404_10993378 | Not Available | 768 | Open in IMG/M |
| 3300012929|Ga0137404_11129792 | Not Available | 719 | Open in IMG/M |
| 3300012930|Ga0137407_10001057 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 18060 | Open in IMG/M |
| 3300012930|Ga0137407_10028788 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4300 | Open in IMG/M |
| 3300012930|Ga0137407_11088226 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae → Nitrospirillum → Nitrospirillum amazonense | 758 | Open in IMG/M |
| 3300012930|Ga0137407_11425727 | Not Available | 658 | Open in IMG/M |
| 3300012930|Ga0137407_12408514 | Not Available | 503 | Open in IMG/M |
| 3300012944|Ga0137410_10428634 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1070 | Open in IMG/M |
| 3300012944|Ga0137410_10588302 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium HGW-Betaproteobacteria-13 | 918 | Open in IMG/M |
| 3300012944|Ga0137410_11056261 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 694 | Open in IMG/M |
| 3300012944|Ga0137410_11062005 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
| 3300013307|Ga0157372_10236253 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 2120 | Open in IMG/M |
| 3300014168|Ga0181534_10001871 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 13469 | Open in IMG/M |
| 3300014168|Ga0181534_10007671 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 5904 | Open in IMG/M |
| 3300014168|Ga0181534_10167584 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1133 | Open in IMG/M |
| 3300014168|Ga0181534_10676632 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rudaea → Rudaea cellulosilytica | 601 | Open in IMG/M |
| 3300014169|Ga0181531_10086394 | All Organisms → cellular organisms → Bacteria | 1862 | Open in IMG/M |
| 3300014169|Ga0181531_10199406 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1215 | Open in IMG/M |
| 3300014272|Ga0075327_1264987 | Not Available | 564 | Open in IMG/M |
| 3300014325|Ga0163163_11997432 | Not Available | 640 | Open in IMG/M |
| 3300014325|Ga0163163_12566278 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Micrarchaeota → unclassified Candidatus Micrarchaeota → Candidatus Micrarchaeota archaeon | 567 | Open in IMG/M |
| 3300014325|Ga0163163_12946373 | Not Available | 531 | Open in IMG/M |
| 3300014489|Ga0182018_10675812 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 539 | Open in IMG/M |
| 3300014501|Ga0182024_10301486 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 2118 | Open in IMG/M |
| 3300014501|Ga0182024_10404195 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1765 | Open in IMG/M |
| 3300014501|Ga0182024_10754104 | Not Available | 1193 | Open in IMG/M |
| 3300014501|Ga0182024_11170763 | Not Available | 902 | Open in IMG/M |
| 3300014501|Ga0182024_12252305 | Not Available | 595 | Open in IMG/M |
| 3300014501|Ga0182024_12483149 | Not Available | 559 | Open in IMG/M |
| 3300014654|Ga0181525_10468029 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 696 | Open in IMG/M |
| 3300014655|Ga0181516_10454191 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 656 | Open in IMG/M |
| 3300014657|Ga0181522_10262462 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1022 | Open in IMG/M |
| 3300014968|Ga0157379_10368083 | All Organisms → cellular organisms → Bacteria | 1318 | Open in IMG/M |
| 3300015052|Ga0137411_1131520 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2339 | Open in IMG/M |
| 3300015052|Ga0137411_1231913 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2368 | Open in IMG/M |
| 3300015053|Ga0137405_1311038 | Not Available | 515 | Open in IMG/M |
| 3300015160|Ga0167642_1011925 | All Organisms → cellular organisms → Bacteria | 1512 | Open in IMG/M |
| 3300015160|Ga0167642_1062332 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 546 | Open in IMG/M |
| 3300015206|Ga0167644_1000008 | All Organisms → cellular organisms → Bacteria | 188925 | Open in IMG/M |
| 3300015206|Ga0167644_1000008 | All Organisms → cellular organisms → Bacteria | 188925 | Open in IMG/M |
| 3300015206|Ga0167644_1000070 | All Organisms → cellular organisms → Bacteria | 104167 | Open in IMG/M |
| 3300015206|Ga0167644_1000131 | All Organisms → cellular organisms → Bacteria | 81912 | Open in IMG/M |
| 3300015206|Ga0167644_1000210 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 64768 | Open in IMG/M |
| 3300015206|Ga0167644_1000266 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 56980 | Open in IMG/M |
| 3300015206|Ga0167644_1000268 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 56659 | Open in IMG/M |
| 3300015206|Ga0167644_1000852 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 24889 | Open in IMG/M |
| 3300015206|Ga0167644_1000944 | All Organisms → cellular organisms → Bacteria | 23205 | Open in IMG/M |
| 3300015206|Ga0167644_1004520 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 7961 | Open in IMG/M |
| 3300015206|Ga0167644_1006400 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6430 | Open in IMG/M |
| 3300015206|Ga0167644_1008565 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 5288 | Open in IMG/M |
| 3300015206|Ga0167644_1030083 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2203 | Open in IMG/M |
| 3300015206|Ga0167644_1141715 | Not Available | 622 | Open in IMG/M |
| 3300015241|Ga0137418_10165846 | All Organisms → cellular organisms → Bacteria | 1935 | Open in IMG/M |
| 3300015245|Ga0137409_10000989 | All Organisms → cellular organisms → Bacteria | 30922 | Open in IMG/M |
| 3300015245|Ga0137409_10002922 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 18140 | Open in IMG/M |
| 3300015245|Ga0137409_10022072 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 6254 | Open in IMG/M |
| 3300015264|Ga0137403_10074737 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3433 | Open in IMG/M |
| 3300015264|Ga0137403_10562487 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1008 | Open in IMG/M |
| 3300015264|Ga0137403_10899884 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 735 | Open in IMG/M |
| 3300017943|Ga0187819_10016725 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 4220 | Open in IMG/M |
| 3300019270|Ga0181512_1589264 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 515 | Open in IMG/M |
| 3300019789|Ga0137408_1054463 | Not Available | 1011 | Open in IMG/M |
| 3300019789|Ga0137408_1183836 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3264 | Open in IMG/M |
| 3300019890|Ga0193728_1228078 | Not Available | 763 | Open in IMG/M |
| 3300020140|Ga0179590_1028396 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1362 | Open in IMG/M |
| 3300020199|Ga0179592_10440813 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 564 | Open in IMG/M |
| 3300020580|Ga0210403_10007280 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales | 9220 | Open in IMG/M |
| 3300020580|Ga0210403_10013612 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 6567 | Open in IMG/M |
| 3300020580|Ga0210403_10752510 | Not Available | 778 | Open in IMG/M |
| 3300020580|Ga0210403_11428636 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 523 | Open in IMG/M |
| 3300020582|Ga0210395_11086493 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 591 | Open in IMG/M |
| 3300020583|Ga0210401_10725126 | Not Available | 855 | Open in IMG/M |
| 3300021086|Ga0179596_10048803 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1745 | Open in IMG/M |
| 3300021086|Ga0179596_10156036 | Not Available | 1089 | Open in IMG/M |
| 3300021086|Ga0179596_10621215 | Not Available | 548 | Open in IMG/M |
| 3300021086|Ga0179596_10720648 | Not Available | 505 | Open in IMG/M |
| 3300021088|Ga0210404_10578800 | Not Available | 637 | Open in IMG/M |
| 3300021168|Ga0210406_10194589 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1684 | Open in IMG/M |
| 3300021168|Ga0210406_10413921 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1078 | Open in IMG/M |
| 3300021168|Ga0210406_10737972 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae | 755 | Open in IMG/M |
| 3300021168|Ga0210406_11004600 | Not Available | 620 | Open in IMG/M |
| 3300021170|Ga0210400_10084200 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2502 | Open in IMG/M |
| 3300021171|Ga0210405_11344034 | Not Available | 523 | Open in IMG/M |
| 3300021180|Ga0210396_11008122 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 705 | Open in IMG/M |
| 3300021181|Ga0210388_10061397 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 3151 | Open in IMG/M |
| 3300021384|Ga0213876_10579854 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300021405|Ga0210387_10598506 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 980 | Open in IMG/M |
| 3300021406|Ga0210386_10012384 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6674 | Open in IMG/M |
| 3300021406|Ga0210386_10136224 | Not Available | 2043 | Open in IMG/M |
| 3300021420|Ga0210394_10044111 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 3918 | Open in IMG/M |
| 3300021420|Ga0210394_10095119 | All Organisms → cellular organisms → Bacteria | 2576 | Open in IMG/M |
| 3300021420|Ga0210394_10160283 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1956 | Open in IMG/M |
| 3300021420|Ga0210394_10934797 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 753 | Open in IMG/M |
| 3300021420|Ga0210394_11051584 | Not Available | 704 | Open in IMG/M |
| 3300021433|Ga0210391_10908006 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 687 | Open in IMG/M |
| 3300021479|Ga0210410_10155907 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2036 | Open in IMG/M |
| 3300021479|Ga0210410_11791807 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Sporichthyales → Sporichthyaceae → Sporichthya → Sporichthya polymorpha | 508 | Open in IMG/M |
| 3300022557|Ga0212123_10845528 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 545 | Open in IMG/M |
| 3300024288|Ga0179589_10040462 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Woeseiaceae → Woeseia → Woeseia oceani | 1700 | Open in IMG/M |
| 3300024288|Ga0179589_10085967 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1260 | Open in IMG/M |
| 3300024288|Ga0179589_10286427 | Not Available | 738 | Open in IMG/M |
| 3300024330|Ga0137417_1474955 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 1643 | Open in IMG/M |
| 3300025504|Ga0208356_1028274 | Not Available | 1180 | Open in IMG/M |
| 3300025903|Ga0207680_10149406 | All Organisms → cellular organisms → Bacteria | 1556 | Open in IMG/M |
| 3300025911|Ga0207654_10741939 | Not Available | 707 | Open in IMG/M |
| 3300025921|Ga0207652_10056309 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 3385 | Open in IMG/M |
| 3300025924|Ga0207694_10673270 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 872 | Open in IMG/M |
| 3300025925|Ga0207650_11810183 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 516 | Open in IMG/M |
| 3300025931|Ga0207644_10090676 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter | 2278 | Open in IMG/M |
| 3300025981|Ga0207640_10260419 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1351 | Open in IMG/M |
| 3300026023|Ga0207677_10065081 | Not Available | 2542 | Open in IMG/M |
| 3300026078|Ga0207702_12081160 | Not Available | 557 | Open in IMG/M |
| 3300026088|Ga0207641_11788475 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 616 | Open in IMG/M |
| 3300026118|Ga0207675_100133462 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 2354 | Open in IMG/M |
| 3300026118|Ga0207675_101141676 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 799 | Open in IMG/M |
| 3300026285|Ga0209438_1008114 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales | 3549 | Open in IMG/M |
| 3300026285|Ga0209438_1015266 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2574 | Open in IMG/M |
| 3300026304|Ga0209240_1071354 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1291 | Open in IMG/M |
| 3300026319|Ga0209647_1305311 | Not Available | 535 | Open in IMG/M |
| 3300026320|Ga0209131_1015067 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 4728 | Open in IMG/M |
| 3300026320|Ga0209131_1040440 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2680 | Open in IMG/M |
| 3300026351|Ga0257170_1039938 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 644 | Open in IMG/M |
| 3300026482|Ga0257172_1006094 | Not Available | 1840 | Open in IMG/M |
| 3300026490|Ga0257153_1023446 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1269 | Open in IMG/M |
| 3300026514|Ga0257168_1105810 | Not Available | 627 | Open in IMG/M |
| 3300026551|Ga0209648_10002342 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 15712 | Open in IMG/M |
| 3300026551|Ga0209648_10027947 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4927 | Open in IMG/M |
| 3300026551|Ga0209648_10046768 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 3724 | Open in IMG/M |
| 3300026551|Ga0209648_10116061 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2169 | Open in IMG/M |
| 3300026555|Ga0179593_1014264 | Not Available | 2035 | Open in IMG/M |
| 3300026557|Ga0179587_10457433 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 835 | Open in IMG/M |
| 3300026557|Ga0179587_10728282 | Not Available | 653 | Open in IMG/M |
| 3300027512|Ga0209179_1006320 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales | 1904 | Open in IMG/M |
| 3300027512|Ga0209179_1017475 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1360 | Open in IMG/M |
| 3300027583|Ga0209527_1090279 | Not Available | 688 | Open in IMG/M |
| 3300027643|Ga0209076_1170707 | Not Available | 604 | Open in IMG/M |
| 3300027651|Ga0209217_1036431 | All Organisms → cellular organisms → Bacteria | 1525 | Open in IMG/M |
| 3300027671|Ga0209588_1099839 | Not Available | 934 | Open in IMG/M |
| 3300027671|Ga0209588_1143685 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 758 | Open in IMG/M |
| 3300027738|Ga0208989_10138154 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Woeseiaceae | 822 | Open in IMG/M |
| 3300027860|Ga0209611_10090063 | All Organisms → cellular organisms → Bacteria | 2111 | Open in IMG/M |
| 3300027860|Ga0209611_10689365 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300027884|Ga0209275_10101885 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1470 | Open in IMG/M |
| 3300027903|Ga0209488_10000129 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 56625 | Open in IMG/M |
| 3300027903|Ga0209488_10001655 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 18977 | Open in IMG/M |
| 3300027903|Ga0209488_10004097 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 11507 | Open in IMG/M |
| 3300027903|Ga0209488_10005668 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 9572 | Open in IMG/M |
| 3300027905|Ga0209415_10194364 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1930 | Open in IMG/M |
| 3300028047|Ga0209526_10017859 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 4931 | Open in IMG/M |
| 3300028047|Ga0209526_10033296 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3626 | Open in IMG/M |
| 3300028379|Ga0268266_10087478 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2726 | Open in IMG/M |
| 3300028379|Ga0268266_10111681 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2422 | Open in IMG/M |
| 3300028381|Ga0268264_10948443 | Not Available | 865 | Open in IMG/M |
| 3300028536|Ga0137415_10386602 | All Organisms → cellular organisms → Bacteria | 1203 | Open in IMG/M |
| 3300028794|Ga0307515_10010000 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 18265 | Open in IMG/M |
| 3300028794|Ga0307515_10879467 | Not Available | 525 | Open in IMG/M |
| 3300029943|Ga0311340_11177736 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 618 | Open in IMG/M |
| 3300029945|Ga0311330_11041773 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 602 | Open in IMG/M |
| 3300030007|Ga0311338_11181717 | Not Available | 727 | Open in IMG/M |
| 3300030521|Ga0307511_10049259 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3414 | Open in IMG/M |
| 3300030739|Ga0302311_10394823 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 975 | Open in IMG/M |
| 3300031023|Ga0073998_11646068 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
| 3300031057|Ga0170834_110899450 | Not Available | 1134 | Open in IMG/M |
| 3300031231|Ga0170824_109493326 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → unclassified Oxalobacteraceae → Oxalobacteraceae bacterium | 1011 | Open in IMG/M |
| 3300031231|Ga0170824_109909184 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3045 | Open in IMG/M |
| 3300031231|Ga0170824_112055077 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1021 | Open in IMG/M |
| 3300031231|Ga0170824_123475576 | All Organisms → cellular organisms → Bacteria | 1657 | Open in IMG/M |
| 3300031250|Ga0265331_10005717 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 7460 | Open in IMG/M |
| 3300031344|Ga0265316_11184061 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300031446|Ga0170820_16581486 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 918 | Open in IMG/M |
| 3300031446|Ga0170820_17579616 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 756 | Open in IMG/M |
| 3300031456|Ga0307513_10101119 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2905 | Open in IMG/M |
| 3300031474|Ga0170818_114311084 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 981 | Open in IMG/M |
| 3300031708|Ga0310686_102556018 | Not Available | 2879 | Open in IMG/M |
| 3300031708|Ga0310686_103418357 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6447 | Open in IMG/M |
| 3300031708|Ga0310686_107946105 | Not Available | 541 | Open in IMG/M |
| 3300031708|Ga0310686_112328845 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 3748 | Open in IMG/M |
| 3300031708|Ga0310686_119416828 | Not Available | 2880 | Open in IMG/M |
| 3300031708|Ga0310686_119446886 | All Organisms → cellular organisms → Bacteria | 4859 | Open in IMG/M |
| 3300031715|Ga0307476_10308351 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1162 | Open in IMG/M |
| 3300031753|Ga0307477_10728727 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter soli | 662 | Open in IMG/M |
| 3300031754|Ga0307475_10349627 | Not Available | 1188 | Open in IMG/M |
| 3300031754|Ga0307475_11062654 | Not Available | 635 | Open in IMG/M |
| 3300031823|Ga0307478_10196844 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1620 | Open in IMG/M |
| 3300031962|Ga0307479_11071911 | All Organisms → cellular organisms → Bacteria | 773 | Open in IMG/M |
| 3300032174|Ga0307470_10005465 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4973 | Open in IMG/M |
| 3300032174|Ga0307470_10035619 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 2415 | Open in IMG/M |
| 3300032180|Ga0307471_101737966 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 777 | Open in IMG/M |
| 3300032180|Ga0307471_103558712 | Not Available | 551 | Open in IMG/M |
| 3300032515|Ga0348332_10689443 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1226 | Open in IMG/M |
| 3300032515|Ga0348332_13351113 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1636 | Open in IMG/M |
| 3300032893|Ga0335069_10452758 | All Organisms → cellular organisms → Bacteria | 1497 | Open in IMG/M |
| 3300034130|Ga0370494_013762 | All Organisms → cellular organisms → Bacteria | 2105 | Open in IMG/M |
| 3300034130|Ga0370494_014464 | All Organisms → cellular organisms → Bacteria | 2052 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 32.29% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.07% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 5.21% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 4.95% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 4.17% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 4.17% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 4.17% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.60% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 2.34% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.34% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.34% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 2.08% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.08% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.82% |
| Host-Associated | Host-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated | 1.82% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.56% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.56% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 1.56% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.04% |
| Ectomycorrhiza | Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza | 1.04% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.78% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.78% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.78% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.52% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.52% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.52% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.52% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.52% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.52% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.52% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.52% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.52% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.26% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.26% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.26% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.26% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Agricultural Soil | 0.26% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.26% |
| Termite Nest | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest | 0.26% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.26% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.26% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.26% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.26% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.26% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.26% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.26% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.26% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.26% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.26% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.26% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.26% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.26% |
| Anaerobic Biogas Reactor | Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Anaerobic Biogas Reactor | 0.26% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.26% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001405 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-1 shallow-072012 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300002886 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm | Environmental | Open in IMG/M |
| 3300002906 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm | Environmental | Open in IMG/M |
| 3300002907 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm | Environmental | Open in IMG/M |
| 3300002910 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm | Environmental | Open in IMG/M |
| 3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
| 3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
| 3300005994 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 | Environmental | Open in IMG/M |
| 3300006169 | Termite nest microbial communities from Madurai, India | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009095 | Agricultural soil microbial communities from Utah to study Nitrogen management - Steer compost 2015 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009500 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fc - Sphagnum magellanicum MG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009659 | Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R1_A C12 SIP DNA | Engineered | Open in IMG/M |
| 3300009709 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fb - Sphagnum magellanicum MG | Host-Associated | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010877 | Boreal forest soil eukaryotic communities from Alaska, USA - W3-2 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014168 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaG | Environmental | Open in IMG/M |
| 3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
| 3300014272 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailB_D1 | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014654 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG | Environmental | Open in IMG/M |
| 3300014655 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaG | Environmental | Open in IMG/M |
| 3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015160 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G7C, Adjacent to main proglacial river, mid transect (Watson river)) | Environmental | Open in IMG/M |
| 3300015206 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G8B, Adjacent to main proglacial river, end of transect (Watson river)) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300019270 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
| 3300020140 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Host-Associated | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025504 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-1 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026285 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026319 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026351 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-05-B | Environmental | Open in IMG/M |
| 3300026482 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-B | Environmental | Open in IMG/M |
| 3300026490 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-A | Environmental | Open in IMG/M |
| 3300026514 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-B | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027583 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027651 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027738 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027860 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fc - Sphagnum magellanicum MG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Host-Associated | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300029945 | I_Bog_N2 coassembly | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Host-Associated | Open in IMG/M |
| 3300030739 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_3 | Environmental | Open in IMG/M |
| 3300031023 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil TCEFA (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Host-Associated | Open in IMG/M |
| 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Host-Associated | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Host-Associated | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300034130 | Peat soil microbial communities from wetlands in Alaska, United States - Collapse_03_16 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI20186J14852_10122522 | 3300001405 | Arctic Peat Soil | MMRLLRPPHIGIFPRSFRLHGTHHAREMIVEICSMWDALATAIITRTGS* |
| JGIcombinedJ26739_1000582744 | 3300002245 | Forest Soil | MMRLLRPPPSGIFLRSFRLHSADYARETIAKSCSLWVALATAIIGQTGSTRQT* |
| JGIcombinedJ26739_1003196111 | 3300002245 | Forest Soil | MMRLLRPPQIGIFLRSFPLHSPHYAPETIAESCSIWVALATAIIGQTGSQ* |
| JGIcombinedJ26739_1006883972 | 3300002245 | Forest Soil | MMRLLRPPPIGIFPRSFRLHGVHHAREMIVEICSMGDALATAIITRTGS |
| C688J35102_1190714962 | 3300002568 | Soil | LTNVRLLRPARSGIFGRSFHLHSIDYARERIAQICSLGASLATAPISQAGS* |
| JGI25612J43240_10251771 | 3300002886 | Grasslands Soil | MMRLLRPPHIGIFPRSLRLHGAHHAREMIVEICSMWDALATAIITRTGS* |
| JGI25614J43888_100517341 | 3300002906 | Grasslands Soil | MMRLLRPPHSGIFLRSFRLHSVHYARETIAKICSLWGALATAIISQTGSKAPRTCS* |
| JGI25613J43889_100321673 | 3300002907 | Grasslands Soil | MMRLLRPPHSGIFLRSFRLHSVHYARETIAKICSLWVALATAIISQTGS* |
| JGI25613J43889_100933882 | 3300002907 | Grasslands Soil | MMRLLRPPHIGIFLRSFHSHSTHYARETIAEICSMWGALVTAIISQTGS* |
| JGI25615J43890_10642232 | 3300002910 | Grasslands Soil | MMRLLRPPPIGRFLRSFHSHSTHYARETIAEICSMGVALVTTPISQTGS* |
| JGI25615J43890_10995681 | 3300002910 | Grasslands Soil | MMRLLRPPHIGIFLRSFHSHXTHYAREMIXEICSMWSALATAIISHTGS* |
| JGI25617J43924_101564772 | 3300002914 | Grasslands Soil | MMRLLRPPHSGIFWRSFRLHSAHYARETIAKICSPWVALATAIISQTGS* |
| JGI25617J43924_102957071 | 3300002914 | Grasslands Soil | MMRLLRPPHIGIFLRSFHSHSTHYARETIAEICSMWRALVTAIISQTGS* |
| JGI25616J43925_100226863 | 3300002917 | Grasslands Soil | MMRLLRPPHIGIFLRSFHSHSTHYAREMIAEICSMWSALATAIISQTGS* |
| JGI25616J43925_101002012 | 3300002917 | Grasslands Soil | MMRLLRPPHSGIFLRSFRLHSAHYVRETIVKICSLWVALATAIISQTGS* |
| JGIcombinedJ51221_100869121 | 3300003505 | Forest Soil | LRPPQIGRFPRSFPLHSQRYAPETIAESSSIRVALATAIISQAGSSPF* |
| Ga0062385_108788562 | 3300004080 | Bog Forest Soil | MMRLLRPPHVGILLRSFHSHSTHYARETIAEICSTRLALVTTPISQTGS* |
| Ga0062384_1001639893 | 3300004082 | Bog Forest Soil | MMRLLRPPHIGIFLRSFHSHSTHYACETIAEICSIWGALATAIISQTGS* |
| Ga0062389_1014717242 | 3300004092 | Bog Forest Soil | MMRLLRPTHIGIFVRSFHSNSTRYARETIAEICSTWVIALRS |
| Ga0062389_1049296381 | 3300004092 | Bog Forest Soil | IGIFLRSFHLHSIHYAREKIAEICSTRVALATAPIGQTGS* |
| Ga0063455_1010499272 | 3300004153 | Soil | RSGIFGRSFHLHSIDYARETIAQSCSLGAALATAPISQTGS* |
| Ga0062388_1002414761 | 3300004635 | Bog Forest Soil | MMRLLRPPHIGIFLRSFHSHSTHYACETIAEICSIWGALATAIISQTGS |
| Ga0062388_1019196632 | 3300004635 | Bog Forest Soil | IGIFLRSFHLHSIHYARETIAEICSTRVALATAPIGQTGS* |
| Ga0070683_1000116897 | 3300005329 | Corn Rhizosphere | MNNDRLLRPPASGTFRRSFPLHSPRYARETIAEICSLAGGLVTAIIIHTGS* |
| Ga0070683_1002240202 | 3300005329 | Corn Rhizosphere | MIRLLRPPPSGIFPRSFRLQSAHYARETIAEICSLGSALATAIIGQPGS* |
| Ga0070683_1003557593 | 3300005329 | Corn Rhizosphere | MRLLRPPPSGIFRRSFPLHSPRYARETIAEICSLGVALATAIPSPTGS* |
| Ga0070670_1002401063 | 3300005331 | Switchgrass Rhizosphere | VRLLRPARSGIFGRSFHLHSVDYARERIAQICSLGASLATAPMSQTGSWLL* |
| Ga0070670_1006451872 | 3300005331 | Switchgrass Rhizosphere | GIFGRSFHLHSIDYARETIAQSCSLGAALATAPISQTGS* |
| Ga0070670_1009063972 | 3300005331 | Switchgrass Rhizosphere | MMRLLRSPRSGIFLRSFRLHSAHYARETIAKICSLWGALATAIISQTGS* |
| Ga0066388_1001550283 | 3300005332 | Tropical Forest Soil | MLHLRRPPHSGIFPRSFRLQSAHYAREMIAQTCSLRVALVTAIISQTGSQVSPEASEHRSR* |
| Ga0068869_1002689501 | 3300005334 | Miscanthus Rhizosphere | LGACLTNMRLLRQPPIGIFRRSFRLHSPRYARETIAEICSMGDCLATAHISQTGS* |
| Ga0070666_100600625 | 3300005335 | Switchgrass Rhizosphere | CLTNVRLLRPARSGIFGRSFHLHSIDYARETIAQSCSLGASLATAPISQTAS* |
| Ga0070666_105053121 | 3300005335 | Switchgrass Rhizosphere | RSGIFGRSFHLHSIDYARETIAQSCSLGAALATAPMSQTGSRA* |
| Ga0070671_10000160414 | 3300005355 | Switchgrass Rhizosphere | MMRLLRPPHSGIFLRSFRLHSPDYARETIAKICSLRVALATAIISQTGS* |
| Ga0070671_1001469041 | 3300005355 | Switchgrass Rhizosphere | SGIFGRSFHLHSIDYARETIAQSCSLGASLATAPISQTAS* |
| Ga0070671_1003275852 | 3300005355 | Switchgrass Rhizosphere | RPARSGIFGRSFHLHSIDYARETIAQSCSLGASLATAPISQAGS* |
| Ga0070671_1020407012 | 3300005355 | Switchgrass Rhizosphere | MDRLLRPPHIGIFRRSFRLHSPHYARETIAEICSMWVALATAPITRTGS* |
| Ga0070667_1006447462 | 3300005367 | Switchgrass Rhizosphere | MANDRLLRPPLSGIFRRSFFLHSPRYARKTIVEICSLRVALATAII |
| Ga0070713_1002181481 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | LLRPPLSGIFRRSFRLHSPRYARETIAETCSLRGALATAIPSPTGS* |
| Ga0070713_1018447782 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MMRLLRPPHSGIFPRSFLLHKPHYARETIAKSCSLWVALATAIISR |
| Ga0070663_1011008411 | 3300005455 | Corn Rhizosphere | RPARSGIFGRSFHLHSIDYARERIAQICSLGASLATAPISQTGS* |
| Ga0070741_100297804 | 3300005529 | Surface Soil | MMRLLRPPPSGIFLRSFPLHSPRYARETIAGICSLGDALATAIISQPGS* |
| Ga0070741_100568791 | 3300005529 | Surface Soil | TPGSGSLLRPFPYIDPRYARETIAAICSLPVVLATAIISQTGS* |
| Ga0070730_106874942 | 3300005537 | Surface Soil | MMRLLRPPHIGRFLRSFHSHSTHYARETIAEICSMWVALATAIISQTGS* |
| Ga0068853_1003189143 | 3300005539 | Corn Rhizosphere | GACLTHVRLLRPARSGIFGRSFHLHSIDYARERIAQICSLRASLATAPMSQTGS* |
| Ga0068853_1003215451 | 3300005539 | Corn Rhizosphere | TTQLGACLTNVRLLRPARSGIFGRSFHLHSIDYARERIAQICSLGASLATAPISQTGSC* |
| Ga0070733_102129442 | 3300005541 | Surface Soil | MMRLLRAPHIGIFPRSFRLHGTHHAREMIVEICSMWDALATAIITRAGS* |
| Ga0070733_103232702 | 3300005541 | Surface Soil | MMRLLRPTHNGRFLRSFRLHSTHYARERIVKICSLWVALATAIISQTGS* |
| Ga0070733_109283712 | 3300005541 | Surface Soil | IGIFLRSFHSHSTHYARETIAEICSTWVALVTAPISQTGS* |
| Ga0070665_1005945702 | 3300005548 | Switchgrass Rhizosphere | LGACLTNVRLLRPARSGIFGRSFHLHSIDYARETIAQSCSLGAALATAPISQTGS* |
| Ga0068855_1006460743 | 3300005563 | Corn Rhizosphere | LAALPVRRMRRTHSGIFGRFFHLHSIDYARERIAQICSLRACLATAPISQTGSRLW* |
| Ga0068855_1017541781 | 3300005563 | Corn Rhizosphere | VTDARLLRPTPNGSFRRSFPLHSARYARETIAEICSL |
| Ga0068855_1018293472 | 3300005563 | Corn Rhizosphere | ACLTNVRLLRPARSGIFGRSFHLHSIDYARERIAQSCSLGASLATAPISQTGS* |
| Ga0068855_1019459402 | 3300005563 | Corn Rhizosphere | MDRLLRPSHIGIFPRSFRLHSPHYARETIAEICSMGGALATVHISQTGS* |
| Ga0068857_1022538082 | 3300005577 | Corn Rhizosphere | GACLTNVRLLRPARSGIFGRSFRLHSMGYARERIARICSLGAALATAPISQTGSRPQLVQLA* |
| Ga0068854_1004444151 | 3300005578 | Corn Rhizosphere | LTNVRLLRPARSGIFGRSFHLHSIDYARETIAQSCSLRAALATAPISQTGS* |
| Ga0068854_1020409782 | 3300005578 | Corn Rhizosphere | MDRLLRPSHIGIFPRSFRLHSPRYARETIAEICSMGDGLATAPISQTGS* |
| Ga0068856_1001504904 | 3300005614 | Corn Rhizosphere | GACLTNVRLLRPARSGIFGRSFHLHSIDYARERIAQSCSLGASLATAPISQTGS* |
| Ga0068856_1008969371 | 3300005614 | Corn Rhizosphere | CLTNVRLLRPSPSGIFGRSFHLHSVDYARERIAQICSLGDALATAPISQTGS* |
| Ga0068856_1009740702 | 3300005614 | Corn Rhizosphere | RLLRPSPSGIFGRSFHLHSIDYARETIAQSCSLRAALATAPISQTGS* |
| Ga0068856_1015911962 | 3300005614 | Corn Rhizosphere | MTDDRLLRPPLSGIFRRSLLLHSTRYARVTIAETCSLRVALATAI |
| Ga0068852_1009048541 | 3300005616 | Corn Rhizosphere | MRLLRPPPSGIFRRSFPLHSPRYARETIAEICSLGVALATAI |
| Ga0068859_1000652501 | 3300005617 | Switchgrass Rhizosphere | SFHLHSVDYARERIAQICSLGASLATAPMSQTGSWLL* |
| Ga0068859_1023114201 | 3300005617 | Switchgrass Rhizosphere | MMRLLRPPPSGIFLRSFRLHSTHYARETIAKICSLWGALATAIISQTGS* |
| Ga0068864_1015715121 | 3300005618 | Switchgrass Rhizosphere | LRPARSGIFGRSFHLHSVDYARERIAQICSLGASLATAPMSQTGSWLL* |
| Ga0070764_100959824 | 3300005712 | Soil | ARLLRPPQLGIFLRSSRLHSPRYARETIAESCSIWVALATAIITQAGS* |
| Ga0068861_1015494692 | 3300005719 | Switchgrass Rhizosphere | PPPVGIFQRSFRLHSPCYARETIAEICSTGVALATAHISQAGS* |
| Ga0068863_1025755622 | 3300005841 | Switchgrass Rhizosphere | TNARLLRPPPSGIFRRSFPLHSPRYARETIAEICSLGVALATAIPNPTGSW* |
| Ga0068858_1000097978 | 3300005842 | Switchgrass Rhizosphere | CLTNVRLLRPARSGIFGRSFHLHSIDYARERIAQICSLGASLATAPISQTGS* |
| Ga0068858_1000153382 | 3300005842 | Switchgrass Rhizosphere | MRILAGLFIARLPGACLTNVRLLRPARSGIFGRSFHLHSIDYARERIAQSCSLGASLATAPISQTGS* |
| Ga0068858_1000611646 | 3300005842 | Switchgrass Rhizosphere | MEGAWLTHVRLLRPARSGIFLRSFHLHSVYYAREMIAKICSLGAGLATAPMSQPGSRSSIPK* |
| Ga0068858_1004247262 | 3300005842 | Switchgrass Rhizosphere | SGIFGRSFHLHSVDYARERIGQICSLGAALATAPISQTGS* |
| Ga0068858_1006366492 | 3300005842 | Switchgrass Rhizosphere | MMRLLRPPPSGIFLRSFRLHSAHYARETIAKICSLGVALATAIISQTGS* |
| Ga0068858_1008200922 | 3300005842 | Switchgrass Rhizosphere | MMRLLRPPLSGIFLRSFPLHSTYYARETIEEICSLRGALATAIMNQTGS* |
| Ga0068858_1010858151 | 3300005842 | Switchgrass Rhizosphere | ARSGIFGRSFHLHSIDYARERIAQICSLGAGLATAPISQTRS* |
| Ga0068860_1014806992 | 3300005843 | Switchgrass Rhizosphere | VTNVHLLRPSPIGILPRSLRLHSADYARETIAAICSMGVALATMPVSHTGSNDMDD* |
| Ga0068862_1003596362 | 3300005844 | Switchgrass Rhizosphere | VSPMRLLRPPLIGIFRRSFRLHSPRYARETIAEICSMADALATVHIDQLGFS* |
| Ga0068862_1022745761 | 3300005844 | Switchgrass Rhizosphere | LRPPHSGIFLRSFRLHSPDYARETIAKICSLRVALATAIISQTGS* |
| Ga0081539_101216072 | 3300005985 | Tabebuia Heterophylla Rhizosphere | MMRVLRPAHIRNFRRSFRLHSTHYARETIAGICSMQDGLATAIITPTGS* |
| Ga0066789_100174652 | 3300005994 | Soil | MIHLLRPSHAGIFLRSFRSHSAHYARETIAEICSPWHALATMTITRTGS* |
| Ga0082029_11298062 | 3300006169 | Termite Nest | ARAAKGACLTNMRLLRQSPVGIFRRSFRLHSPRYARETIAERCSTGDRLATAHISQTGSQGRIEGK* |
| Ga0097621_1007287061 | 3300006237 | Miscanthus Rhizosphere | MRLLRPPLSGIFRRSFRLHSPRYARETIAETCSLR |
| Ga0097621_1017911952 | 3300006237 | Miscanthus Rhizosphere | MDHLLRPPHIGIFRRSFRLHSARYARETIAETCSMWVALATVPITRTGS* |
| Ga0079222_123948802 | 3300006755 | Agricultural Soil | MIRLLRPPHIGIFLRSFPLHSPHYAPETIAETCSMRVALATAIISQTGS* |
| Ga0079221_116016312 | 3300006804 | Agricultural Soil | MMRLLRPPHSGIFPRALPLHSPGYAREALAETCSLWDALATAIIGQTGSESAP* |
| Ga0075434_1011316492 | 3300006871 | Populus Rhizosphere | MRLLRPPPIGIFPRSFRLHSPCYARETIAEICSMGGALATAPISQTGS* |
| Ga0073928_100021912 | 3300006893 | Iron-Sulfur Acid Spring | MMRLLRPPHSGIFLRSFRLHSTHYARETIAKICSL* |
| Ga0073928_103041111 | 3300006893 | Iron-Sulfur Acid Spring | IPGQQVSPADKEPLGACLTNVRLLRPARSGIFLRSFRLHSAHYARETIAKICSLGAALATAPISQTGS* |
| Ga0073928_104577271 | 3300006893 | Iron-Sulfur Acid Spring | MMRLLRPPRSGIFWRSFRLHSAHYARETITKICSLWF |
| Ga0073928_105400552 | 3300006893 | Iron-Sulfur Acid Spring | MRLLRSARNGIFLRSFRLHGIDHARETIAKICSLGAALATAIVTETGS* |
| Ga0073928_105659171 | 3300006893 | Iron-Sulfur Acid Spring | MMRLLRPPHIGIFPRSFRLHGARHAREMSVEICSMWDALATAIIT |
| Ga0073928_111618262 | 3300006893 | Iron-Sulfur Acid Spring | TRSGIFLRSFRLHSARYARERIAKICSLGVGLATAIISQTGS* |
| Ga0073928_111710871 | 3300006893 | Iron-Sulfur Acid Spring | QLGIFLRSFPLHSPRYARKTIAESCSSWVALATAIMDDSGSID* |
| Ga0079218_110021002 | 3300007004 | Agricultural Soil | MIHQLRPPPIGIFPRSFCLRRPHYVRKMIAEICSMWDDLA* |
| Ga0099793_102067381 | 3300007258 | Vadose Zone Soil | MMRLLRPPHIGIFPRSFRLHGAHHAREMIVEICSMWDALATA |
| Ga0099794_100329513 | 3300007265 | Vadose Zone Soil | MMRLLRPPHSGIFWRSFRLHSIHYARETIAKICSLWVVLATAIISQTGSKMLTA* |
| Ga0099794_101885351 | 3300007265 | Vadose Zone Soil | MMRLLRPTHSGSFWRSFRLHSTHYARETIAKICSLWVALATAIIS |
| Ga0099794_104432582 | 3300007265 | Vadose Zone Soil | MMRLLRPPRSGIFLRSFRLHSAHYARETIAKICSLRVALATAIINQTGSYA |
| Ga0099794_105572403 | 3300007265 | Vadose Zone Soil | HLHSAHYARETIAKICSLGVALATAIISQTGSWAASAA* |
| Ga0099795_100001764 | 3300007788 | Vadose Zone Soil | MMRLLRPPHSGIFLRSFRLHGAHHARETIAKICSLWVALATAIISQTGS* |
| Ga0099795_1000051210 | 3300007788 | Vadose Zone Soil | MMRLLRPPDIGIFLRSFHSHSTHYARETIAEICSMWGALVTAIISQTGS |
| Ga0099795_100487171 | 3300007788 | Vadose Zone Soil | MMRLLRPPHIGIFLRSFHSHSTHYARETIAEICSMWGALVTAIISQTGS |
| Ga0099829_105210241 | 3300009038 | Vadose Zone Soil | MMRLLRPPHSGIFWRSFRLHSAHYARETIAKICSLWGALATAIISQTGS* |
| Ga0099829_105693401 | 3300009038 | Vadose Zone Soil | MMRLLRPPHSGIFLRSFRLHSAHYARETIAKICSLWVALATAII |
| Ga0099829_110567951 | 3300009038 | Vadose Zone Soil | SFRLHSAHYARETIAKICSLWVALATAIISQTGS* |
| Ga0099830_113842042 | 3300009088 | Vadose Zone Soil | MMRLLRPTHSGIFLRSFRLHSTHYARETIAKICSLWGALATAIISQTGSKFGS* |
| Ga0099827_114290271 | 3300009090 | Vadose Zone Soil | HSGSFWRSFRLHSTHYARETIAKICSLWVALATAIISQTGS* |
| Ga0105240_111168682 | 3300009093 | Corn Rhizosphere | PARSGIFGRSFHLHSIDYARERIAQICSLGASLATAPMSQTGS* |
| Ga0105240_127831231 | 3300009093 | Corn Rhizosphere | MLVPVIKGATGACLSHVRLLRPARGGIFGRSFRLHSVDYARETIAQICSPGAVLATAP |
| Ga0079224_1006280002 | 3300009095 | Agricultural Soil | MMHLLRPPHIGIFPRSFRLHSYGYVRETIAEICSMWDALATMIITRTRS* |
| Ga0099792_100027241 | 3300009143 | Vadose Zone Soil | GIFLRSFRLHSTHYARETIAKICSLWVALATAIISQTGS* |
| Ga0099792_100035841 | 3300009143 | Vadose Zone Soil | LLRPPHIGIFPRSFRLRGTHHAREMIVEICSMWDALATAIITRTGSKAPISLTGC* |
| Ga0099792_100057836 | 3300009143 | Vadose Zone Soil | MMRLLRPPPIGIFLRSFHSHSTHYARETIAEICSMGVALVTAPISQTGS* |
| Ga0099792_100141236 | 3300009143 | Vadose Zone Soil | MMRLLRPPHSGIFLRSFRLHSTHYARETIAKICSLWVALATAI |
| Ga0099792_106068912 | 3300009143 | Vadose Zone Soil | MMRLLRPTHSGSFWRSFRLHSTHYARETIAKICSLWV |
| Ga0105248_113012441 | 3300009177 | Switchgrass Rhizosphere | GACLTNVRLLRPARSGIFGRSFHLHSVDYARERIGQICSLGAALATAPISQTGS* |
| Ga0116229_103769352 | 3300009500 | Host-Associated | MMRLLRPSHIGIFRRSFRLHSTHYAREMIAEICSIWAALATAIISQTGS* |
| Ga0116229_115588141 | 3300009500 | Host-Associated | MMRLLRPSHIGIFRRSFRLHSTHYAREMIAEICSM |
| Ga0105237_124074291 | 3300009545 | Corn Rhizosphere | LGACLTNVRLLRPSPSGIFGRSFHLHSIDYARETIAQSCSLGAALATAPISQTGS* |
| Ga0105238_109637723 | 3300009551 | Corn Rhizosphere | VTNVRLLRPARSGIFGRSFHLHSIDYARERIAQICSLGAVLATANISHTGSSAV |
| Ga0123328_12546182 | 3300009659 | Anaerobic Biogas Reactor | MMNLLRPPHIGIFPRSFRLHSYGYVRETIAEICSMWDALATMIITRTRS* |
| Ga0116227_103280792 | 3300009709 | Host-Associated | MRLLRPPHIGIFLRSLRSHSTHYAREMIAEICSMRVALTTAIITQTGS* |
| Ga0116227_110075781 | 3300009709 | Host-Associated | AGLSPHIRIFMRSFPLRSHHYAAETIAEICLMSDALATAMIIRTGSWP* |
| Ga0116227_110289131 | 3300009709 | Host-Associated | MRLLRAPHIGIFRRSFRLHSAHYAREMIAEICSMW |
| Ga0099796_100007446 | 3300010159 | Vadose Zone Soil | MMRLLRPPHGGIFLRSFRLHSTHYARETIAKICSLWVALATAIISQTGS* |
| Ga0099796_100206751 | 3300010159 | Vadose Zone Soil | MMRLLRPPHIGIFLRSFHSHSTHYAREMIAEICSMWSALATAIISQTGS |
| Ga0099796_101652841 | 3300010159 | Vadose Zone Soil | MMRLLRPPHIGIFPRSFRLHGVHHAREMIVEICSMWGALATAIISR |
| Ga0126378_126825332 | 3300010361 | Tropical Forest Soil | MMRLLRAPPIGIFRRSFPLHSAHYARETIAETCSMWDALATAIMTQTGSQRVYDP* |
| Ga0105239_103425673 | 3300010375 | Corn Rhizosphere | VRLLRPARSGIFGRSFHLHSIDYARERIAQICSLGASLATAPISQTGS* |
| Ga0105239_117284881 | 3300010375 | Corn Rhizosphere | VTNVRLLRPARSGIFLRLFHLHSIDYARETIAKICSLGAALATAPIRHPGSYPTYRA |
| Ga0105239_134391761 | 3300010375 | Corn Rhizosphere | MHLLRPPPIGIFPRSFRLHRLGYARETIAEICSMAGALATAH |
| Ga0134127_125200492 | 3300010399 | Terrestrial Soil | MRLLRPPLSGIFRRSFRLHSPRYARETIAETCPLRDA |
| Ga0126356_106518792 | 3300010877 | Boreal Forest Soil | FRLHSGNYARETIAKICSLGAALATAILSQTGSW* |
| Ga0137392_100476601 | 3300011269 | Vadose Zone Soil | MMPLLRPPHIGIFPRSFRLHGVHHAREMIVEICSMWDALATAIITRTDFWN* |
| Ga0137392_102932643 | 3300011269 | Vadose Zone Soil | MMRLLRPTRSGIFLRSFHLHSAHYARETIAKICSLGVALATAIISQTGSWAASAA* |
| Ga0137392_113258102 | 3300011269 | Vadose Zone Soil | MMRLLRPPHTGIFLRSFRSHSTHYARKTIAEICSLW |
| Ga0137391_102865453 | 3300011270 | Vadose Zone Soil | MMRLLRPPHVGIFLRSFHSHSTHYARETIAEICSTWVALVTAPISQTGS |
| Ga0137393_100240843 | 3300011271 | Vadose Zone Soil | MMRLLRPPHIGIFPRSFRLHGVHHAREMIVEICSMW |
| Ga0137393_100241402 | 3300011271 | Vadose Zone Soil | MMRLLRPTHSGIFWRSFRLHSAHYARETIAKICSPWVALATAIISQTGS* |
| Ga0137393_101121301 | 3300011271 | Vadose Zone Soil | MMRLLRPPHSGRFWRSFRLHSTPYAREMIAKICSLWGALATAIM |
| Ga0137393_102355462 | 3300011271 | Vadose Zone Soil | MMRLLRPTRSGIFLRSFRLHSAHYARETIAKICSLWVALATAIIGQTGS* |
| Ga0137393_108759502 | 3300011271 | Vadose Zone Soil | MMRLLRPARSGIFLRSFRLHSVDYARETIAKICSLGAVLATAIISQTGS* |
| Ga0137393_115250372 | 3300011271 | Vadose Zone Soil | VRLLRPPRIGIFLRSLRLHSADYARETIAEICSMWVALVTAIISQTGS* |
| Ga0137393_115757582 | 3300011271 | Vadose Zone Soil | MMRLLRPPHSGIFLRSFRLHSAHYARETIAKICSLWVVLATAIISQTGS* |
| Ga0137388_108584572 | 3300012189 | Vadose Zone Soil | MMRLLRTPHSGIFLRSFRLHSTHYARETIAKICSLWGALATAIISQTGSKFGS* |
| Ga0137388_111994902 | 3300012189 | Vadose Zone Soil | MMRLLRPPHSGIFLRSFRLHSAHYARETIAKICSPWVALA |
| Ga0137388_112402351 | 3300012189 | Vadose Zone Soil | MMRLLRPPHSGIFLRSFRLHSAHYARETIAKICSPWVALATAIISQTGS* |
| Ga0137388_115368692 | 3300012189 | Vadose Zone Soil | VTNVRLLRPARSGIFLRSFRLHSVDYARETIAKICSLGAALATAPMSQTGSYVDYMNQD* |
| Ga0137388_116629931 | 3300012189 | Vadose Zone Soil | MMRLLRPPHSGIFLRSFRLHSAHYARETIAKICSPWV |
| Ga0137363_1000169810 | 3300012202 | Vadose Zone Soil | MMRLLRPPHSGIFLRSFRLHSTHYARETIAKICSLWVALATAIISQTGS* |
| Ga0137363_100039715 | 3300012202 | Vadose Zone Soil | MMRLLRPPHSGIFLRSFRLHSAHYARETIVKICSLWVALATAIISQTGS* |
| Ga0137399_104383102 | 3300012203 | Vadose Zone Soil | RLHSAHYARETIAKICSLWVALATAIISQTGSCPVA* |
| Ga0137386_110914382 | 3300012351 | Vadose Zone Soil | MMRLLRPARSGIFLRSFRLHSAHYARETIAKICSLGAVLATAIISQTGSSTFNGTAQV* |
| Ga0137386_111948362 | 3300012351 | Vadose Zone Soil | MRLLRSAHSGIFLRSFRLHSGDYARETIAKICSLGAALATAILSQTGSW* |
| Ga0137385_102173853 | 3300012359 | Vadose Zone Soil | MMRLLRTPHSGIFLRSFRLHSSHYARETIAKICSLWGALATAIISQTGSKFGS* |
| Ga0137385_104630092 | 3300012359 | Vadose Zone Soil | MMRLLRPPRSGIFLRSFRLHSLDYARETIAKICSLRVALATAIISQTGS* |
| Ga0137385_108686772 | 3300012359 | Vadose Zone Soil | LRSFRLHSLDYARETIAKICSLWVALATAIISQTGS* |
| Ga0137360_118492212 | 3300012361 | Vadose Zone Soil | MYGACLTNARLLRPPHSGIFLRSFRLHSAHYARETIAKICSLGVALVTAIIGQTGSSFSG |
| Ga0137361_100390245 | 3300012362 | Vadose Zone Soil | MMRLLRPPHSGIFWRSFRLHSAHYARERIAKICSPWFGLATAIISQTGS* |
| Ga0137361_119080082 | 3300012362 | Vadose Zone Soil | MMRLLRPTRSGIFLRSFRLHSAHYARETIAKICSLWVALATAIISQTGS* |
| Ga0137390_100965253 | 3300012363 | Vadose Zone Soil | MMRLLRPPHSGIFWRSFRLHSAHYARETIAKICSLWVALATAIIG |
| Ga0137390_101202633 | 3300012363 | Vadose Zone Soil | MMRLLRPPHIGIFPRSFRLHGVHHAREMIVEICSM |
| Ga0137390_102603751 | 3300012363 | Vadose Zone Soil | MMRLLRPPHSGIFWRSFRLHSAHYARETIAKICSL |
| Ga0137390_107473913 | 3300012363 | Vadose Zone Soil | LMMRLLRPPHSGIFWRSFRLHSAHYARETIAKICSLCVALATAIISQTGS* |
| Ga0137390_107699851 | 3300012363 | Vadose Zone Soil | GIFLRSFRLHSAHYARETIAKICSLWVALATAIISQTGS* |
| Ga0137398_1000058914 | 3300012683 | Vadose Zone Soil | MMRLLRPPPIGIFLRSFHSHSTHYARETIAEICSMWGALVTAIISQTGSCATEVP* |
| Ga0137398_100051231 | 3300012683 | Vadose Zone Soil | MMRLLRPPHSGIFLRSFRLHSVHYARETIAKICSLWGALATAIIS |
| Ga0137398_100246256 | 3300012683 | Vadose Zone Soil | MMRLLRPPHSGIFLRSFRLHSTHYARETIAKICSLWV |
| Ga0137398_106349362 | 3300012683 | Vadose Zone Soil | FRLHSAHYARETITKICSLWVALATAIISQTGSYDFRHP* |
| Ga0137398_108413342 | 3300012683 | Vadose Zone Soil | GIFLRSFRLHSAHYVRETIVKICSLWVTLVTAPMSQTGSS* |
| Ga0137397_100429963 | 3300012685 | Vadose Zone Soil | MMRLLRPPHIGIFLRSFHSHSTHYARETIAEICSMW |
| Ga0137397_109127642 | 3300012685 | Vadose Zone Soil | WLMMRLLRPPHSGIFLRSFRLHSAHYARETIAKICSL* |
| Ga0137396_111313841 | 3300012918 | Vadose Zone Soil | LRPPHSGIFLRSFRLHSVHYARETIAKICSLWGALATAIISQTGS* |
| Ga0137359_101490401 | 3300012923 | Vadose Zone Soil | MMRLLRPPHIGIFLRSFHSHSTHYARETIAEICSLWGALVTAPISQTGSYRRGTGG* |
| Ga0137413_101342991 | 3300012924 | Vadose Zone Soil | PARSGIFGRSFRLHSAHYARETIAQICSLGAALATAPMSQPGSWQ* |
| Ga0137413_101569403 | 3300012924 | Vadose Zone Soil | LQLGACVTHVRLLRPARSGIFGRSFRLHSAHYARETIAQICSLGAALATAPMSQTGS* |
| Ga0137413_103351262 | 3300012924 | Vadose Zone Soil | GKQVNHGACLTNGRLLRPARSGIFLRSLRLHSVDYARETIAKICSLGAALATAPIGQTGS |
| Ga0137413_103537142 | 3300012924 | Vadose Zone Soil | MIRLLRPPLIGIFRRSFPLHGMSHAPETIAEICSMRVVLATAIISQTGS* |
| Ga0137413_104882172 | 3300012924 | Vadose Zone Soil | HIGIFLRSFHSHSTHYARETIAEICSMWDALVTAIIGQTGSL* |
| Ga0137413_110810082 | 3300012924 | Vadose Zone Soil | QSSGACLTHDRLLRPARSGIFLRSFHLHSIDYARETIAKICSLGAALATAPISQTGS* |
| Ga0137419_101105122 | 3300012925 | Vadose Zone Soil | MMRLLRPTHSGIFLRSFRLHSAHYARETIAKICSLWIALATAIISQTGSK* |
| Ga0137419_101721203 | 3300012925 | Vadose Zone Soil | RLLRPPHIGIFPRSFRLHGAHHAREMIVEICSMWDALATAIITRTGS* |
| Ga0137419_101731772 | 3300012925 | Vadose Zone Soil | MMRLLRPPHSGIFLRSFRLHSVHYARETIAKICSLWGALATAIISQTGS* |
| Ga0137416_100000542 | 3300012927 | Vadose Zone Soil | VIHDRLLRSPRSGIFLRSFRLHSSRYARETIAKICSLWAALATAIMTHTGSCQPSAGDAN |
| Ga0137416_113427951 | 3300012927 | Vadose Zone Soil | MMRLLRAPHIGIFPRSFRLHGAHHAREMIVEICSIWDALATA |
| Ga0137404_100298655 | 3300012929 | Vadose Zone Soil | MMRLLRPPHSGIFWRSFRLHSAHYARETIAKICSLWVALATAIISQTGS* |
| Ga0137404_103977591 | 3300012929 | Vadose Zone Soil | MMRLLRPPHIGIFLRSFHSHSTHYARETIAEICSMWVALATAIISQT |
| Ga0137404_104253491 | 3300012929 | Vadose Zone Soil | MMRLLRTPHSGIFWRSFRLHSAHYARETIAKICSPWVALATAII |
| Ga0137404_104715211 | 3300012929 | Vadose Zone Soil | MMRLLRAPHIGIFPRSFRLHGTHHAREMIVEICSM |
| Ga0137404_104915451 | 3300012929 | Vadose Zone Soil | MMRLLRPTHSGSFWRSFRLHSTHYARETIAKICSLWVIAL |
| Ga0137404_109933782 | 3300012929 | Vadose Zone Soil | QGACLTHVRLLRPARSGIFLRSFRLHSAHYARETIAKICSLGAALATAPISQTGS* |
| Ga0137404_111297921 | 3300012929 | Vadose Zone Soil | MMRLLRPPHIGIFPRSFRLHGVHHAREMIVEICSMWDALATAIITRT |
| Ga0137407_100010573 | 3300012930 | Vadose Zone Soil | MMRLLRPPHSGIFWRSFRLHSAHYARETIAKICSLWGALATAIINQTGSRMLTA* |
| Ga0137407_100287881 | 3300012930 | Vadose Zone Soil | MMRLLRPPHSGIFLRSFRLHSFDYARETIAKICSLWVALATA |
| Ga0137407_110882262 | 3300012930 | Vadose Zone Soil | RLLRPPRSGIFLRSFRLHSNDYARETIAKICSLWVALATAIISQTGS* |
| Ga0137407_114257272 | 3300012930 | Vadose Zone Soil | CLTNVRLLRPARSGIFLRSFHLHSIDYARETIAKICSLGAALATAPISQTGS* |
| Ga0137407_124085142 | 3300012930 | Vadose Zone Soil | MIRLLRPPHIGIFPRSFRLHGTHHAREMIVEICSMWDALA |
| Ga0137410_104286343 | 3300012944 | Vadose Zone Soil | MMRLLRTPHSGIFWRSFRLHSAHYARETIAKICSPWVALAT |
| Ga0137410_105883021 | 3300012944 | Vadose Zone Soil | SGIFLRSFRLHSAHYARETIAKICSLRGALATAPMSHTGSNLEET* |
| Ga0137410_110562613 | 3300012944 | Vadose Zone Soil | VAATRDSSTPGLGACLTNVRLLRPARSGIFLRSFHLHSIDYARETIAKICSLGAALATAPISQTGS |
| Ga0137410_110620052 | 3300012944 | Vadose Zone Soil | GNDRLLRPARSGIFLRSFRLHSAHYARETIAKICSLGAVLATAIITQTGS* |
| Ga0157372_102362531 | 3300013307 | Corn Rhizosphere | GACLTNVRLLRPARSGIFGRSFHLHSIDYARETIAQSCSLRAALATAPISQTGS* |
| Ga0181534_100018711 | 3300014168 | Bog | IGIFLRSFHSHGTHHARETIAEIYSMGGALATAIISQTGS* |
| Ga0181534_100076718 | 3300014168 | Bog | MMHLLRPPHIGIFLRSFHSHGTHHARETIAEIYSMGGALATAI |
| Ga0181534_101675841 | 3300014168 | Bog | MMRLLRPPHIGIFLRSFHSHGTHHARETIAEIYSMGGALATAI |
| Ga0181534_106766322 | 3300014168 | Bog | MMRLLRPSHIGIFLRSFRSHSTHYAREMIAEICSMWIAL |
| Ga0181531_100863942 | 3300014169 | Bog | RLLRPTRSGIFRRSFPLHSPRYAQETIAEICSLGVALATAIITQTGS* |
| Ga0181531_101994062 | 3300014169 | Bog | MRLLRPSHIGIFLRSFRSHSTHYAREMIAEICSMWIALATAIITQTGS* |
| Ga0075327_12649872 | 3300014272 | Natural And Restored Wetlands | MMRLLRLSHIGTFPRSFCLHGHHYARAMIVEICSTWISLATTIMARTGS* |
| Ga0163163_119974321 | 3300014325 | Switchgrass Rhizosphere | ARSGIFGRSFHLHSIDYARETIAQSCSLGASLATAPISQTAS* |
| Ga0163163_125662782 | 3300014325 | Switchgrass Rhizosphere | MMRLLRPPPSGIFLRSFRLHSAHYARETIAKICSLGVALATA |
| Ga0163163_129463732 | 3300014325 | Switchgrass Rhizosphere | MMRLLRPTHIGIFLRSFPLHGPHHARETIAEICSMWVDLATAIISQTGSWPHD |
| Ga0182018_106758121 | 3300014489 | Palsa | MMRLLRPTHIGIFLRSFHSHSTDYARETIAKICSMGVALVTAPISQTG |
| Ga0182024_103014862 | 3300014501 | Permafrost | MMRLLRPPHSGIFLRSFRLHGVHHARETIAKICSLWVALATAIISQTGS* |
| Ga0182024_104041951 | 3300014501 | Permafrost | MMRLLRPPHSGIFLRSFRLHGVHHARETIAKICSLW |
| Ga0182024_107541042 | 3300014501 | Permafrost | MMRLLRPPHSGIFLRSFRLHGAHHARETIAKICSLWVALATAIISQTGS |
| Ga0182024_111707632 | 3300014501 | Permafrost | MMRLLRPPRSGIFLRSFRLHGAHHARETIAKICSLWVALATAIISQTGS |
| Ga0182024_122523051 | 3300014501 | Permafrost | GIFLRSFRLDSSRYARETIAKICSPWFGLATAIISQTGS* |
| Ga0182024_124831491 | 3300014501 | Permafrost | HSGIFLRSFRLHGAHHARETIAKICSLWVALATAIISQTGSSP* |
| Ga0181525_104680293 | 3300014654 | Bog | MMRLLRPSHIGIFLRSFRSHSTHYAREMIAEICSMWIA |
| Ga0181516_104541912 | 3300014655 | Bog | MRALRAPHIGIFRRSFRLHSAHYARERIAEICSMWVALATAPA |
| Ga0181522_102624623 | 3300014657 | Bog | MMRLLRSSHIGIFLRSFRSHSTHYARETIAEICSMWIALATAIITQ |
| Ga0157379_103680832 | 3300014968 | Switchgrass Rhizosphere | LGACLTNVRLLRPARSGIFGRSFHLHSIDYARETIAQSCSLRAALATAPISQTGS* |
| Ga0137411_11315204 | 3300015052 | Vadose Zone Soil | MMRLLRPTHSGIFWRSFRLHSAHYARETIAKICSPWVALATAII |
| Ga0137411_12319131 | 3300015052 | Vadose Zone Soil | MMRLLRPTHSGIFWRSFRLHSAHYARETIAKICSPWVALATAIIN* |
| Ga0137405_13110381 | 3300015053 | Vadose Zone Soil | MMRLLRPPHIGIFLRSFHSHSAHYARETIAEICSMRGAL |
| Ga0167642_10119251 | 3300015160 | Glacier Forefield Soil | LLRPPHSGIFWRSFRLHSTHYARETIAKICSPWLVLATAIISQTGS* |
| Ga0167642_10623322 | 3300015160 | Glacier Forefield Soil | MMRLLRLPHIGIFLRSFHSHSTHYARETIAGSMWVTLATAIMSQTGSLRVLP* |
| Ga0167644_1000008176 | 3300015206 | Glacier Forefield Soil | MMRLLRPPHIGIFLRSFRLHGTHHAREMIAEICSMWDALATAIITRTGS* |
| Ga0167644_100000897 | 3300015206 | Glacier Forefield Soil | MMRLLRPPHIGILLRSFRLHGTHHAREMIAEICSMWDALATAIITRTGS* |
| Ga0167644_100007085 | 3300015206 | Glacier Forefield Soil | MMRLLRPPHSGIFWRSFRLHSTHYARETIAKICSPWLVLATAIISQTGS* |
| Ga0167644_100013141 | 3300015206 | Glacier Forefield Soil | MMRLLRPPHSGIFWRSFRLHSTHYARETIAKICSQWVVLATAIISQTGS* |
| Ga0167644_100021050 | 3300015206 | Glacier Forefield Soil | MMRLLRPPHIGIFLRSFRLHGTRHAREMIAEICSMWVALATAIITRTGS* |
| Ga0167644_100026617 | 3300015206 | Glacier Forefield Soil | MMRLLRPPHIGIFPRSFPSHSTRYARETIVEICSMWVALATAIISQTGS* |
| Ga0167644_100026811 | 3300015206 | Glacier Forefield Soil | MMRLLRPPHIGIFLRSFRLHGTRHAREMIAEICSMWDALATAIITRTGS* |
| Ga0167644_10008521 | 3300015206 | Glacier Forefield Soil | MMRLLRPPHIGIFLRSFRLHGTHHAREMIAEICSMW |
| Ga0167644_100094413 | 3300015206 | Glacier Forefield Soil | MMRLLRPPHIGIFLRSFRLHGTHHAREMIAEICSMRDALATAIITRTGS* |
| Ga0167644_10045207 | 3300015206 | Glacier Forefield Soil | MMRLLRPSRIGIFPRSFRLHGAHHAREMIGEICSMGAALATAIITRSGS* |
| Ga0167644_10064001 | 3300015206 | Glacier Forefield Soil | LRPSRIGIFPRSFRLHGAHHAREMIGEICSMGAALATAIITRTGS* |
| Ga0167644_10085657 | 3300015206 | Glacier Forefield Soil | MMRLLRPPDIGIFLRSFRLHGTHHAREMIAEICSMWDALATAIITQTGS* |
| Ga0167644_10300832 | 3300015206 | Glacier Forefield Soil | MMRLLRPSRIGIFPRSFRLHDAHHAREMIGEICSMGAALATAIITRTDS* |
| Ga0167644_11417152 | 3300015206 | Glacier Forefield Soil | MMRLLRPSRIGIFPRSFRLHGGHHARETIGEICSMGAVLATAIITRTGSLPQ* |
| Ga0137418_101658461 | 3300015241 | Vadose Zone Soil | MMRLLRPPHSGIFLRSFRLHSVHYARETIAKICSLWVALATAIISQT |
| Ga0137409_1000098915 | 3300015245 | Vadose Zone Soil | MMRLLRPPHIGIFLRSFHSHSTHYARETIAEICSMWVALATAIISQTGS* |
| Ga0137409_1000292218 | 3300015245 | Vadose Zone Soil | MMRLLRPPHSGIFRRSFRLHSAHYARETIAKICSPWVALATAIISQT |
| Ga0137409_100220721 | 3300015245 | Vadose Zone Soil | MMRLLRPTHSGIFWRSFRLHSAHYARETIAKICSPWVALATAIISQT |
| Ga0137403_100747373 | 3300015264 | Vadose Zone Soil | MMRLLRPTHSGSFWRSFRLHSTHYARETIAKICSLWVALATAIISQTGS* |
| Ga0137403_105624873 | 3300015264 | Vadose Zone Soil | VAATRDSSTPGLGACLTNVRLLRPARSGIFLRSFHLHSGDYVRETTAQICSLGAAPET |
| Ga0137403_108998841 | 3300015264 | Vadose Zone Soil | IFLRSFHLHSIDYARETIAKICSLGAALATAPMSQTGS* |
| Ga0187819_100167255 | 3300017943 | Freshwater Sediment | MMRLLRPPHIGIFLRSFHSHSTHYARETIAEICSTWDALVTAPISQTGS |
| Ga0181512_15892641 | 3300019270 | Peatland | MRLLRPPHIGIFLRSFPLHSPRYARETIAESCSMWVALA |
| Ga0137408_10544632 | 3300019789 | Vadose Zone Soil | MMRLLRPPHSGIFWRSFRLHSAHYARETIAKICSLWGALATAIINQTGSRMLTA |
| Ga0137408_11838366 | 3300019789 | Vadose Zone Soil | MMRLLRPPHIGIFLRSFHSHSTHYARETIAEICSMWVALATAIISQTASQAGVSIVFSA |
| Ga0193728_12280782 | 3300019890 | Soil | PHSGIFLRSFRLHSAHYARETIAKICSLWGALATAIMSQTGS |
| Ga0179590_10283961 | 3300020140 | Vadose Zone Soil | LMMRLLRPPHGGIFWRSFRLHSAHYARETIAKICSPWVALATAIISQTGS |
| Ga0179592_104408132 | 3300020199 | Vadose Zone Soil | MMRLLRAPHIGIFPRSFRLHGTHHAREMIVEICSMWDALATAIITRTGSLGGS |
| Ga0210403_100072803 | 3300020580 | Soil | MMRLLRPPHIGIFLRSFRLHGTHHAREMIAEICSMWDALATAIITRTGS |
| Ga0210403_100136123 | 3300020580 | Soil | MMRLLRPPHIGIFLRSFRLHGTHHAREMIAEICSMWNALATAIITRTGS |
| Ga0210403_107525102 | 3300020580 | Soil | MMRLLRPSHIGIFLRSFRSHSTHYAREMIAEICSMGDALATAI |
| Ga0210403_114286361 | 3300020580 | Soil | MMRLLRPPHTGIFLRSFHSHSTHYARETIAEICSMWVALVTAP |
| Ga0210395_110864932 | 3300020582 | Soil | MMRLLRPPPIGIFLRSFPLHSYHYAPETIAEICSMGDALAT |
| Ga0210401_107251261 | 3300020583 | Soil | MRLLRPPHIGIFPRSFRLHGDHHAREMIVEICSMWVALGTAI |
| Ga0179596_100488031 | 3300021086 | Vadose Zone Soil | RLLRPPHSGIFLRSFRLHSLDYARETIAKICSLRVALVTAIISQTGS |
| Ga0179596_101560362 | 3300021086 | Vadose Zone Soil | MMRLLRPTRSGIFLRSFRLHSAHYARETIAKICSLWVALATAIIGQTGS |
| Ga0179596_106212151 | 3300021086 | Vadose Zone Soil | MPGVCVTNVRLLRSARSGIFLRSFHFHSIDYARETIAKICSLGAALATAPIGHTDS |
| Ga0179596_107206481 | 3300021086 | Vadose Zone Soil | SGIFCRSFRLHSAHYARETIAKICSLWGALATAIISQTGS |
| Ga0210404_105788001 | 3300021088 | Soil | MLAVARAPPIGILPRSFPLHSPHYARETIAAICSMGGALATAIIGHPGS |
| Ga0210406_101945891 | 3300021168 | Soil | MRLLRPARSGIFLRSFRLHSGNYAPETIAKICSLGAVLATAIMSQTGS |
| Ga0210406_104139212 | 3300021168 | Soil | MMRLLRPPHSGIFLRSFRLHSVDYARETIAKICSLWVALVTAIIGQPGSNVGNLR |
| Ga0210406_107379721 | 3300021168 | Soil | MMRLLRPPHSGIFWRSFRFHSTHYARETIAKICSPCV |
| Ga0210406_110046002 | 3300021168 | Soil | MMRLLRPARSGIFLRSFRLHSGHYARETIAKICSLGAVLATAIISQAGS |
| Ga0210400_100842002 | 3300021170 | Soil | MMRLLRPPHIGIFLRSIRLHGTQHAREMIAEICSVWDALATAIITRAGS |
| Ga0210405_113440342 | 3300021171 | Soil | MMRLLRPPHSGIFWRSFRLHSAHYARETIAKICSPWVAL |
| Ga0210396_110081222 | 3300021180 | Soil | MMRLLRPTRSGIFWRSFRFHSAHYARETIAKICSLGVGLATAIISQTGS |
| Ga0210388_100613972 | 3300021181 | Soil | MMRLLRPPPIGIFLRSFPLHSYHYAPETIAEICSMGDALATAIITRAGS |
| Ga0213876_105798542 | 3300021384 | Plant Roots | MELGACLTNVRLLRPARSGIFGRSFHLHSIDYARERIAQICSLGASLATAPISQTGSYARITLSP |
| Ga0210387_105985061 | 3300021405 | Soil | RSGIFLRSFRLHSVDYARETIAKICSLGAALATAPMSQTGS |
| Ga0210386_100123844 | 3300021406 | Soil | MMRLLRPTRSGIFWRSFRFHSAHYARETMAKICSLGVGLATAIISQTGS |
| Ga0210386_101362243 | 3300021406 | Soil | MMRLLRPPHIGIFPRSFRLHGDHHAREMIVEICSMWVALATAIITRT |
| Ga0210394_100441112 | 3300021420 | Soil | MRLLRPPHIGIFLRSFRLHGTHHAREMIAEICSMWDALATAIITRTGS |
| Ga0210394_100951195 | 3300021420 | Soil | MMRLLRPSHIGIFLRSFRLHGTHHAREMIAEICSMWGALA |
| Ga0210394_101602832 | 3300021420 | Soil | MMRLLRPPHIGIFLRSFRLHGTRHAREMIAEICSMWDALATAIIARTGS |
| Ga0210394_109347972 | 3300021420 | Soil | MMRLLRPSHIGIFPRSFRLHGARHAREMIVEICSMWDALATAIITRTGS |
| Ga0210394_110515841 | 3300021420 | Soil | MMRLLRPPHIGIFPRSFRLHGARHAREMSVEICSM |
| Ga0210391_109080061 | 3300021433 | Soil | RVMMRLLRPPPIGIFLRSFPLHSYHYAPETIAEICSMGDALATAIITRAGS |
| Ga0210410_101559073 | 3300021479 | Soil | MMRLLRPPHIGIFLRSFHSHSTHYARETIAEICSMWVALVT |
| Ga0210410_117918071 | 3300021479 | Soil | LLRPARSGIFLRSFRLHSAHYARETIAKICSLGAVLATAPISQTGS |
| Ga0212123_108455282 | 3300022557 | Iron-Sulfur Acid Spring | MMRLLRPPHSGIFWRSFRLHSAHYARETIAKICSPWGVLATAIISQTGSCARGSHEECVL |
| Ga0179589_100404623 | 3300024288 | Vadose Zone Soil | MMRLLRPPHSGIFLRSFRLHSAHYARETIVKICSLWVIAL |
| Ga0179589_100859673 | 3300024288 | Vadose Zone Soil | FLRSFRFHSAHYVRETIVKICSLWVALATAIISQTGS |
| Ga0179589_102864272 | 3300024288 | Vadose Zone Soil | MMRLLRPPHSGIFWRSFRLHSAHYARETIAKICSPWVALATAIISQT |
| Ga0137417_14749551 | 3300024330 | Vadose Zone Soil | MRLLRPSCSGIFWRSFRLHGIGHARERIAKICSLEA |
| Ga0208356_10282741 | 3300025504 | Arctic Peat Soil | MMRLLRPPHIGIFLRSFRLHGTHHAREMIAEICSMWDALATAI |
| Ga0207680_101494062 | 3300025903 | Switchgrass Rhizosphere | MMRLLRSPRSGIFLRSFRLHSAHYARETIAKICSLWGALATAIISQTGS |
| Ga0207654_107419392 | 3300025911 | Corn Rhizosphere | LGDAFHLHSVDYARERIAQICSLGASLATAPISQTGS |
| Ga0207652_100563092 | 3300025921 | Corn Rhizosphere | MMRLLRPPPIGIFRRSFPLHGDHHAPETIAESCSMGDALATAIISRTGSSDR |
| Ga0207694_106732701 | 3300025924 | Corn Rhizosphere | MTNVRLLRPARSGIFGRSFHLHSADYARERIAQICSLGAGLATAPVSHGGST |
| Ga0207650_118101832 | 3300025925 | Switchgrass Rhizosphere | LPIGVFPRSFRLHRLGYARETIAEICSMGSALATARMGQTGS |
| Ga0207644_100906761 | 3300025931 | Switchgrass Rhizosphere | SLGACLTNVRLLRPARSGIFGRSFHLHSIDYARERIAQICSLGASLATAPISQTGSC |
| Ga0207640_102604192 | 3300025981 | Corn Rhizosphere | RSGIFGRSFHLHSIDYARERIAQICSLGASLATAPISQTGS |
| Ga0207677_100650812 | 3300026023 | Miscanthus Rhizosphere | MHLLRAPPIGIFLRSFRLHRLGYARETIAEICSMGGALATVHISQTGS |
| Ga0207702_120811601 | 3300026078 | Corn Rhizosphere | MTDDRLLRPPLSGIFRRSLLLHSTRYARVTIAETCSLRVALATAIIGHTGS |
| Ga0207641_117884751 | 3300026088 | Switchgrass Rhizosphere | MMRLLRPPPSGIFLRSFRLHSAHYARETIAKICSLGVALA |
| Ga0207675_1001334621 | 3300026118 | Switchgrass Rhizosphere | TDMHLLRQPPIGIFQRSFRLHSPRYARETIAEICSMGDRLATAHISQAGSWSR |
| Ga0207675_1011416763 | 3300026118 | Switchgrass Rhizosphere | MRLLRPSPIGIFQRSFRLHSPCYARETIAEICSMGVALATAHISQAGSSPAAC |
| Ga0209438_10081143 | 3300026285 | Grasslands Soil | MMRLLRPPHSGIFLRSFRLHSAHYARETIVKICSLWVALATAIISQTDS |
| Ga0209438_10152661 | 3300026285 | Grasslands Soil | SGIFWRSFRLHSAHYARETIAKICSPWVALATAIISQTGS |
| Ga0209240_10713542 | 3300026304 | Grasslands Soil | MMRLLRPPHSGIFLRSFRLHSTHYARETIAKICSLWVALATAIISQTGS |
| Ga0209647_13053112 | 3300026319 | Grasslands Soil | MMRLLRPPHSGIFLRSFRLHSVHYARETIAKICSLW |
| Ga0209131_10150673 | 3300026320 | Grasslands Soil | MMRLLRPPHSGIFLRSFRLHSVHYARETIAKICSLWVALATAIISQTGS |
| Ga0209131_10404404 | 3300026320 | Grasslands Soil | MMRLLRPPHSGIFLRSFRLHSAHYVRETIVKICSLWVALATAIISQTGS |
| Ga0257170_10399381 | 3300026351 | Soil | MMRLLRPPHIGIFPRSFRLHGDHHAREMIVEICSMWDALATAII |
| Ga0257172_10060943 | 3300026482 | Soil | MMRLLRPTHSGIFLRSFRLHSAHYARETIAKICSLWIALATAIISQTGSE |
| Ga0257153_10234462 | 3300026490 | Soil | MMRLLRPPHSGIFLRSFRLHSAHYARETIAKICSLWVALATAIISQTGS |
| Ga0257168_11058102 | 3300026514 | Soil | MMRLLRPPHSGIFLRSFRLHSIDYARETIAKICSLWVALATAIISQTGFCRSCRQRTSVPFS |
| Ga0209648_1000234217 | 3300026551 | Grasslands Soil | MMRLLRPTHSGIFLRSFRLHSAHYARETIAKICSLWIALATAIISQTGSK |
| Ga0209648_100279475 | 3300026551 | Grasslands Soil | MMRLLRPPHSGIFWRSFRLHSAHYARETIAKICSLWVALA |
| Ga0209648_100467683 | 3300026551 | Grasslands Soil | MMRLLRPTHSGIFWRSFRLHSAHYARETIAKICSPWVALATAIISQTGS |
| Ga0209648_101160613 | 3300026551 | Grasslands Soil | HSGIFLRSFRLHSAHYARETIAKICSLWVALATAIISQTGS |
| Ga0179593_10142644 | 3300026555 | Vadose Zone Soil | MMRLLRPPHIGIFLRSFHSHSTHYARETIAEICSMWVALATAIISQTGS |
| Ga0179587_104574332 | 3300026557 | Vadose Zone Soil | MMRLLRAPHIGIFPRSFRLHGTHHAREMIVEICSMWDALATAIIT |
| Ga0179587_107282822 | 3300026557 | Vadose Zone Soil | MMRLLRPPHSGIFLRSFRLHSAHYARETIAKICSLWSALATAIIGQTGS |
| Ga0209179_10063203 | 3300027512 | Vadose Zone Soil | MMRLLRPTHSGIFWRSFRLHSAHYARETIAKICSP |
| Ga0209179_10174752 | 3300027512 | Vadose Zone Soil | MMRLLRPPHGGIFLRSFRLHSTHYARETIAKICSLWVALATAIISQTGS |
| Ga0209527_10902792 | 3300027583 | Forest Soil | MMRLLRPPHIGIFPRSFRLHGARHAREMIVEICSMWDALATAIITRTGSRESARRPS |
| Ga0209076_11707072 | 3300027643 | Vadose Zone Soil | MMRLLRPPHSGIFLRSFRLHSVHYARETIAKICSLWV |
| Ga0209217_10364314 | 3300027651 | Forest Soil | MMRLLRRPHIGIFPRSFRLHGVRHAREMIAEICSM |
| Ga0209588_10998391 | 3300027671 | Vadose Zone Soil | MRLLRPPHIGIFPRSFRLHGAHHAREMIVEICSMW |
| Ga0209588_11436851 | 3300027671 | Vadose Zone Soil | LMMRLLRPPHSGIFWRSFRLHSIHYARETIAKICSLWVVLATAIISQTGSKMLTA |
| Ga0208989_101381541 | 3300027738 | Forest Soil | MMRLLRPPHSGIFWRSFRLHSVHYARERIAKICSPWVALATAIISQTGSMLTA |
| Ga0209611_100900633 | 3300027860 | Host-Associated | MMRLLRPSHIGIFRRSFRLHSTHYAREMIAEICSIWAALATAIISQTGS |
| Ga0209611_106893652 | 3300027860 | Host-Associated | MRLLRAPHIGIFRRSFRLHSAHYAREMIAEICSMWVALAT |
| Ga0209275_101018854 | 3300027884 | Soil | MMRLLRPPLSGIFPRSFRLHSACYARETIAKSCSLRVALVTAIMGQT |
| Ga0209488_1000012965 | 3300027903 | Vadose Zone Soil | MMRLLRPPHSGIFLRSFRLHSTHYARETIAKICSLWVALAT |
| Ga0209488_100016558 | 3300027903 | Vadose Zone Soil | MMRLLRPPHSGIFWRSFRLHSIHYARETIAKICSLWVVLATAIISQTGSKMLTA |
| Ga0209488_100040971 | 3300027903 | Vadose Zone Soil | IFLRSFRLHSTHYARETIAKICSLWVALATAIISQTGS |
| Ga0209488_100056688 | 3300027903 | Vadose Zone Soil | MMRLLRPPHSGIFWRSFRLHSAHYAREMIAKICSLWGALATAIMG |
| Ga0209415_101943641 | 3300027905 | Peatlands Soil | PHIGRFLRSFRLHSPCYVRETIAEIGSMWGALATAILSQTGSYVFRIF |
| Ga0209526_100178593 | 3300028047 | Forest Soil | MMRLLRPPPSGIFLRSFRLHSADYARETIAKSCSLWVALATAIIGQTGSTRQT |
| Ga0209526_100332963 | 3300028047 | Forest Soil | MMRLLRPPPSGIFLRSFRLHSAHYARETIAKICSLWVALATAIISQTGS |
| Ga0268266_100874784 | 3300028379 | Switchgrass Rhizosphere | LRPARSGIFGRSFHLHSIDYARETIAQSCSLGAALATAPISQTGS |
| Ga0268266_101116811 | 3300028379 | Switchgrass Rhizosphere | GACLTNVRLLRPARSGIFGRSFHLHSIDYARERIAQICSLGASLATAPISQTGSYEPLASDP |
| Ga0268264_109484432 | 3300028381 | Switchgrass Rhizosphere | MHLLRQPPIGIFQRSFRLHSPRYARETIAEICSMGDRL |
| Ga0137415_103866021 | 3300028536 | Vadose Zone Soil | GIFLRSFRLHSAHYARETIAKICSLWVALATAIISQTGS |
| Ga0307515_100100002 | 3300028794 | Ectomycorrhiza | MEHLLRPPPIGIFRRSFRLHRARYACETIAETCSMGDVLATVPITRTGS |
| Ga0307515_108794671 | 3300028794 | Ectomycorrhiza | MDRLLRPPHIGIFRRSFRLHSAHYARETIAETCSM |
| Ga0311340_111777361 | 3300029943 | Palsa | RPPQLGIFLRSCPLHSLGYAPDTIAETCSIWVALATAIISQSAS |
| Ga0311330_110417731 | 3300029945 | Bog | MRLLRAPHIGIFRRSFRLHSAHYAREMIAEICSMWVALATAPASPTGS |
| Ga0311338_111817171 | 3300030007 | Palsa | PHIGIFLRSFPLHSPHYAPETIAETCSMWVALATAILSQAGS |
| Ga0307511_100492594 | 3300030521 | Ectomycorrhiza | MIRLLRPTRSGIFLRSFRLHSGDYARETIAKSCSLG |
| Ga0302311_103948233 | 3300030739 | Palsa | PHIGIFLRSFPLHSPHYAPETIAETCSMWVALATAILSHTGS |
| Ga0073998_116460682 | 3300031023 | Soil | MMRLLRPTLIGIFLRSFHSHSTHYARETIAEICSMRVALVTAPISQTGSSAQLSVWN |
| Ga0170834_1108994503 | 3300031057 | Forest Soil | LRPARSGIFLRSFRLHSVDYARETIAKICSLGAVLATAPMSQTGS |
| Ga0170824_1094933262 | 3300031231 | Forest Soil | LRPARSGIFLRSFRLHSGDYARETIAKICSLGAVLATAIIGQTGS |
| Ga0170824_1099091842 | 3300031231 | Forest Soil | MMRLLRSSPSGIFPRSFPLHGPRYARETITESCSLEVNLAAAIMGQSGS |
| Ga0170824_1120550772 | 3300031231 | Forest Soil | LRPARSGIFLRSFRLHSVDYARETIAKICSLGAALATAPISQTGS |
| Ga0170824_1234755762 | 3300031231 | Forest Soil | MMRLLRPPHSGILRRSFPLHGNQHAPETIAASCSLWGALATAIITRTGSQR |
| Ga0265331_100057172 | 3300031250 | Rhizosphere | MMRLLRPPPGGIFRRSFPLHSARYARETITEICSPWVALATAIMTQPGS |
| Ga0265316_111840611 | 3300031344 | Rhizosphere | MLRLLRPPRIGRFRRSFPSQSANYAPETIAEIAPMGVVLATAIIGY |
| Ga0170820_165814862 | 3300031446 | Forest Soil | MTNVRLLRPARSGIFLRSFRLHSVHYARETNRENLPGRAGSLGAALATAPMSQTGS |
| Ga0170820_175796161 | 3300031446 | Forest Soil | NVRLLRPARSGIFLRSFRLHSAHYARETIAKICSLGAALATAPMSQTGS |
| Ga0307513_101011193 | 3300031456 | Ectomycorrhiza | MDPLLRPPPIGIFRRSFRLHSAPYARETIAETCSMGDALATTPITRTGS |
| Ga0170818_1143110842 | 3300031474 | Forest Soil | LLRPARSGIFLRSFRLHSVDYARETIAKICSLGAALATAPISQTGS |
| Ga0310686_1025560182 | 3300031708 | Soil | MMHLLRPPPSGIFLRSFRLHSPRYARETIAKICSLGVALATAIISQTGSWH |
| Ga0310686_1034183576 | 3300031708 | Soil | MMRLLRPTRIGIFLQSFHSHSTHYARETIAEICSMGVALVTAPMSQTGS |
| Ga0310686_1079461052 | 3300031708 | Soil | LGACLTNVRLLRPARSGIFLRSFRLHSAHYARETIAKICSLGAVLATAPISQTGS |
| Ga0310686_1123288455 | 3300031708 | Soil | MMRLLRSPHIGIFLRSFPLHSPRYAPKMIAESCSMWSALATAIMTRAGTTRPQETQH |
| Ga0310686_1194168284 | 3300031708 | Soil | MMRQLRPPRIGIFLRSFHLHSAHYAREPIAEICSMGGALVKAPISQTGS |
| Ga0310686_1194468863 | 3300031708 | Soil | MLRLLRPPHSGIFPRSFPLHGTQHAPETIAESCSLWDALATASITRTGS |
| Ga0307476_103083511 | 3300031715 | Hardwood Forest Soil | PPHSGIFLRSFRLHKPHYARETIAEICSLGGALVTAIIGQTGS |
| Ga0307477_107287272 | 3300031753 | Hardwood Forest Soil | MMRLLRPPHIGIFLRSFHSHSTHYARETIAEICSMWGALVTAIISQTGSYELSAPTRIIF |
| Ga0307475_103496271 | 3300031754 | Hardwood Forest Soil | MMRLLRPPHIGIFPRSFRLHGAHHAREMIVEICSMWVALATAIITRTGS |
| Ga0307475_110626541 | 3300031754 | Hardwood Forest Soil | MMRLLRPPHIGIFLRSFHSHSTHYARETIAEICSMWVALVTAIISQTGSCAHVS |
| Ga0307478_101968441 | 3300031823 | Hardwood Forest Soil | MMRLLRPTHSGIFWRSFRLHSAHYARETIAKICSLW |
| Ga0307479_110719112 | 3300031962 | Hardwood Forest Soil | MMRLLRPPHIGIFLRSFHSHSTHYARETIAEICSMWGALVTAIISQTDSWRSR |
| Ga0307470_100054658 | 3300032174 | Hardwood Forest Soil | MMRLLRPPHIGIFLRSFHSHSTHYARETIAEICSMWGALATAIISQTGS |
| Ga0307470_100356192 | 3300032174 | Hardwood Forest Soil | MMRLLRTPHSGIFLRSFRLHSAHYARETIAKICSLWVVLATAIISRTGS |
| Ga0307471_1017379662 | 3300032180 | Hardwood Forest Soil | MMRLLRPPHIGIFLRSFHSHSTHYARETIAEICSIWVGLVT |
| Ga0307471_1035587122 | 3300032180 | Hardwood Forest Soil | MRLLRPPRSGIFWRSFRLHSTHYARETIAKICSLWGALATAIISQT |
| Ga0348332_106894431 | 3300032515 | Plant Litter | MMRLLRPPHIGTFLRSFPLHSTRYARETIAEICSM |
| Ga0348332_133511131 | 3300032515 | Plant Litter | RAGIFLRSFPLHSINYAPETIAESCSTRVALATAIIGQSGSRPNGS |
| Ga0335069_104527582 | 3300032893 | Soil | MNRLLRPPHSGIFPRSFRLQSAHYARETIAEICSLRVALATALISQTGS |
| Ga0370494_013762_90_236 | 3300034130 | Untreated Peat Soil | MRLLRAPHIGIFRRSFRLHSAHYAREMIAEICSMWTALATTIISQTGS |
| Ga0370494_014464_754_903 | 3300034130 | Untreated Peat Soil | MMRLLRSPHISTLLRSFPSHSQRYAPETIAEICSMWNAFATAIITRTGS |
| ⦗Top⦘ |