


| Basic Information | |
|---|---|
| Family ID | F005909 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 386 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MENYEEDITKYPTPDKQYEGAMKYCTYESIQTGAMGKAAK |
| Number of Associated Samples | 219 |
| Number of Associated Scaffolds | 386 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 52.59 % |
| % of genes near scaffold ends (potentially truncated) | 18.13 % |
| % of genes from short scaffolds (< 2000 bps) | 85.75 % |
| Associated GOLD sequencing projects | 200 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.18 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (45.855 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (29.534 % of family members) |
| Environment Ontology (ENVO) | Unclassified (62.435 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (63.472 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 10.29% β-sheet: 0.00% Coil/Unstructured: 89.71% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.18 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 386 Family Scaffolds |
|---|---|---|
| PF01391 | Collagen | 7.51 |
| PF13252 | DUF4043 | 1.04 |
| PF13692 | Glyco_trans_1_4 | 0.52 |
| PF13392 | HNH_3 | 0.52 |
| PF04545 | Sigma70_r4 | 0.52 |
| PF00534 | Glycos_transf_1 | 0.26 |
| PF12705 | PDDEXK_1 | 0.26 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 54.15 % |
| Unclassified | root | N/A | 45.85 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2199352004|2199835893 | All Organisms → Viruses → Predicted Viral | 1252 | Open in IMG/M |
| 3300000206|M3P_c10052057 | Not Available | 634 | Open in IMG/M |
| 3300000268|M3P_10152294 | Not Available | 700 | Open in IMG/M |
| 3300000268|M3P_10166545 | Not Available | 661 | Open in IMG/M |
| 3300000405|LV_Brine_h2_0102DRAFT_1003524 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 3810 | Open in IMG/M |
| 3300000558|Draft_10094638 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 24279 | Open in IMG/M |
| 3300000558|Draft_11518697 | Not Available | 811 | Open in IMG/M |
| 3300000756|JGI12421J11937_10119717 | Not Available | 689 | Open in IMG/M |
| 3300001274|B570J13895_1007227 | All Organisms → Viruses → Predicted Viral | 1261 | Open in IMG/M |
| 3300001274|B570J13895_1021164 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 641 | Open in IMG/M |
| 3300001282|B570J14230_10125350 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 751 | Open in IMG/M |
| 3300002145|S2t7BSb_10110819 | Not Available | 644 | Open in IMG/M |
| 3300002296|B570J29587_1001107 | All Organisms → Viruses → Predicted Viral | 2627 | Open in IMG/M |
| 3300002835|B570J40625_101322955 | Not Available | 598 | Open in IMG/M |
| 3300003277|JGI25908J49247_10024397 | All Organisms → Viruses → Predicted Viral | 1772 | Open in IMG/M |
| 3300003277|JGI25908J49247_10044418 | All Organisms → Viruses → Predicted Viral | 1185 | Open in IMG/M |
| 3300003277|JGI25908J49247_10049630 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1102 | Open in IMG/M |
| 3300003277|JGI25908J49247_10071646 | Not Available | 866 | Open in IMG/M |
| 3300003277|JGI25908J49247_10078078 | Not Available | 820 | Open in IMG/M |
| 3300003277|JGI25908J49247_10096663 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 714 | Open in IMG/M |
| 3300003393|JGI25909J50240_1029521 | All Organisms → Viruses → Predicted Viral | 1210 | Open in IMG/M |
| 3300003394|JGI25907J50239_1017420 | All Organisms → Viruses → Predicted Viral | 1625 | Open in IMG/M |
| 3300003394|JGI25907J50239_1057037 | Not Available | 786 | Open in IMG/M |
| 3300003394|JGI25907J50239_1082685 | Not Available | 631 | Open in IMG/M |
| 3300003412|JGI25912J50252_10086323 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 778 | Open in IMG/M |
| 3300003490|JGI25926J51410_1001600 | All Organisms → Viruses → Predicted Viral | 4469 | Open in IMG/M |
| 3300003490|JGI25926J51410_1030824 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 996 | Open in IMG/M |
| 3300004481|Ga0069718_10066816 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 584 | Open in IMG/M |
| 3300004769|Ga0007748_11571999 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 684 | Open in IMG/M |
| 3300004789|Ga0007752_10873044 | Not Available | 565 | Open in IMG/M |
| 3300004836|Ga0007759_11569375 | Not Available | 525 | Open in IMG/M |
| 3300005069|Ga0071350_1241306 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 628 | Open in IMG/M |
| 3300005420|Ga0068879_1676984 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 558 | Open in IMG/M |
| 3300005517|Ga0070374_10102729 | All Organisms → Viruses → Predicted Viral | 1490 | Open in IMG/M |
| 3300005517|Ga0070374_10134255 | All Organisms → Viruses → Predicted Viral | 1286 | Open in IMG/M |
| 3300005517|Ga0070374_10188013 | All Organisms → Viruses → Predicted Viral | 1065 | Open in IMG/M |
| 3300005517|Ga0070374_10195663 | All Organisms → Viruses → Predicted Viral | 1041 | Open in IMG/M |
| 3300005517|Ga0070374_10367593 | Not Available | 725 | Open in IMG/M |
| 3300005525|Ga0068877_10417835 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 754 | Open in IMG/M |
| 3300005525|Ga0068877_10707889 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 539 | Open in IMG/M |
| 3300005527|Ga0068876_10064996 | All Organisms → Viruses → Predicted Viral | 2205 | Open in IMG/M |
| 3300005527|Ga0068876_10090914 | All Organisms → Viruses → Predicted Viral | 1826 | Open in IMG/M |
| 3300005527|Ga0068876_10156387 | All Organisms → Viruses → Predicted Viral | 1338 | Open in IMG/M |
| 3300005527|Ga0068876_10371987 | Not Available | 800 | Open in IMG/M |
| 3300005527|Ga0068876_10386791 | Not Available | 782 | Open in IMG/M |
| 3300005580|Ga0049083_10009938 | All Organisms → Viruses → Predicted Viral | 3486 | Open in IMG/M |
| 3300005581|Ga0049081_10000839 | All Organisms → cellular organisms → Bacteria | 11691 | Open in IMG/M |
| 3300005581|Ga0049081_10098173 | All Organisms → Viruses → Predicted Viral | 1093 | Open in IMG/M |
| 3300005581|Ga0049081_10102500 | All Organisms → Viruses → Predicted Viral | 1066 | Open in IMG/M |
| 3300005581|Ga0049081_10188425 | Not Available | 743 | Open in IMG/M |
| 3300005581|Ga0049081_10234997 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 647 | Open in IMG/M |
| 3300005581|Ga0049081_10240771 | Not Available | 637 | Open in IMG/M |
| 3300005581|Ga0049081_10350698 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 500 | Open in IMG/M |
| 3300005582|Ga0049080_10247142 | Not Available | 583 | Open in IMG/M |
| 3300005583|Ga0049085_10046527 | All Organisms → Viruses → Predicted Viral | 1570 | Open in IMG/M |
| 3300005583|Ga0049085_10067138 | All Organisms → Viruses → Predicted Viral | 1266 | Open in IMG/M |
| 3300005583|Ga0049085_10091067 | All Organisms → Viruses → Predicted Viral | 1059 | Open in IMG/M |
| 3300005584|Ga0049082_10035275 | All Organisms → Viruses → Predicted Viral | 1753 | Open in IMG/M |
| 3300005584|Ga0049082_10052807 | All Organisms → Viruses → Predicted Viral | 1425 | Open in IMG/M |
| 3300005584|Ga0049082_10054021 | All Organisms → Viruses → Predicted Viral | 1409 | Open in IMG/M |
| 3300005584|Ga0049082_10185607 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 715 | Open in IMG/M |
| 3300006639|Ga0079301_1155045 | Not Available | 675 | Open in IMG/M |
| 3300006805|Ga0075464_10385479 | Not Available | 850 | Open in IMG/M |
| 3300007304|Ga0102689_1649454 | Not Available | 655 | Open in IMG/M |
| 3300007538|Ga0099851_1021137 | All Organisms → Viruses → Predicted Viral | 2631 | Open in IMG/M |
| 3300007538|Ga0099851_1059385 | All Organisms → Viruses → Predicted Viral | 1493 | Open in IMG/M |
| 3300007538|Ga0099851_1074288 | Not Available | 1314 | Open in IMG/M |
| 3300007540|Ga0099847_1192605 | Not Available | 596 | Open in IMG/M |
| 3300007542|Ga0099846_1172417 | Not Available | 772 | Open in IMG/M |
| 3300007544|Ga0102861_1172703 | Not Available | 590 | Open in IMG/M |
| 3300007559|Ga0102828_1116901 | Not Available | 656 | Open in IMG/M |
| 3300007559|Ga0102828_1201105 | Not Available | 511 | Open in IMG/M |
| 3300007670|Ga0102862_1051951 | Not Available | 996 | Open in IMG/M |
| 3300007708|Ga0102859_1233720 | Not Available | 550 | Open in IMG/M |
| 3300007972|Ga0105745_1216893 | Not Available | 606 | Open in IMG/M |
| 3300007992|Ga0105748_10432717 | Not Available | 570 | Open in IMG/M |
| 3300008055|Ga0108970_10389555 | All Organisms → Viruses → Predicted Viral | 1694 | Open in IMG/M |
| 3300008107|Ga0114340_1060154 | All Organisms → Viruses → Predicted Viral | 1632 | Open in IMG/M |
| 3300008107|Ga0114340_1069577 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 1485 | Open in IMG/M |
| 3300008107|Ga0114340_1087469 | All Organisms → Viruses → Predicted Viral | 1272 | Open in IMG/M |
| 3300008107|Ga0114340_1117236 | Not Available | 1037 | Open in IMG/M |
| 3300008107|Ga0114340_1131927 | Not Available | 949 | Open in IMG/M |
| 3300008107|Ga0114340_1144066 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 888 | Open in IMG/M |
| 3300008107|Ga0114340_1206546 | Not Available | 652 | Open in IMG/M |
| 3300008108|Ga0114341_10396506 | Not Available | 670 | Open in IMG/M |
| 3300008110|Ga0114343_1066854 | All Organisms → Viruses → Predicted Viral | 1332 | Open in IMG/M |
| 3300008110|Ga0114343_1078661 | All Organisms → Viruses → Predicted Viral | 1190 | Open in IMG/M |
| 3300008110|Ga0114343_1130386 | Not Available | 829 | Open in IMG/M |
| 3300008110|Ga0114343_1174899 | Not Available | 653 | Open in IMG/M |
| 3300008114|Ga0114347_1098928 | All Organisms → Viruses → Predicted Viral | 1132 | Open in IMG/M |
| 3300008114|Ga0114347_1150230 | Not Available | 836 | Open in IMG/M |
| 3300008116|Ga0114350_1177248 | Not Available | 552 | Open in IMG/M |
| 3300008117|Ga0114351_1112413 | All Organisms → Viruses → Predicted Viral | 1566 | Open in IMG/M |
| 3300008119|Ga0114354_1133554 | Not Available | 944 | Open in IMG/M |
| 3300008120|Ga0114355_1093144 | All Organisms → Viruses → Predicted Viral | 1206 | Open in IMG/M |
| 3300008259|Ga0114841_1186541 | Not Available | 770 | Open in IMG/M |
| 3300008261|Ga0114336_1025416 | All Organisms → Viruses → Predicted Viral | 3361 | Open in IMG/M |
| 3300008261|Ga0114336_1144281 | All Organisms → Viruses → Predicted Viral | 1062 | Open in IMG/M |
| 3300008262|Ga0114337_1199108 | Not Available | 817 | Open in IMG/M |
| 3300008262|Ga0114337_1211022 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 780 | Open in IMG/M |
| 3300008264|Ga0114353_1233032 | Not Available | 834 | Open in IMG/M |
| 3300008266|Ga0114363_1042003 | All Organisms → Viruses → Predicted Viral | 1864 | Open in IMG/M |
| 3300008450|Ga0114880_1009386 | All Organisms → Viruses → Predicted Viral | 4879 | Open in IMG/M |
| 3300008450|Ga0114880_1132726 | Not Available | 920 | Open in IMG/M |
| 3300009056|Ga0102860_1219385 | Not Available | 547 | Open in IMG/M |
| 3300009068|Ga0114973_10420324 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → Micavibrio → unclassified Micavibrio → Micavibrio sp. TMED2 | 698 | Open in IMG/M |
| 3300009075|Ga0105090_10774651 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 583 | Open in IMG/M |
| 3300009081|Ga0105098_10018510 | Not Available | 2643 | Open in IMG/M |
| 3300009081|Ga0105098_10066135 | All Organisms → Viruses → Predicted Viral | 1502 | Open in IMG/M |
| 3300009081|Ga0105098_10151893 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1040 | Open in IMG/M |
| 3300009081|Ga0105098_10472192 | Not Available | 635 | Open in IMG/M |
| 3300009081|Ga0105098_10521642 | Not Available | 608 | Open in IMG/M |
| 3300009082|Ga0105099_10404817 | Not Available | 815 | Open in IMG/M |
| 3300009085|Ga0105103_10091451 | Not Available | 1573 | Open in IMG/M |
| 3300009085|Ga0105103_10486665 | Not Available | 691 | Open in IMG/M |
| 3300009152|Ga0114980_10063748 | Not Available | 2223 | Open in IMG/M |
| 3300009155|Ga0114968_10185287 | All Organisms → Viruses → Predicted Viral | 1215 | Open in IMG/M |
| 3300009159|Ga0114978_10026248 | Not Available | 4209 | Open in IMG/M |
| 3300009165|Ga0105102_10140107 | All Organisms → Viruses → Predicted Viral | 1171 | Open in IMG/M |
| 3300009165|Ga0105102_10288918 | Not Available | 846 | Open in IMG/M |
| 3300009165|Ga0105102_10325950 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 801 | Open in IMG/M |
| 3300009165|Ga0105102_10344549 | Not Available | 781 | Open in IMG/M |
| 3300009165|Ga0105102_10391724 | Not Available | 736 | Open in IMG/M |
| 3300009165|Ga0105102_10795509 | Not Available | 538 | Open in IMG/M |
| 3300009168|Ga0105104_10463056 | Not Available | 710 | Open in IMG/M |
| 3300009168|Ga0105104_10738283 | Not Available | 568 | Open in IMG/M |
| 3300009169|Ga0105097_10286416 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 909 | Open in IMG/M |
| 3300009169|Ga0105097_10863569 | Not Available | 518 | Open in IMG/M |
| 3300009170|Ga0105096_10164743 | All Organisms → Viruses → Predicted Viral | 1117 | Open in IMG/M |
| 3300009170|Ga0105096_10425064 | Not Available | 686 | Open in IMG/M |
| 3300009170|Ga0105096_10741097 | Not Available | 523 | Open in IMG/M |
| 3300009181|Ga0114969_10275346 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1002 | Open in IMG/M |
| 3300009194|Ga0114983_1026266 | Not Available | 1495 | Open in IMG/M |
| 3300009419|Ga0114982_1219868 | Not Available | 589 | Open in IMG/M |
| 3300009419|Ga0114982_1279001 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 523 | Open in IMG/M |
| 3300009451|Ga0127402_1047553 | Not Available | 941 | Open in IMG/M |
| 3300009466|Ga0126448_1002894 | All Organisms → Viruses → Predicted Viral | 4756 | Open in IMG/M |
| 3300010388|Ga0136551_1018446 | All Organisms → Viruses → Predicted Viral | 1372 | Open in IMG/M |
| 3300010965|Ga0138308_192287 | All Organisms → Viruses → Predicted Viral | 1056 | Open in IMG/M |
| 3300011183|Ga0136713_1061253 | Not Available | 505 | Open in IMG/M |
| 3300011339|Ga0153700_10221 | Not Available | 30188 | Open in IMG/M |
| 3300012702|Ga0157596_1054992 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 546 | Open in IMG/M |
| 3300012706|Ga0157627_1121462 | Not Available | 569 | Open in IMG/M |
| 3300012707|Ga0157623_1117670 | Not Available | 559 | Open in IMG/M |
| 3300012710|Ga0157550_1148191 | All Organisms → Viruses → Predicted Viral | 3082 | Open in IMG/M |
| 3300012714|Ga0157601_1226718 | Not Available | 677 | Open in IMG/M |
| 3300012716|Ga0157605_1255228 | All Organisms → Viruses → Predicted Viral | 1106 | Open in IMG/M |
| 3300012719|Ga0157600_1092258 | Not Available | 624 | Open in IMG/M |
| 3300012720|Ga0157613_1203412 | Not Available | 941 | Open in IMG/M |
| 3300012752|Ga0157629_1080569 | Not Available | 522 | Open in IMG/M |
| 3300013004|Ga0164293_10129992 | Not Available | 1895 | Open in IMG/M |
| 3300013004|Ga0164293_10980935 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 528 | Open in IMG/M |
| 3300013005|Ga0164292_10218530 | All Organisms → Viruses → Predicted Viral | 1345 | Open in IMG/M |
| 3300013014|Ga0164295_10313901 | All Organisms → Viruses → Predicted Viral | 1183 | Open in IMG/M |
| 3300013310|Ga0157622_1154889 | Not Available | 784 | Open in IMG/M |
| 3300013372|Ga0177922_10302718 | Not Available | 779 | Open in IMG/M |
| 3300017700|Ga0181339_1034241 | Not Available | 555 | Open in IMG/M |
| 3300017701|Ga0181364_1020365 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1093 | Open in IMG/M |
| 3300017701|Ga0181364_1045035 | Not Available | 698 | Open in IMG/M |
| 3300017701|Ga0181364_1065405 | Not Available | 559 | Open in IMG/M |
| 3300017707|Ga0181363_1042384 | Not Available | 833 | Open in IMG/M |
| 3300017716|Ga0181350_1067643 | Not Available | 922 | Open in IMG/M |
| 3300017722|Ga0181347_1136543 | Not Available | 677 | Open in IMG/M |
| 3300017722|Ga0181347_1140979 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 663 | Open in IMG/M |
| 3300017723|Ga0181362_1031966 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1120 | Open in IMG/M |
| 3300017723|Ga0181362_1045914 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 914 | Open in IMG/M |
| 3300017723|Ga0181362_1122794 | Not Available | 508 | Open in IMG/M |
| 3300017736|Ga0181365_1039768 | All Organisms → Viruses → Predicted Viral | 1183 | Open in IMG/M |
| 3300017736|Ga0181365_1073017 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 845 | Open in IMG/M |
| 3300017754|Ga0181344_1163007 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300017761|Ga0181356_1171093 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 661 | Open in IMG/M |
| 3300017761|Ga0181356_1184115 | Not Available | 628 | Open in IMG/M |
| 3300017761|Ga0181356_1227497 | Not Available | 540 | Open in IMG/M |
| 3300017761|Ga0181356_1238870 | Not Available | 522 | Open in IMG/M |
| 3300017766|Ga0181343_1113001 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 767 | Open in IMG/M |
| 3300017777|Ga0181357_1131359 | Not Available | 933 | Open in IMG/M |
| 3300017777|Ga0181357_1200530 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 713 | Open in IMG/M |
| 3300017777|Ga0181357_1204159 | Not Available | 704 | Open in IMG/M |
| 3300017777|Ga0181357_1258826 | Not Available | 602 | Open in IMG/M |
| 3300017778|Ga0181349_1110884 | All Organisms → Viruses → Predicted Viral | 1019 | Open in IMG/M |
| 3300017780|Ga0181346_1154587 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 856 | Open in IMG/M |
| 3300017784|Ga0181348_1052227 | All Organisms → Viruses → Predicted Viral | 1670 | Open in IMG/M |
| 3300017784|Ga0181348_1214695 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 682 | Open in IMG/M |
| 3300017785|Ga0181355_1381720 | Not Available | 513 | Open in IMG/M |
| 3300019122|Ga0188839_1010900 | All Organisms → Viruses → Predicted Viral | 1053 | Open in IMG/M |
| 3300019784|Ga0181359_1012974 | All Organisms → Viruses → Predicted Viral | 3025 | Open in IMG/M |
| 3300019784|Ga0181359_1019496 | All Organisms → Viruses → Predicted Viral | 2555 | Open in IMG/M |
| 3300019784|Ga0181359_1038280 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1858 | Open in IMG/M |
| 3300019784|Ga0181359_1046210 | All Organisms → Viruses → Predicted Viral | 1683 | Open in IMG/M |
| 3300019784|Ga0181359_1070325 | All Organisms → Viruses → Predicted Viral | 1326 | Open in IMG/M |
| 3300019784|Ga0181359_1073946 | All Organisms → Viruses → Predicted Viral | 1286 | Open in IMG/M |
| 3300019784|Ga0181359_1085160 | All Organisms → Viruses → Predicted Viral | 1179 | Open in IMG/M |
| 3300019784|Ga0181359_1117829 | Not Available | 953 | Open in IMG/M |
| 3300019784|Ga0181359_1132832 | Not Available | 875 | Open in IMG/M |
| 3300019784|Ga0181359_1142820 | Not Available | 830 | Open in IMG/M |
| 3300019784|Ga0181359_1150310 | Not Available | 799 | Open in IMG/M |
| 3300019784|Ga0181359_1169846 | Not Available | 730 | Open in IMG/M |
| 3300019784|Ga0181359_1191819 | Not Available | 665 | Open in IMG/M |
| 3300019784|Ga0181359_1192160 | Not Available | 664 | Open in IMG/M |
| 3300019784|Ga0181359_1229264 | Not Available | 578 | Open in IMG/M |
| 3300019784|Ga0181359_1243341 | Not Available | 550 | Open in IMG/M |
| 3300019784|Ga0181359_1268680 | Not Available | 507 | Open in IMG/M |
| 3300020151|Ga0211736_10752987 | Not Available | 656 | Open in IMG/M |
| 3300020160|Ga0211733_10949850 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 9883 | Open in IMG/M |
| 3300020162|Ga0211735_10910819 | Not Available | 557 | Open in IMG/M |
| 3300020172|Ga0211729_11073630 | Not Available | 874 | Open in IMG/M |
| 3300020205|Ga0211731_10955271 | All Organisms → Viruses → Predicted Viral | 1287 | Open in IMG/M |
| 3300020205|Ga0211731_11742314 | All Organisms → Viruses → Predicted Viral | 1341 | Open in IMG/M |
| 3300020498|Ga0208050_1002820 | All Organisms → Viruses → Predicted Viral | 2280 | Open in IMG/M |
| 3300020498|Ga0208050_1013857 | Not Available | 876 | Open in IMG/M |
| 3300020505|Ga0208088_1008883 | All Organisms → Viruses → Predicted Viral | 1428 | Open in IMG/M |
| 3300020527|Ga0208232_1002326 | All Organisms → Viruses → Predicted Viral | 3380 | Open in IMG/M |
| 3300020529|Ga0208233_1010891 | All Organisms → Viruses → Predicted Viral | 1309 | Open in IMG/M |
| 3300020530|Ga0208235_1024916 | Not Available | 727 | Open in IMG/M |
| 3300020530|Ga0208235_1037010 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 578 | Open in IMG/M |
| 3300020533|Ga0208364_1004136 | All Organisms → Viruses → Predicted Viral | 2537 | Open in IMG/M |
| 3300020549|Ga0207942_1002341 | All Organisms → Viruses → Predicted Viral | 3215 | Open in IMG/M |
| 3300020551|Ga0208360_1029175 | Not Available | 719 | Open in IMG/M |
| 3300020553|Ga0208855_1036367 | Not Available | 671 | Open in IMG/M |
| 3300020554|Ga0208599_1025008 | Not Available | 943 | Open in IMG/M |
| 3300020556|Ga0208486_1004217 | All Organisms → Viruses → Predicted Viral | 2387 | Open in IMG/M |
| 3300021961|Ga0222714_10058250 | All Organisms → Viruses → Predicted Viral | 2628 | Open in IMG/M |
| 3300021961|Ga0222714_10127174 | All Organisms → Viruses → Predicted Viral | 1564 | Open in IMG/M |
| 3300022176|Ga0212031_1079077 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 560 | Open in IMG/M |
| 3300022190|Ga0181354_1000944 | Not Available | 5804 | Open in IMG/M |
| 3300022190|Ga0181354_1007359 | All Organisms → Viruses → Predicted Viral | 3078 | Open in IMG/M |
| 3300022190|Ga0181354_1036809 | All Organisms → Viruses → Predicted Viral | 1614 | Open in IMG/M |
| 3300022190|Ga0181354_1108483 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 899 | Open in IMG/M |
| 3300022190|Ga0181354_1121851 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 837 | Open in IMG/M |
| 3300022190|Ga0181354_1151981 | Not Available | 723 | Open in IMG/M |
| 3300022190|Ga0181354_1173246 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 661 | Open in IMG/M |
| 3300022190|Ga0181354_1178739 | Not Available | 646 | Open in IMG/M |
| 3300022190|Ga0181354_1196214 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 604 | Open in IMG/M |
| 3300022190|Ga0181354_1215533 | Not Available | 564 | Open in IMG/M |
| 3300022200|Ga0196901_1006491 | Not Available | 5140 | Open in IMG/M |
| 3300022200|Ga0196901_1008030 | All Organisms → cellular organisms → Bacteria | 4574 | Open in IMG/M |
| 3300022200|Ga0196901_1089911 | Not Available | 1083 | Open in IMG/M |
| 3300022407|Ga0181351_1026125 | All Organisms → Viruses → Predicted Viral | 2480 | Open in IMG/M |
| 3300022407|Ga0181351_1061485 | All Organisms → Viruses → Predicted Viral | 1542 | Open in IMG/M |
| 3300022407|Ga0181351_1128955 | Not Available | 938 | Open in IMG/M |
| 3300022407|Ga0181351_1155117 | All Organisms → cellular organisms → Bacteria | 818 | Open in IMG/M |
| 3300022407|Ga0181351_1163408 | Not Available | 786 | Open in IMG/M |
| 3300022407|Ga0181351_1173133 | Not Available | 752 | Open in IMG/M |
| 3300022407|Ga0181351_1176819 | Not Available | 739 | Open in IMG/M |
| 3300022407|Ga0181351_1211809 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 637 | Open in IMG/M |
| 3300022407|Ga0181351_1240422 | Not Available | 572 | Open in IMG/M |
| 3300022407|Ga0181351_1246988 | Not Available | 558 | Open in IMG/M |
| 3300022752|Ga0214917_10234184 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 871 | Open in IMG/M |
| 3300023174|Ga0214921_10174795 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 1397 | Open in IMG/M |
| 3300023301|Ga0209414_1000547 | Not Available | 17960 | Open in IMG/M |
| 3300024348|Ga0244776_10742516 | Not Available | 601 | Open in IMG/M |
| 3300024569|Ga0255243_1164080 | Not Available | 535 | Open in IMG/M |
| 3300025646|Ga0208161_1026387 | Not Available | 2101 | Open in IMG/M |
| 3300026454|Ga0256319_1110827 | Not Available | 536 | Open in IMG/M |
| 3300026568|Ga0255240_1129260 | Not Available | 555 | Open in IMG/M |
| 3300027124|Ga0255116_1027846 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 783 | Open in IMG/M |
| 3300027131|Ga0255066_1064625 | Not Available | 513 | Open in IMG/M |
| 3300027132|Ga0255110_1016622 | All Organisms → Viruses → Predicted Viral | 1309 | Open in IMG/M |
| 3300027141|Ga0255076_1084455 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 516 | Open in IMG/M |
| 3300027151|Ga0255063_1019994 | All Organisms → Viruses → Predicted Viral | 1406 | Open in IMG/M |
| 3300027365|Ga0209300_1037358 | Not Available | 908 | Open in IMG/M |
| 3300027499|Ga0208788_1125517 | Not Available | 584 | Open in IMG/M |
| 3300027581|Ga0209651_1211524 | Not Available | 503 | Open in IMG/M |
| 3300027586|Ga0208966_1069722 | Not Available | 985 | Open in IMG/M |
| 3300027608|Ga0208974_1071036 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 966 | Open in IMG/M |
| 3300027608|Ga0208974_1098823 | Not Available | 780 | Open in IMG/M |
| 3300027627|Ga0208942_1048429 | All Organisms → Viruses → Predicted Viral | 1308 | Open in IMG/M |
| 3300027659|Ga0208975_1025057 | All Organisms → Viruses → Predicted Viral | 1933 | Open in IMG/M |
| 3300027659|Ga0208975_1085924 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 926 | Open in IMG/M |
| 3300027675|Ga0209077_1163235 | Not Available | 622 | Open in IMG/M |
| 3300027679|Ga0209769_1062721 | All Organisms → Viruses → Predicted Viral | 1235 | Open in IMG/M |
| 3300027689|Ga0209551_1055835 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1307 | Open in IMG/M |
| 3300027693|Ga0209704_1042061 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1236 | Open in IMG/M |
| 3300027693|Ga0209704_1154041 | Not Available | 666 | Open in IMG/M |
| 3300027693|Ga0209704_1164967 | Not Available | 643 | Open in IMG/M |
| 3300027707|Ga0209443_1177565 | Not Available | 760 | Open in IMG/M |
| 3300027720|Ga0209617_10332918 | Not Available | 563 | Open in IMG/M |
| (restricted) 3300027728|Ga0247836_1072978 | All Organisms → Viruses → Predicted Viral | 1801 | Open in IMG/M |
| 3300027732|Ga0209442_1100000 | All Organisms → Viruses → Predicted Viral | 1169 | Open in IMG/M |
| 3300027736|Ga0209190_1003758 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 10017 | Open in IMG/M |
| 3300027754|Ga0209596_1187695 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 890 | Open in IMG/M |
| 3300027756|Ga0209444_10255495 | Not Available | 609 | Open in IMG/M |
| 3300027764|Ga0209134_10164921 | Not Available | 763 | Open in IMG/M |
| 3300027764|Ga0209134_10258929 | Not Available | 595 | Open in IMG/M |
| 3300027785|Ga0209246_10114004 | All Organisms → Viruses → Predicted Viral | 1061 | Open in IMG/M |
| 3300027785|Ga0209246_10203918 | Not Available | 772 | Open in IMG/M |
| 3300027793|Ga0209972_10001161 | Not Available | 23719 | Open in IMG/M |
| 3300027793|Ga0209972_10351387 | Not Available | 637 | Open in IMG/M |
| 3300027797|Ga0209107_10149659 | All Organisms → Viruses → Predicted Viral | 1194 | Open in IMG/M |
| 3300027797|Ga0209107_10162072 | All Organisms → Viruses → Predicted Viral | 1134 | Open in IMG/M |
| 3300027797|Ga0209107_10203002 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 977 | Open in IMG/M |
| 3300027797|Ga0209107_10259715 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 832 | Open in IMG/M |
| 3300027797|Ga0209107_10448735 | Not Available | 580 | Open in IMG/M |
| 3300027805|Ga0209229_10000121 | Not Available | 28740 | Open in IMG/M |
| 3300027805|Ga0209229_10039120 | All Organisms → Viruses → Predicted Viral | 2096 | Open in IMG/M |
| 3300027808|Ga0209354_10134283 | All Organisms → Viruses → Predicted Viral | 1010 | Open in IMG/M |
| 3300027808|Ga0209354_10250433 | Not Available | 711 | Open in IMG/M |
| 3300027808|Ga0209354_10251770 | Not Available | 709 | Open in IMG/M |
| 3300027808|Ga0209354_10340342 | Not Available | 592 | Open in IMG/M |
| 3300027816|Ga0209990_10000126 | Not Available | 75858 | Open in IMG/M |
| 3300027816|Ga0209990_10225309 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 861 | Open in IMG/M |
| 3300027900|Ga0209253_10305961 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1233 | Open in IMG/M |
| 3300027973|Ga0209298_10331455 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 586 | Open in IMG/M |
| (restricted) 3300027977|Ga0247834_1244680 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 648 | Open in IMG/M |
| 3300028025|Ga0247723_1000178 | Not Available | 40473 | Open in IMG/M |
| 3300028025|Ga0247723_1000189 | Not Available | 39697 | Open in IMG/M |
| 3300028025|Ga0247723_1001216 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 15504 | Open in IMG/M |
| 3300028025|Ga0247723_1012026 | All Organisms → Viruses → Predicted Viral | 3277 | Open in IMG/M |
| 3300028025|Ga0247723_1024715 | All Organisms → Viruses → Predicted Viral | 1969 | Open in IMG/M |
| 3300028025|Ga0247723_1038843 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1432 | Open in IMG/M |
| 3300028025|Ga0247723_1099952 | Not Available | 733 | Open in IMG/M |
| 3300028085|Ga0255255_1087835 | Not Available | 532 | Open in IMG/M |
| (restricted) 3300028569|Ga0247843_1024866 | Not Available | 4440 | Open in IMG/M |
| (restricted) 3300028569|Ga0247843_1053328 | All Organisms → Viruses → Predicted Viral | 2232 | Open in IMG/M |
| 3300031673|Ga0307377_11055266 | Not Available | 542 | Open in IMG/M |
| 3300031707|Ga0315291_10089519 | All Organisms → Viruses → Predicted Viral | 3348 | Open in IMG/M |
| 3300031707|Ga0315291_10111832 | All Organisms → Viruses → Predicted Viral | 2925 | Open in IMG/M |
| 3300031707|Ga0315291_10221144 | All Organisms → Viruses → Predicted Viral | 1914 | Open in IMG/M |
| 3300031707|Ga0315291_10544933 | All Organisms → Viruses → Predicted Viral | 1065 | Open in IMG/M |
| 3300031707|Ga0315291_10589800 | All Organisms → Viruses → Predicted Viral | 1010 | Open in IMG/M |
| 3300031707|Ga0315291_10805922 | Not Available | 817 | Open in IMG/M |
| 3300031707|Ga0315291_11202460 | Not Available | 620 | Open in IMG/M |
| 3300031758|Ga0315907_10263044 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1427 | Open in IMG/M |
| 3300031772|Ga0315288_10363547 | All Organisms → Viruses → Predicted Viral | 1482 | Open in IMG/M |
| 3300031784|Ga0315899_10726322 | Not Available | 919 | Open in IMG/M |
| 3300031784|Ga0315899_10962251 | Not Available | 763 | Open in IMG/M |
| 3300031784|Ga0315899_10968159 | Not Available | 760 | Open in IMG/M |
| 3300031787|Ga0315900_10234941 | All Organisms → Viruses → Predicted Viral | 1583 | Open in IMG/M |
| 3300031787|Ga0315900_10421184 | All Organisms → Viruses → Predicted Viral | 1044 | Open in IMG/M |
| 3300031787|Ga0315900_10642528 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 765 | Open in IMG/M |
| 3300031857|Ga0315909_10204364 | All Organisms → Viruses → Predicted Viral | 1562 | Open in IMG/M |
| 3300031857|Ga0315909_10239767 | All Organisms → Viruses → Predicted Viral | 1401 | Open in IMG/M |
| 3300031857|Ga0315909_10271349 | All Organisms → Viruses → Predicted Viral | 1287 | Open in IMG/M |
| 3300031857|Ga0315909_10299051 | All Organisms → Viruses → Predicted Viral | 1204 | Open in IMG/M |
| 3300031857|Ga0315909_10541061 | Not Available | 793 | Open in IMG/M |
| 3300031885|Ga0315285_10853561 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 563 | Open in IMG/M |
| 3300031951|Ga0315904_10002621 | All Organisms → cellular organisms → Bacteria | 27579 | Open in IMG/M |
| 3300031951|Ga0315904_10058091 | All Organisms → Viruses → Predicted Viral | 4270 | Open in IMG/M |
| 3300031951|Ga0315904_10267186 | All Organisms → Viruses → Predicted Viral | 1625 | Open in IMG/M |
| 3300032050|Ga0315906_10815382 | Not Available | 729 | Open in IMG/M |
| 3300032092|Ga0315905_10192531 | All Organisms → Viruses → Predicted Viral | 2012 | Open in IMG/M |
| 3300032093|Ga0315902_10465395 | All Organisms → Viruses → Predicted Viral | 1114 | Open in IMG/M |
| 3300032093|Ga0315902_11085134 | Not Available | 590 | Open in IMG/M |
| 3300032118|Ga0315277_10849384 | Not Available | 855 | Open in IMG/M |
| 3300032164|Ga0315283_12198795 | Not Available | 543 | Open in IMG/M |
| 3300032275|Ga0315270_11060938 | Not Available | 538 | Open in IMG/M |
| 3300032516|Ga0315273_10292949 | All Organisms → Viruses → Predicted Viral | 2210 | Open in IMG/M |
| 3300033816|Ga0334980_0097011 | All Organisms → Viruses → Predicted Viral | 1227 | Open in IMG/M |
| 3300033978|Ga0334977_0538573 | Not Available | 528 | Open in IMG/M |
| 3300033980|Ga0334981_0208873 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 904 | Open in IMG/M |
| 3300033996|Ga0334979_0110246 | All Organisms → Viruses → Predicted Viral | 1703 | Open in IMG/M |
| 3300033996|Ga0334979_0487274 | Not Available | 669 | Open in IMG/M |
| 3300034012|Ga0334986_0138882 | All Organisms → Viruses → Predicted Viral | 1414 | Open in IMG/M |
| 3300034012|Ga0334986_0165619 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1263 | Open in IMG/M |
| 3300034018|Ga0334985_0277461 | All Organisms → Viruses → Predicted Viral | 1061 | Open in IMG/M |
| 3300034022|Ga0335005_0048726 | All Organisms → Viruses → Predicted Viral | 2862 | Open in IMG/M |
| 3300034022|Ga0335005_0223562 | All Organisms → Viruses → Predicted Viral | 1156 | Open in IMG/M |
| 3300034061|Ga0334987_0070262 | All Organisms → Viruses → Predicted Viral | 2802 | Open in IMG/M |
| 3300034062|Ga0334995_0086536 | All Organisms → Viruses → Predicted Viral | 2419 | Open in IMG/M |
| 3300034063|Ga0335000_0442070 | Not Available | 763 | Open in IMG/M |
| 3300034068|Ga0334990_0012017 | All Organisms → cellular organisms → Bacteria | 4623 | Open in IMG/M |
| 3300034071|Ga0335028_0056894 | All Organisms → cellular organisms → Archaea | 2638 | Open in IMG/M |
| 3300034071|Ga0335028_0116719 | All Organisms → Viruses → Predicted Viral | 1732 | Open in IMG/M |
| 3300034082|Ga0335020_0446050 | Not Available | 619 | Open in IMG/M |
| 3300034093|Ga0335012_0405737 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 665 | Open in IMG/M |
| 3300034093|Ga0335012_0509752 | Not Available | 569 | Open in IMG/M |
| 3300034095|Ga0335022_0201163 | All Organisms → Viruses → Predicted Viral | 1193 | Open in IMG/M |
| 3300034095|Ga0335022_0306148 | Not Available | 898 | Open in IMG/M |
| 3300034101|Ga0335027_0193854 | All Organisms → Viruses → Predicted Viral | 1449 | Open in IMG/M |
| 3300034101|Ga0335027_0835907 | Not Available | 530 | Open in IMG/M |
| 3300034102|Ga0335029_0622129 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 601 | Open in IMG/M |
| 3300034103|Ga0335030_0215765 | All Organisms → Viruses → Predicted Viral | 1328 | Open in IMG/M |
| 3300034103|Ga0335030_0375903 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 929 | Open in IMG/M |
| 3300034104|Ga0335031_0034168 | All Organisms → Viruses → Predicted Viral | 3700 | Open in IMG/M |
| 3300034104|Ga0335031_0107498 | All Organisms → Viruses → Predicted Viral | 1962 | Open in IMG/M |
| 3300034105|Ga0335035_0492916 | Not Available | 672 | Open in IMG/M |
| 3300034112|Ga0335066_0099434 | All Organisms → Viruses → Predicted Viral | 1840 | Open in IMG/M |
| 3300034112|Ga0335066_0283606 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 943 | Open in IMG/M |
| 3300034112|Ga0335066_0623391 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 555 | Open in IMG/M |
| 3300034120|Ga0335056_0663853 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 532 | Open in IMG/M |
| 3300034121|Ga0335058_0189621 | All Organisms → Viruses → Predicted Viral | 1202 | Open in IMG/M |
| 3300034122|Ga0335060_0124429 | All Organisms → Viruses → Predicted Viral | 1527 | Open in IMG/M |
| 3300034200|Ga0335065_0140998 | All Organisms → Viruses → Predicted Viral | 1611 | Open in IMG/M |
| 3300034272|Ga0335049_0548271 | Not Available | 727 | Open in IMG/M |
| 3300034283|Ga0335007_0261011 | All Organisms → Viruses → Predicted Viral | 1160 | Open in IMG/M |
| 3300034284|Ga0335013_0661173 | Not Available | 602 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 29.53% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 15.29% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 6.74% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 6.48% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 5.70% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 4.92% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 3.37% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 3.89% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 2.85% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 2.33% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 2.07% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.81% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.81% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 1.81% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 1.55% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 1.55% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 1.30% |
| Lotic | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Lotic | 0.78% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 0.52% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.52% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.52% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.52% |
| Hypersaline | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Unclassified → Hypersaline | 0.52% |
| Meromictic Pond | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Meromictic Pond | 0.52% |
| Hydrocarbon Resource Environments | Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments | 0.52% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 0.26% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment | 0.26% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.26% |
| Lake Chemocline | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake Chemocline | 0.26% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.26% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.26% |
| Pond Fresh Water | Environmental → Aquatic → Freshwater → Pond → Unclassified → Pond Fresh Water | 0.26% |
| Marine | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Marine | 0.26% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.26% |
| Estuary | Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary | 0.26% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2199352004 | Freshwater microbial communities from Lake Mendota, WI - Practice 15JUN2010 epilimnion | Environmental | Open in IMG/M |
| 3300000206 | Lotic microbial communities from Mississippi River at two locations in the state of Minnesota, sample from River Site 1, Mississippi Headwaters | Environmental | Open in IMG/M |
| 3300000268 | Lotic microbial communities from Mississippi River at two locations in the state of Minnesota, sample from River Site 1, Mississippi Headwaters ver2 | Environmental | Open in IMG/M |
| 3300000405 | Hypersaline microbial communities from Lake Vida, Antarctica - sample: Brine Hole Two 0.1-0.2 micron | Environmental | Open in IMG/M |
| 3300000558 | Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - West In Pit SyncrudeMLSB2011 | Engineered | Open in IMG/M |
| 3300000756 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 | Environmental | Open in IMG/M |
| 3300001274 | Freshwater microbial communities from Lake Mendota, WI - Practice 15JUN2010 epilimnion | Environmental | Open in IMG/M |
| 3300001282 | Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnion | Environmental | Open in IMG/M |
| 3300002145 | S2t7BSb (114f) | Environmental | Open in IMG/M |
| 3300002296 | Freshwater microbial communities from Lake Mendota, WI - 02JUN2012 deep hole epilimnion | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300003393 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD | Environmental | Open in IMG/M |
| 3300003394 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN | Environmental | Open in IMG/M |
| 3300003412 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD | Environmental | Open in IMG/M |
| 3300003490 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN | Environmental | Open in IMG/M |
| 3300004481 | Combined Assembly of Gp0112041, Gp0112042, Gp0112043 | Environmental | Open in IMG/M |
| 3300004769 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004789 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SD (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004836 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005069 | Metagenomes from Harmful Algal Blooms in Lake Erie, HABS-E2014-0024 | Environmental | Open in IMG/M |
| 3300005420 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
| 3300005525 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaG | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005580 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300005583 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF | Environmental | Open in IMG/M |
| 3300005584 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF | Environmental | Open in IMG/M |
| 3300006639 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 | Environmental | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007304 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
| 3300007544 | Estuarine microbial communities from the Columbia River estuary - metaG 1449B-3 | Environmental | Open in IMG/M |
| 3300007559 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 | Environmental | Open in IMG/M |
| 3300007670 | Estuarine microbial communities from the Columbia River estuary - metaG 1449C-3 | Environmental | Open in IMG/M |
| 3300007708 | Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02 | Environmental | Open in IMG/M |
| 3300007972 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460ABC_3.0um | Environmental | Open in IMG/M |
| 3300007992 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461AB_0.2um | Environmental | Open in IMG/M |
| 3300008055 | Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393 | Host-Associated | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008108 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA | Environmental | Open in IMG/M |
| 3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
| 3300008114 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NA | Environmental | Open in IMG/M |
| 3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
| 3300008117 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008119 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0110-C-NA | Environmental | Open in IMG/M |
| 3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
| 3300008259 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0132-C-NA | Environmental | Open in IMG/M |
| 3300008261 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NA | Environmental | Open in IMG/M |
| 3300008262 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-C-NA | Environmental | Open in IMG/M |
| 3300008264 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-53-LTR | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009056 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-3 | Environmental | Open in IMG/M |
| 3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009075 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm March2015 | Environmental | Open in IMG/M |
| 3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300009082 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
| 3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
| 3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300009170 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
| 3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009194 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 RT | Environmental | Open in IMG/M |
| 3300009419 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT | Environmental | Open in IMG/M |
| 3300009451 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 8m depth; DNA IDBA-UD | Environmental | Open in IMG/M |
| 3300009466 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 2m depth; DNA IDBA-UD | Environmental | Open in IMG/M |
| 3300010388 | Freshwater microbial communities from the surface of the forest pond in Jussy, Geneva, Switzerland - JEBV, may 2015 | Environmental | Open in IMG/M |
| 3300010965 | Microbial communities from Lake Cadagno chemocline, Switzerland. Combined Assembly of Gp0156211, Gp0156621 | Environmental | Open in IMG/M |
| 3300011183 | Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA - JTO22cm metaG | Environmental | Open in IMG/M |
| 3300011339 | Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Hannam | Environmental | Open in IMG/M |
| 3300012702 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES114 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012706 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES159 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012707 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES154 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012710 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES041 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012714 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES125 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012716 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES130 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012719 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES123 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012720 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES141 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012752 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES162 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
| 3300013014 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES006 metaG | Environmental | Open in IMG/M |
| 3300013310 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES153 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300017700 | Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.D.D | Environmental | Open in IMG/M |
| 3300017701 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017707 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MLB.S.N | Environmental | Open in IMG/M |
| 3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
| 3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
| 3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
| 3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300019122 | Metatranscriptome of marine microbial communities from Baltic Sea - GS677_0p1 | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
| 3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
| 3300020162 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1 | Environmental | Open in IMG/M |
| 3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
| 3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
| 3300020498 | Freshwater microbial communities from Lake Mendota, WI - 13JUN2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020505 | Freshwater microbial communities from Lake Mendota, WI - 02APR2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020527 | Freshwater microbial communities from Lake Mendota, WI - 24AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020529 | Freshwater microbial communities from Lake Mendota, WI - 07SEP2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020530 | Freshwater microbial communities from Lake Mendota, WI - 22OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020533 | Freshwater microbial communities from Lake Mendota, WI - 08JUN2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020549 | Freshwater microbial communities from Lake Mendota, WI - 12OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020551 | Freshwater microbial communities from Lake Mendota, WI - 27JUL2010 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
| 3300020553 | Freshwater microbial communities from Lake Mendota, WI - 17MAY2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020554 | Freshwater microbial communities from Lake Mendota, WI - 17AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020556 | Freshwater microbial communities from Lake Mendota, WI - 03AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300022176 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v2) | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
| 3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
| 3300023301 | Hypersaline microbial communities from Lake Vida, Antarctica - Brine Hole Two >0.2 micron (SPAdes) | Environmental | Open in IMG/M |
| 3300024348 | 0.2um to 3um size fraction coassembly | Environmental | Open in IMG/M |
| 3300024569 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepB_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025646 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026454 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Colum_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026568 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepC_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300027124 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Law_RepC_8h | Environmental | Open in IMG/M |
| 3300027131 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepA_8h | Environmental | Open in IMG/M |
| 3300027132 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Miss_RepC_8h | Environmental | Open in IMG/M |
| 3300027141 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepB_8h | Environmental | Open in IMG/M |
| 3300027151 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepA_0h | Environmental | Open in IMG/M |
| 3300027365 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 RT (SPAdes) | Environmental | Open in IMG/M |
| 3300027499 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 (SPAdes) | Environmental | Open in IMG/M |
| 3300027581 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027586 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027627 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027675 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027679 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027689 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027693 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027707 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DCMD (SPAdes) | Environmental | Open in IMG/M |
| 3300027720 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027728 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_14m | Environmental | Open in IMG/M |
| 3300027732 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027736 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027756 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027764 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027793 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027797 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
| 3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027816 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027900 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes) | Environmental | Open in IMG/M |
| 3300027973 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027977 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_12m | Environmental | Open in IMG/M |
| 3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
| 3300028085 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Colum_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028569 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2017_8m | Environmental | Open in IMG/M |
| 3300031673 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-3 | Environmental | Open in IMG/M |
| 3300031707 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20 | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031772 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20 | Environmental | Open in IMG/M |
| 3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031885 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_36 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
| 3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
| 3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
| 3300032118 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_15 | Environmental | Open in IMG/M |
| 3300032164 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0 | Environmental | Open in IMG/M |
| 3300032275 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_bottom | Environmental | Open in IMG/M |
| 3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
| 3300033816 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Sep2004-rr0005 | Environmental | Open in IMG/M |
| 3300033978 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME28Sep2014-rr0002 | Environmental | Open in IMG/M |
| 3300033980 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME09Aug2015-rr0007 | Environmental | Open in IMG/M |
| 3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
| 3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
| 3300034018 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME04Jul2014-rr0021 | Environmental | Open in IMG/M |
| 3300034022 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Apr2018-rr0058 | Environmental | Open in IMG/M |
| 3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034063 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Oct2008D10-rr0053 | Environmental | Open in IMG/M |
| 3300034068 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Apr2016-rr0031 | Environmental | Open in IMG/M |
| 3300034071 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Oct2008D10-rr0110 | Environmental | Open in IMG/M |
| 3300034082 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088 | Environmental | Open in IMG/M |
| 3300034093 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072 | Environmental | Open in IMG/M |
| 3300034095 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Feb2014D0-rr0091 | Environmental | Open in IMG/M |
| 3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
| 3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
| 3300034103 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Sep2002-rr0119 | Environmental | Open in IMG/M |
| 3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
| 3300034105 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15May2014-rr0127 | Environmental | Open in IMG/M |
| 3300034112 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191 | Environmental | Open in IMG/M |
| 3300034120 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2014-rr0172 | Environmental | Open in IMG/M |
| 3300034121 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19May2015-rr0174 | Environmental | Open in IMG/M |
| 3300034122 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2014-rr0181 | Environmental | Open in IMG/M |
| 3300034200 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2013-rr0190 | Environmental | Open in IMG/M |
| 3300034272 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2017-rr0156 | Environmental | Open in IMG/M |
| 3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
| 3300034284 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jul2016-rr0075 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| 2200016563 | 2199352004 | Freshwater | MENYEEDLTKYPTPDKQYEGAMKYCTYESIQTGAMGKSAK |
| M3P_100520571 | 3300000206 | Lotic | EEEVMENYEEDITKYPTPDKQYDGAKKYETYESLQTGAMGKSAK* |
| M3P_101522943 | 3300000268 | Lotic | MENYEEDITKYPTPDKQYDGAKKYETYESLQTGAMGKSAK* |
| M3P_101665451 | 3300000268 | Lotic | MENYSEDITKYPTPDKQYDGAKKYETYESLQTGALGKAAK* |
| LV_Brine_h2_0102DRAFT_10035246 | 3300000405 | Hypersaline | MDYPMQMEMEQEIAKYPTPDNQYESAMKYCTYESIQTGAMGKITK* |
| Draft_1009463814 | 3300000558 | Hydrocarbon Resource Environments | MENYSEDITKYPTPDKQYDGAKKYETYESLQTGAMGKAAK* |
| Draft_115186973 | 3300000558 | Hydrocarbon Resource Environments | MENYGKMEMSEDITKYPTPDKQYEGAMKYCTYESIQTGAMGKAAK* |
| JGI12421J11937_101197173 | 3300000756 | Freshwater And Sediment | MENYEEDITKYPTPDKQYDGAKKYETYESIQTGANGKAAK* |
| B570J13895_10072274 | 3300001274 | Freshwater | MENYKEEEITKYPTPDKQYDGAKKYETYESIQTGAMGKSAK* |
| B570J13895_10211643 | 3300001274 | Freshwater | MENYEEDLTKYPTPDKQYEGAMKYCTYESIQTGAMGKSAK* |
| B570J14230_101253501 | 3300001282 | Freshwater | MENYEEDLTKYPTPDKQYEGAMKYCTYESIQTGAMGKSA |
| S2t7BSb_101108192 | 3300002145 | Marine | MHKMSYEEYFEKYPTPELQYENAMKYCTYESIETGAPGKMA* |
| B570J29587_10011075 | 3300002296 | Freshwater | MENYSEDITKYPTPDKQYEAAMKYCTYESLQTGAMGKAAK* |
| B570J40625_1013229552 | 3300002835 | Freshwater | MENYSKMENESDEYITKYPTPDKQYAGAMKYCTYESIQTGAMGKAAK* |
| JGI25908J49247_100243971 | 3300003277 | Freshwater Lake | MDNXTEDITKYPTPDKQYEGAMKYETYESLQTGAMGKETK* |
| JGI25908J49247_100444182 | 3300003277 | Freshwater Lake | MENYTEDITKYPTPDKQYEGAMKYETYESIQTGAQGKAC* |
| JGI25908J49247_100496304 | 3300003277 | Freshwater Lake | MDNYTQEDITKYPTPDKQYEGAKKYETYESIQTGAQGKAC* |
| JGI25908J49247_100716464 | 3300003277 | Freshwater Lake | DEELCYEEDGKEEVMDNYTEEDITKYPTPDKQYESAMKYCTYESIQTGAQGKAC* |
| JGI25908J49247_100780783 | 3300003277 | Freshwater Lake | MENYTEEVTKYPTPDKQYEAAMKYCTYESVQTGAQGKNC* |
| JGI25908J49247_100966631 | 3300003277 | Freshwater Lake | MMDNYTEEDITKYPTPDKQYAAAMKYCTYESIQTGAMGKAA |
| JGI25909J50240_10295211 | 3300003393 | Freshwater Lake | MMDNYTEEDIAKYPTPDKQYEGAMKYCTYESIQTGAQGKAC* |
| JGI25907J50239_10174205 | 3300003394 | Freshwater Lake | MDNYTEEDITKYPTPDKQYEGAKKYETYESIQTGAQGKAC* |
| JGI25907J50239_10570373 | 3300003394 | Freshwater Lake | MDNYTEDITKYPTPDKQYEGAMKYETYESLQTGAMGKETK* |
| JGI25907J50239_10826853 | 3300003394 | Freshwater Lake | MTENYTEESITKYPTPDKQYEGTKKYETYESVQTGAQGKAC* |
| JGI25912J50252_100863231 | 3300003412 | Freshwater Lake | MDNYTEEDITKYPTPDKQYESAMKYETYESIQTGAQGKAC* |
| JGI25926J51410_10016001 | 3300003490 | Freshwater Lake | MENYEEDITKYPTPDKQYEGAMKFQSYESVQTGAPGKKAK* |
| JGI25926J51410_10308244 | 3300003490 | Freshwater Lake | MENYTEEITKYPTPDKQYASAMKYCTYESIQTGAQGKAC* |
| Ga0069718_100668162 | 3300004481 | Sediment | MENYAKMESDEYITKYPTPDKQYEGAMKYCTYESIQTGAMGKAAK* |
| Ga0007748_115719993 | 3300004769 | Freshwater Lake | MMENYTEDITKYPTPDKQYEAAMKYCTYESIQTGAQGKAC* |
| Ga0007752_108730441 | 3300004789 | Freshwater Lake | MENYTEEITKYPTPDKQYEAAMKYCTYESVQTGAQGKNC* |
| Ga0007759_115693752 | 3300004836 | Freshwater Lake | MMENYTEDIAKYPTPDKQYEAAMKYCTYESIQTGAQGKAC* |
| Ga0071350_12413062 | 3300005069 | Freshwater | MENYSEDITKYPTPDKQYDGAKKYETYESLQTGAMGKSAK* |
| Ga0068879_16769841 | 3300005420 | Freshwater Lake | MENYAKIEMESDEYITKYPTPDKQYESAMKYCTYESIQTGAMGKAAK* |
| Ga0070374_101027292 | 3300005517 | Freshwater Lake | MENYTEDITKYPTPDKQYDGAKKYETYESLQTGAMGKATK* |
| Ga0070374_101342553 | 3300005517 | Freshwater Lake | MDNYTEKDITKYPTPDKQYEGAKKYETYESIQTGAQGKAC* |
| Ga0070374_101880135 | 3300005517 | Freshwater Lake | MAHYTEEEITKYPTPDKQYDGAKKYETYESLQTGAMGKA |
| Ga0070374_101956631 | 3300005517 | Freshwater Lake | MMENYEEDITKYPTPDKQYASAMKYCTYESIQTGAQGKAC* |
| Ga0070374_103675932 | 3300005517 | Freshwater Lake | VMDNYEEDITKYPTPDKQYEGAKKYETYESVQTGAMGKAAK* |
| Ga0068877_104178351 | 3300005525 | Freshwater Lake | MENYEEDITKYPTPDKQYDGAKKYETYESIQTGAMGKAAK* |
| Ga0068877_107078891 | 3300005525 | Freshwater Lake | MENYAKMEMESDEYITKYPTPDKQYEGAMKYCTYESIQTGAMGKAAK* |
| Ga0068876_100649963 | 3300005527 | Freshwater Lake | MENYEEDITKYPTPDKQYDGAKKYETYESLQTGALGKAAK* |
| Ga0068876_100909144 | 3300005527 | Freshwater Lake | MENYAKMEMESDEYITKYPTPDKQYAGAMKYCTYESIQTGAMGKAAK* |
| Ga0068876_101563875 | 3300005527 | Freshwater Lake | MENYSEDITKYPTPDKQYDGAKKYETYESIQTGAMGKSAK* |
| Ga0068876_103719871 | 3300005527 | Freshwater Lake | MENYAKMEMESDEYITKYPTPDKQYEGAMKYCTYESIQT |
| Ga0068876_103867912 | 3300005527 | Freshwater Lake | MENYEEDITKYPTPDKQYDGAKKYETYESLQTGAMGKAAK* |
| Ga0049083_100099384 | 3300005580 | Freshwater Lentic | MDNYTEEDITKYPTPDKQYEGAKKYETYESVQTGAQGKAC* |
| Ga0049081_1000083919 | 3300005581 | Freshwater Lentic | MENYEEDITKYPTPDKQYDGAKKYETYESIQTGAMGKSAK* |
| Ga0049081_100981734 | 3300005581 | Freshwater Lentic | VMENYTEEDIAKYPTPDKQYDGAKKYETYESLQTGAMGKSAK* |
| Ga0049081_101025003 | 3300005581 | Freshwater Lentic | MENYSEDITKYPTPDKQYEGAMKYETYESLQTGAMGKSAK* |
| Ga0049081_101884252 | 3300005581 | Freshwater Lentic | MMENYEEDITKYPTPDKQYEGAKKYETYESLQTGAMGKSAK* |
| Ga0049081_102349973 | 3300005581 | Freshwater Lentic | MENYEEDITKYPTPDKQYDGAKKYETYESIQTGAQGKAC* |
| Ga0049081_102407712 | 3300005581 | Freshwater Lentic | MENYEEDITKYPTPDKQYEGAMKFQSYESVQTGAMGKETK* |
| Ga0049081_103506983 | 3300005581 | Freshwater Lentic | MEKMSYEEYFEKYPTPELQYENAMKYCTYESIQTGAMGKVTN* |
| Ga0049080_102471423 | 3300005582 | Freshwater Lentic | MENYSEDITKYPTPDKQYDGAKKYETYESIQTGAQGKNC* |
| Ga0049085_100465274 | 3300005583 | Freshwater Lentic | MENYTEEITKYPTPDKQYQGAAKYETYESIQTGAQGKAC* |
| Ga0049085_100671383 | 3300005583 | Freshwater Lentic | MENYSEDITKYPTPDKQYEGAAKYETYESIQTGAQGKAC* |
| Ga0049085_100910671 | 3300005583 | Freshwater Lentic | MENYTEDITKYPTPDKQYEGASKYETYESIQTGAQGKAC* |
| Ga0049082_100352754 | 3300005584 | Freshwater Lentic | MMDNYTEEDIAKYPTPDKQYAAAMKYCAYDSIQTGAMGKAAK* |
| Ga0049082_100528072 | 3300005584 | Freshwater Lentic | MDNYTEEDITKYPTPDKQYESAMKYCTYESIQTGAQGKAC* |
| Ga0049082_100540214 | 3300005584 | Freshwater Lentic | MDNYTEDITKYPTPDKQYEGAMKYETYESIQTGAQGKAC* |
| Ga0049082_101856074 | 3300005584 | Freshwater Lentic | MENYTEEVTKYPTPDKQYDGAKKYETYESVQTGAQGKNC* |
| Ga0079301_11550452 | 3300006639 | Deep Subsurface | MENYEEDIMKYPTPDKQYEGAMKFQSYESVQTGAMGKAAK* |
| Ga0075464_103854793 | 3300006805 | Aqueous | MENYAAMESEEYITKYPTPDKQYASAMKYCTYEPLQTGAMGKAAK* |
| Ga0102689_16494541 | 3300007304 | Freshwater Lake | MENYAKMEMESDEYITKYPTPDKQYESAMKYCTYESIQTGAMGKAAK* |
| Ga0099851_10211378 | 3300007538 | Aqueous | MENYNEDLTKYPAPDKQYEAAMKYCTYESIQTGAMGKAAK* |
| Ga0099851_10593852 | 3300007538 | Aqueous | MENYNEDLTKYPSPDKQYEGAMKYCTYESIQTGAMGKAAK* |
| Ga0099851_10742883 | 3300007538 | Aqueous | MDKMNYEEDFEKYPTPELQYEGAMKYCTYESIQTGAPGKMA* |
| Ga0099847_11926052 | 3300007540 | Aqueous | MENYSEDITKYPTPDKQYDGAKKYETYESLQTGAQGKPAK* |
| Ga0099846_11724173 | 3300007542 | Aqueous | MMKDYEEDFEKYPTPELQYENAMKYCTYESIQTGAPGKMA* |
| Ga0102861_11727033 | 3300007544 | Estuarine | MENYSEDITKYPTPDKQYESAMKYCTYESIQTGAMGKAAK* |
| Ga0102828_11169011 | 3300007559 | Estuarine | VMDNYTEDITKYPTPDKQYEGAMKYETYESLQTGAMGKETK* |
| Ga0102828_12011052 | 3300007559 | Estuarine | MENYEEDITKYPTPDKQYEGAMKYCTYESIQTGAMGKAAK* |
| Ga0102862_10519513 | 3300007670 | Estuarine | MTENYTEESITKYPTPDKQYEGAKKYETYESVQTGTMGKAAK* |
| Ga0102859_12337202 | 3300007708 | Estuarine | MENYEEDITKYPTPDKQYEGAKKYETYESLQTGAMGKAAK* |
| Ga0105745_12168932 | 3300007972 | Estuary Water | MENYEEDITKYPTPDKQYDGAKKYETYESVQTGAMGKAAK* |
| Ga0105748_104327172 | 3300007992 | Estuary Water | MENYEEDIAKYPTPDKQYDGAKKYETYESLQTGAMGKSAK* |
| Ga0108970_103895552 | 3300008055 | Estuary | MENYEEDITKYPSPDKQYEGAMKYCTYESIQTGAMGKAAK* |
| Ga0114340_10601544 | 3300008107 | Freshwater, Plankton | MENYTEEDIAKYPTPDKQYEGAMKFQSYESIQTGAMGKAAK* |
| Ga0114340_10695774 | 3300008107 | Freshwater, Plankton | MENYAKMESDEYITKYPTPDKQYESAMKYCTYESIQTGAMGKAAK* |
| Ga0114340_10874693 | 3300008107 | Freshwater, Plankton | MENYTEESITKYPTPDKQYDGAKKYETYESLQTGAMGKAAK* |
| Ga0114340_11172364 | 3300008107 | Freshwater, Plankton | MENYTEEDIAKYPTPDKQYDSAKKYETYESLQTGAMGKSAK* |
| Ga0114340_11319273 | 3300008107 | Freshwater, Plankton | MENYEEDITKYPTPDKQFPSNTKYETYESLQTGAMGKSAK* |
| Ga0114340_11440662 | 3300008107 | Freshwater, Plankton | MENYAKMEMESDEYITKYPTPDKQYVGAMKYCTYESIQTGAMGKAAK* |
| Ga0114340_12065462 | 3300008107 | Freshwater, Plankton | MENYEEDITKYPTPDKQYEGAMKFQSYESVQTGAMGKAAK* |
| Ga0114341_103965062 | 3300008108 | Freshwater, Plankton | MENYTEDITKYPTPDKQYDGAKKYETYESIQTGAPGKAAK* |
| Ga0114343_10668546 | 3300008110 | Freshwater, Plankton | EDLMPYPTPDKQYPGAAKYSSYESIQTGAPGKAAK* |
| Ga0114343_10786614 | 3300008110 | Freshwater, Plankton | MENYSEDITKYPTPDKQYDGAKKYETYESIQTGAPGKAAK* |
| Ga0114343_11303863 | 3300008110 | Freshwater, Plankton | MENYTEEDIAKYPTPDKQYDGAKKYETYESLQTGAMGKAAK* |
| Ga0114343_11748991 | 3300008110 | Freshwater, Plankton | MENYTEDITKYPTPDKQYDGAKKYETYESLQTGAMGKA |
| Ga0114347_10989283 | 3300008114 | Freshwater, Plankton | MENYEEDIAKYPTPDKQYEGAMKYCTYESIQTGAMGKAAK* |
| Ga0114347_11502303 | 3300008114 | Freshwater, Plankton | MENYKEEEITKYPTPDKQYDGAKKYETYESLQTGAMGKAAK* |
| Ga0114350_11772482 | 3300008116 | Freshwater, Plankton | MENYATMESDEYITKYPTPDKQYEGAMKYCTYESIQTGAMGKAAK* |
| Ga0114351_11124136 | 3300008117 | Freshwater, Plankton | MENYKEEEITKYPTPDKQYDGAKKYETYESVQTGAMGKSAK* |
| Ga0114354_11335542 | 3300008119 | Freshwater, Plankton | MEKMSYEEYFEKYPTPELQYENAMKYSTYESVQTGAMGKATN* |
| Ga0114355_10931443 | 3300008120 | Freshwater, Plankton | MENYEEDITKYPTPDKQYEGAMKFQSYESVQTGAMGKSAK* |
| Ga0114841_11865413 | 3300008259 | Freshwater, Plankton | MENYEEEITKYPTPDKQYDGAKKYETYESLQTGAMGKSAK* |
| Ga0114336_10254161 | 3300008261 | Freshwater, Plankton | MENYTEEDSAKYPTPDKQYDGAKKYETYESLQTGAMGKAAK* |
| Ga0114336_11442813 | 3300008261 | Freshwater, Plankton | MENYEEDITKYPTPDKQYDGAKKYETYESIQTGANGKAEK* |
| Ga0114337_11991081 | 3300008262 | Freshwater, Plankton | YEEDITKYPTPDKQYDGAKKYETYESLQTGALGKAAK* |
| Ga0114337_12110222 | 3300008262 | Freshwater, Plankton | MENYATMESDEYITKYPTPDKQYEGAMKYCTYESIQTGAPGKAAK* |
| Ga0114353_12330323 | 3300008264 | Freshwater, Plankton | MENYTEEDIAKYPTPDKQYDGAKKYETYESVQTGAMGKSAK* |
| Ga0114363_10420035 | 3300008266 | Freshwater, Plankton | MENYEEDIAKYPTPDKQYEGAMKFQSYESVQTGAMGKSAK* |
| Ga0114880_10093864 | 3300008450 | Freshwater Lake | MENYTEDITKYPTPDKQYEAAMKYCTYESIQTGAQGKAC* |
| Ga0114880_11327263 | 3300008450 | Freshwater Lake | MENYTEESIVKYPTPDKQYDGAKKYETYESLQTGAMGKAAK* |
| Ga0102860_12193851 | 3300009056 | Estuarine | MGHYTEEDITKYPTPDKQYEGATKYETYESIQTGAQGKAC* |
| Ga0114973_104203243 | 3300009068 | Freshwater Lake | MENYTEESITKYPTPDKQYDGAKKYETYESVQTGAMGKAAK* |
| Ga0105090_107746511 | 3300009075 | Freshwater Sediment | MENYLEDITKYPTPDKQYDGAKKYETYESIQTGAPGKSAK* |
| Ga0105098_100185106 | 3300009081 | Freshwater Sediment | MKDYMESEDLQKYPTPELQYEGAMKYCTYESIQTGAPGKMA* |
| Ga0105098_100661355 | 3300009081 | Freshwater Sediment | MENYSEDITKYPTPDKQYEGAMKYCTYESIQTGAMGKSAK* |
| Ga0105098_101518933 | 3300009081 | Freshwater Sediment | MENYSEDITKYPTPDKQYDGAKKYETYESLQTGAPGKAAK* |
| Ga0105098_104721923 | 3300009081 | Freshwater Sediment | MENYSEEITKYPTPEKQYDGAKKYETYESVQTGAMGKSAK* |
| Ga0105098_105216421 | 3300009081 | Freshwater Sediment | NYSEEITKYPTPDKQYESAMKYCTYESLQTGAMGKSAK* |
| Ga0105099_104048174 | 3300009082 | Freshwater Sediment | MENYTEDITKYPTPDKQYEGAMKFQSYESVQTGAMGKAAK* |
| Ga0105103_100914513 | 3300009085 | Freshwater Sediment | MMKDYMESEDLQKYPTPELQYEGAMKYCTYESIQTGAPGKMA* |
| Ga0105103_104866654 | 3300009085 | Freshwater Sediment | MENYSEEITKYPTPDKQYEGAKKYETYESLQTSAMGKSAK* |
| Ga0114980_100637483 | 3300009152 | Freshwater Lake | MENYAAVEAAEQITKYPTPDKQYDSAMKYCTYESLQTGAQGKSAK* |
| Ga0114968_101852875 | 3300009155 | Freshwater Lake | MENYEEEITKYPTPDKQYEGAKKYETYESLQTGAMGKAAK* |
| Ga0114978_1002624810 | 3300009159 | Freshwater Lake | MDMNNGMETAASESEEYITAYPSPDKQYDGAKRYTSYESIQTGAMGKAAK* |
| Ga0105102_101401075 | 3300009165 | Freshwater Sediment | MENYTEEDIAKYPTPDKQYDGAKKYETYESLQTGAMGKSAK* |
| Ga0105102_102889182 | 3300009165 | Freshwater Sediment | MENYSEEITKYPTPDKQYEGAKKYETYESLQTGAMGKSAK* |
| Ga0105102_103259504 | 3300009165 | Freshwater Sediment | MENYSEDIAKYPTPDKQYDGAKKYETYESLQTGAQGKPAK* |
| Ga0105102_103445492 | 3300009165 | Freshwater Sediment | MENYSEEITKYPTPDKQYEGAKKYETYESLQTGAQGKPAK* |
| Ga0105102_103917243 | 3300009165 | Freshwater Sediment | MENYEEDIMKYPTPDKQYEGAMKYCTYESIQTGAMGKAAK* |
| Ga0105102_107955092 | 3300009165 | Freshwater Sediment | MENYSEDITKYPTPDKQYEGAMKFQSYESVQTGAPGKAAK* |
| Ga0105104_104630561 | 3300009168 | Freshwater Sediment | SEDLQKYPTPELQYEGAMKYCTYESIQTGAPGKMA* |
| Ga0105104_107382831 | 3300009168 | Freshwater Sediment | MMKDYMESEDLQKYPTPELQYEGAMKYCTYESIQTGALGKMA* |
| Ga0105097_102864162 | 3300009169 | Freshwater Sediment | MENYSEDITKYPTPDKQYEGAMKCKYHESVQTGAPGKAAK* |
| Ga0105097_108635691 | 3300009169 | Freshwater Sediment | MENYEEDITKYPTPDKQYDGAKKYETYESLQTGAMGKPAK* |
| Ga0105096_101647434 | 3300009170 | Freshwater Sediment | MENYSEDITKYPTPDKQYEAAMKYCTYESIQTGAMGKSAK* |
| Ga0105096_104250644 | 3300009170 | Freshwater Sediment | SYQEDGEEEVMENYSEDITKYPTPDKQYDGAKKYETYESLQTGAMGKSAK* |
| Ga0105096_107410973 | 3300009170 | Freshwater Sediment | MENYEEDIAKYPTPDKQYEGAMKFQSYESVQTGAMGKAAK* |
| Ga0114969_102753461 | 3300009181 | Freshwater Lake | MGHNGKMEMESEEYITKYPTPDKQYEGAAKYETYESIQTGAQGKAC* |
| Ga0114983_10262663 | 3300009194 | Deep Subsurface | MENYTEEDIAKYPTPDKQYEGAMKYCTYESIQTGAMGKSAK* |
| Ga0114982_12198681 | 3300009419 | Deep Subsurface | GVIMENYAKMESDEYITKYPTPDKQYEGAMKYCTYESIQTGAMGKAAK* |
| Ga0114982_12790011 | 3300009419 | Deep Subsurface | YITKYPTPDKQYAGAMKYCTYESIQTGAMGKAAK* |
| Ga0127402_10475532 | 3300009451 | Meromictic Pond | MENYEEEITKYPTPDKQYEAAMKYCTYESLQTGAQGKAC* |
| Ga0126448_10028948 | 3300009466 | Meromictic Pond | MENYKEEITKYPTPDKQYDGAKKYETYESIQTGAQGKAC* |
| Ga0136551_10184464 | 3300010388 | Pond Fresh Water | MENYAKMEMESDEYITKYPTPDKQYEGAMKHCTYESIQTGAMGKAAK* |
| Ga0138308_1922874 | 3300010965 | Lake Chemocline | MENYTEEDITKYPTPDKQYESAMKYCTYESIQTGAQGKAC* |
| Ga0136713_10612532 | 3300011183 | Freshwater | MENYKEEEITKYPTPDKQYEGAKKYETYESLQTGAMGKSAK* |
| Ga0153700_1022110 | 3300011339 | Freshwater | MKYNMESEEYLEKYPTPELQYEGAMKYCTYESIQTGASGKMA* |
| Ga0157596_10549923 | 3300012702 | Freshwater | MENYEEDITKYPTPDKQYDGAKKYETYESLQTGAPGKAAK* |
| Ga0157627_11214622 | 3300012706 | Freshwater | MENYSEDIVKYPTPDKQYEAAMKYCTYESIQTGAMGKAAK* |
| Ga0157623_11176702 | 3300012707 | Freshwater | MENYEEDITKYPTPDKQYEGAMKFQTYESVQTGAPGKAAK* |
| Ga0157550_11481916 | 3300012710 | Freshwater | MENYAAMESDEYITKYPTPDKQYASAMKYCTYESLQTGAMGKAAK* |
| Ga0157601_12267181 | 3300012714 | Freshwater | EIKMEDYAKMEMDEYITEYPTPDKQYEGAMKYCTYESIQTGAMGKSAK* |
| Ga0157605_12552282 | 3300012716 | Freshwater | MENYTEEDITKYPTPDKQYEGAMKYCTYESIQTGAMGKSAK* |
| Ga0157600_10922581 | 3300012719 | Freshwater | MENYPEEDIAKYPTPDKQYEGAMKYCTYESIQTGAMGKAAK* |
| Ga0157613_12034124 | 3300012720 | Freshwater | MENYTEEDIAKYPTPYKQYDGAKKYETYESLQTGAMGKPAK* |
| Ga0157629_10805692 | 3300012752 | Freshwater | MENYSEDITKYPTPDKQYDGVKKYEIYELLQIGAPGKAAK* |
| Ga0164293_101299926 | 3300013004 | Freshwater | MMKNYMESEDLQKYPTPELQYEGAMKYCTYESIQTGAPGKMA* |
| Ga0164293_109809352 | 3300013004 | Freshwater | MMDNYTEEDIAKYPTPDKQYAAAMKYCTYESIQTGAM |
| Ga0164292_102185302 | 3300013005 | Freshwater | MENYATMESDEYITKYPTPDKQYEGAMKYCTYDSIQTGAMGKAAK* |
| Ga0164295_103139012 | 3300013014 | Freshwater | MENYAAMESEEYITKYPTPDKQYASAMKYCTYESLQTGAMGKAAK* |
| Ga0157622_11548894 | 3300013310 | Freshwater | MEDYAKMEMDEYITKYPTPDKQYEGAMKYCTYESIQTGAMGKSAK* |
| Ga0177922_103027183 | 3300013372 | Freshwater | MDNYTEDITKYPTPDKQYDGAKKYETYESLQTGAMGKAAK* |
| Ga0181339_10342411 | 3300017700 | Freshwater Lake | MRAEDITKYPTPDKQYEGAMKYETYESLQTGAMGKAAK |
| Ga0181364_10203651 | 3300017701 | Freshwater Lake | MEKMSYEEYFEKYPTPELQYENAMKYCTYESIQTGAMGKVIN |
| Ga0181364_10450352 | 3300017701 | Freshwater Lake | MDNYTEEDITKYPTPDKQYEAAMKYCTYESIQTGAQGKAC |
| Ga0181364_10654053 | 3300017701 | Freshwater Lake | YEEDGKEEVMDNYTEEDITKYPTPDKQYEGAKKYETYESIQTGAQGKAC |
| Ga0181363_10423843 | 3300017707 | Freshwater Lake | MENYEEDITKYPTPDKQYDGAKKYETYESLQTGAPSKAAK |
| Ga0181350_10676431 | 3300017716 | Freshwater Lake | ELCYEEDGKEEVMDNYTEEDITKYPTPDKQYEGAKKYETYESIQTGANGKAAK |
| Ga0181347_11365434 | 3300017722 | Freshwater Lake | MEEDLMPYPTPDKQYLGASKYSSYESIQTGAPGKAAK |
| Ga0181347_11409794 | 3300017722 | Freshwater Lake | MAHYTEEEITKYPTPDKQYDGAKKYETYESLQTGAMGKAAKXRR |
| Ga0181362_10319665 | 3300017723 | Freshwater Lake | MENYTEDITKYPTPDKQYDGAKKYETYESLQTGAM |
| Ga0181362_10459142 | 3300017723 | Freshwater Lake | MENYTEELEKYPTSDKQYEGASKYETYESIQTGAQGKAC |
| Ga0181362_11227942 | 3300017723 | Freshwater Lake | MENYEENITKYPTPDKQYDGAKKYETYESVQTGAMGKAAK |
| Ga0181365_10397684 | 3300017736 | Freshwater Lake | MDNYTEDITKYPTPDKQYEGAMKYDTYESLQTGAMGKETK |
| Ga0181365_10730174 | 3300017736 | Freshwater Lake | MDNYTEDITKYPTPDKQYEGAMKYETYESVQTGAMGKETK |
| Ga0181344_11630073 | 3300017754 | Freshwater Lake | MENYEEDIAKYPTPDKQYEGAMKFQSYESVQTGAMGKAAK |
| Ga0181356_11710933 | 3300017761 | Freshwater Lake | MENYTEEITKYPTPDKQYESAMKYCTYESIQTGAQGKAC |
| Ga0181356_11841154 | 3300017761 | Freshwater Lake | MENYTEEVTKYPTPDKQYDGAKKYETYESVQTGAQGKNC |
| Ga0181356_12274973 | 3300017761 | Freshwater Lake | MMDNYTEEDITKYPTPDKQYAAAMKYCTYESIQTGAMGKAAK |
| Ga0181356_12388701 | 3300017761 | Freshwater Lake | IQGVTMENYEEDITKYPTPDKQYEGAMKFQSYESIQTGAMGKAAK |
| Ga0181343_11130012 | 3300017766 | Freshwater Lake | MENYTEEDITKYPTPDKQYEGAKKYETYESLQTGAMGKSAK |
| Ga0181357_11313591 | 3300017777 | Freshwater Lake | MMENYEEDITKYPTPDKQYEGAKKYETYESLQTGAMG |
| Ga0181357_12005304 | 3300017777 | Freshwater Lake | MMENYTEDIAKYPTPDKQYEAAMKYCTYESIQTGAQGKAC |
| Ga0181357_12041593 | 3300017777 | Freshwater Lake | MENYTEDITKYPTPDKQYEGASKYETYESIQTGAQGKAC |
| Ga0181357_12588263 | 3300017777 | Freshwater Lake | MMDNYTEEDIAKYPTPDKQYAAAMKYCTYESIQTGAQGKAC |
| Ga0181349_11108841 | 3300017778 | Freshwater Lake | GVIMENYEEDITKYPTPDKQYEGAMKFQSYESVQTGAMGKAAK |
| Ga0181346_11545872 | 3300017780 | Freshwater Lake | MENYTEDIAKYPTPDKQYEAAMKYCTYESIQTGAQGKAC |
| Ga0181348_10522276 | 3300017784 | Freshwater Lake | VMENYEEDITKYPTPDKQYEGAMKFQSYESVQTGAMGKDTK |
| Ga0181348_12146953 | 3300017784 | Freshwater Lake | MENYTEEITKYPTPDKQYDGAKKYETYESVQTGAQGKNC |
| Ga0181355_13817202 | 3300017785 | Freshwater Lake | MMENYTEDIAKYPTPDKQYEAAMKYCTYESIQTGDQGKAC |
| Ga0188839_10109005 | 3300019122 | Freshwater Lake | MENYEEDITKYPTPDKQYEAAMKYCTYESIQTGAMGKAAK |
| Ga0181359_10129745 | 3300019784 | Freshwater Lake | MENYEEDITKYPTPDKQYEGAMKFQSYESVQTGAPGKKAK |
| Ga0181359_10194965 | 3300019784 | Freshwater Lake | MENYTEEVTKYPTPDKQYEAAMKYCTYESVQTGAQGKNC |
| Ga0181359_10382802 | 3300019784 | Freshwater Lake | MENYTEDITKYPTPDKQYDGAKKYETYESLQTGAMGKATK |
| Ga0181359_10462103 | 3300019784 | Freshwater Lake | MAHYTEEEITKYPTPDKQYDGAKKYETYESLQTGAMGKAAK |
| Ga0181359_10703255 | 3300019784 | Freshwater Lake | MENYTEESITKYPTPDKQYEGAMKYETYESIQTGAQGKAC |
| Ga0181359_10739462 | 3300019784 | Freshwater Lake | MDNYTEEDITKYPTPDKQYEGAKKYETYESIQTGAQGKAC |
| Ga0181359_10851604 | 3300019784 | Freshwater Lake | MEKMSYEEYFEKYPTPELQYENAMKYSTYESVQTGAMGKVIN |
| Ga0181359_11178294 | 3300019784 | Freshwater Lake | MEKMSYEEYFEKYPTPELQYENAMKYCTYESIQTGAMGKVTN |
| Ga0181359_11328323 | 3300019784 | Freshwater Lake | MENYTEEITKYPTPDKQYASAMKYCTYESIQTGAQGKAC |
| Ga0181359_11428202 | 3300019784 | Freshwater Lake | MMDNYTEEDIAKYPTPDKQYEGAMKYCTYESIQTGAQGKAC |
| Ga0181359_11503104 | 3300019784 | Freshwater Lake | MDNYEEDITKYPTPDKQYEGAKKYETYESVQTGAMGKAAK |
| Ga0181359_11698464 | 3300019784 | Freshwater Lake | MDNYTQEDITKYPTPDKQYEGAKKYETYESIQTGAQGKAC |
| Ga0181359_11918191 | 3300019784 | Freshwater Lake | MENYEEDITKYPTPDKQYDGAKKYETYESLQTGAMGKSAK |
| Ga0181359_11921602 | 3300019784 | Freshwater Lake | MDNYTEEDITKYPTPDKQYEGAKKYETYDSIQTGAQGKAC |
| Ga0181359_12292642 | 3300019784 | Freshwater Lake | MENYEEDITKYPTPDKQYEGAMKFQSYESVQTGAMGKDTK |
| Ga0181359_12433412 | 3300019784 | Freshwater Lake | MDNYTEDITKYPTPDKQYEGAMKYETYESLQTGAMGKETK |
| Ga0181359_12686801 | 3300019784 | Freshwater Lake | YEEDGKEEVMDNYTEEDITKYPTPDKQYEGAKKYETYESIQTGANGKAAK |
| Ga0211736_107529873 | 3300020151 | Freshwater | MENYAKMEMESDEYITKYPTPDKQYDGAKKYETYESLQTGAQG |
| Ga0211733_109498507 | 3300020160 | Freshwater | MENYEEDITKYPTPDKQYEGAKKYETYESLQTGAMKKAAK |
| Ga0211735_109108191 | 3300020162 | Freshwater | MENYPEMEMESDEYITKYPTPDKQYEGAMKYCTYESIQTGAMGKSAK |
| Ga0211729_110736304 | 3300020172 | Freshwater | VMENYEEDITKYPTPDKQYDGAKKYETYESVQTGAMGKSAK |
| Ga0211731_109552712 | 3300020205 | Freshwater | MENYEEDITKYPTPDKQYDGAKKYETYESIQTGAMGKSTK |
| Ga0211731_117423144 | 3300020205 | Freshwater | MENYAKMESDEYITKYPTPDKQYEGAMKYCTYESIQTGAQGKSAK |
| Ga0208050_10028207 | 3300020498 | Freshwater | MENYSEDITKYPTPDKQYDGAKKYETYESIQTGAPGKAAK |
| Ga0208050_10138573 | 3300020498 | Freshwater | MENYKEEEITKYPTPDKQYDGAKKYETYESVQTGAMGNSAK |
| Ga0208088_10088834 | 3300020505 | Freshwater | VMENYEEDITKYPTPDKQYEGAMKFQSYESVQTGAMGKSAK |
| Ga0208232_10023267 | 3300020527 | Freshwater | MENYSEDITKYPTPDKQYEAAMKYCTYESLQTGAMGKAAK |
| Ga0208233_10108916 | 3300020529 | Freshwater | MENYGKMEMSEDITKYPSPDKQYEGALKYCTYESIQTGAMGKAAK |
| Ga0208235_10249164 | 3300020530 | Freshwater | EVMENYSEDITKYPTPDKQYDGAKKYETYESLQTGAMGKSAK |
| Ga0208235_10370101 | 3300020530 | Freshwater | MENYEEDITKYPTPDKQYDGAKKYETYESIQTGAMGKSAK |
| Ga0208364_10041362 | 3300020533 | Freshwater | MEMSEDITKYPSPDKQYEGALKYCTYESIQTGAMGKAAK |
| Ga0207942_10023411 | 3300020549 | Freshwater | MENYSEDITKYPTPDKQYDGAKKYETYESIQTGAL |
| Ga0208360_10291753 | 3300020551 | Freshwater | MENYKEEEITKYPTPDKQYDGAKKYETYESIQTGAMGKSAK |
| Ga0208855_10363673 | 3300020553 | Freshwater | MENYEEDITKYPTPDKQYEGAMKFQTYESVQTGAPGKAAK |
| Ga0208599_10250083 | 3300020554 | Freshwater | MENYEEDITKYPSPDKQYEGALKYCTYESIQTGAMGKAAK |
| Ga0208486_10042175 | 3300020556 | Freshwater | MENYSEDITKYPTPDKQYEGAMKFQTYESVQTGAPGKAAK |
| Ga0222714_100582505 | 3300021961 | Estuarine Water | MENYGKMEMESDEYITKYPTPDKQYEGAMKYCTYESIQTGAMGKAAK |
| Ga0222714_101271741 | 3300021961 | Estuarine Water | EEIMENYSEEITKYPTPDKQYDGAKKYETYESIQTGAQGKAC |
| Ga0212031_10790773 | 3300022176 | Aqueous | MKDYEEDFEKYPTPELQYENAMKYCTYESIQTGAPGKMA |
| Ga0181354_100094411 | 3300022190 | Freshwater Lake | MENYEEDITKYPTPDKQYDGAKKYETYESIQTGVGGKK |
| Ga0181354_10073597 | 3300022190 | Freshwater Lake | MTENYTEESITKYPTPDKQYDGAKKYETYESVQTGAQGKAC |
| Ga0181354_10368094 | 3300022190 | Freshwater Lake | MENYTEDITKYPTPDKQYEGAMKYETYESIQTGAQGKAC |
| Ga0181354_11084831 | 3300022190 | Freshwater Lake | MDNYTEDITKYPTPDKQYEGAMKYETYESIQTGAQGKAC |
| Ga0181354_11218514 | 3300022190 | Freshwater Lake | MENYTEEITKYPTPDKQYEGAMKYETYESIQTGAQGKAC |
| Ga0181354_11519814 | 3300022190 | Freshwater Lake | MTENYTEESITKYPTPDKQYDGAKKYETYESVQTGAF |
| Ga0181354_11732461 | 3300022190 | Freshwater Lake | MENYTEEDIAKYPTPDKQYASAMKYCAYDSIQTGAMGKPAK |
| Ga0181354_11787391 | 3300022190 | Freshwater Lake | DGKKEVMDNYTQEDITKYPTPDKQYEGAKKYETYESIQTGAQGKAC |
| Ga0181354_11962141 | 3300022190 | Freshwater Lake | MEKMTYEEYFEKYPTPELQYENAMKYCTYESVQTGAMGKVIN |
| Ga0181354_12155332 | 3300022190 | Freshwater Lake | MMENYEKDITKYPTPDKQYEGAKKYETYESLQTGAMGKSAK |
| Ga0196901_10064912 | 3300022200 | Aqueous | MENYNEDLTKYPSPDKQYEGAMKYCTYESIQTGAMGKAAK |
| Ga0196901_10080306 | 3300022200 | Aqueous | MENYNEDLTKYPAPDKQYEAAMKYCTYESIQTGAMGKAAK |
| Ga0196901_10899113 | 3300022200 | Aqueous | MMKDYEEDFEKYPTPELQYENAMKYCTYESIQTGAPGKMA |
| Ga0181351_10261251 | 3300022407 | Freshwater Lake | MTENYTEESITKYPTPDKQYEGTKKYETYESVQTGAQGKAC |
| Ga0181351_10614853 | 3300022407 | Freshwater Lake | MMENYEEDITKYPTPDKQYASAMKYCTYESIQTGAQGKAC |
| Ga0181351_11289554 | 3300022407 | Freshwater Lake | MENYTEDITKYPTPDKQYEAAMKYCTYESIQTGAQGKAC |
| Ga0181351_11551173 | 3300022407 | Freshwater Lake | MENYSEEITKYPTPDKQYEAAMKYCTYESIQTGAMGKAAK |
| Ga0181351_11634082 | 3300022407 | Freshwater Lake | MDNYTEDITKYPTPDKQYEGAMKYETYESLQTGAMGKAAK |
| Ga0181351_11731331 | 3300022407 | Freshwater Lake | YTEEDITKYPTPDKQYEGAKKYETYESIQTGAQGKAC |
| Ga0181351_11768192 | 3300022407 | Freshwater Lake | MHNSEEIEKYPTPDKQYEGASKYETYESIQTGAQGKAC |
| Ga0181351_12118091 | 3300022407 | Freshwater Lake | MENYTEEDITKYPTPDKQYEGAMKYCAYDSIQTGAMGKAAK |
| Ga0181351_12404222 | 3300022407 | Freshwater Lake | MAHYTEEDIEKYPTPDKQYEGASKYETYESLQTGAMGKPAK |
| Ga0181351_12469883 | 3300022407 | Freshwater Lake | MDNYTEDITKYPTPDKQYEGAMKFQSYESVQTGAMGKAAK |
| Ga0214917_102341843 | 3300022752 | Freshwater | MEKMTYEEYFEKYPTPELQYENAMKYCTYESIQTGAMGKMPS |
| Ga0214921_101747951 | 3300023174 | Freshwater | MEEDLMPYPASDKQYPNAAKYSSYESIQTGAMGKA |
| Ga0209414_100054714 | 3300023301 | Hypersaline | MDYPMQMEMEQEIAKYPTPDNQYESAMKYCTYESIQTGAMGKITK |
| Ga0244776_107425162 | 3300024348 | Estuarine | MENYEEDITKYPTPDKQYDGAKKYETYESVQTGAMGKSAK |
| Ga0255243_11640802 | 3300024569 | Freshwater | VMENYSEDITKYPTPDKQYDGAKKYETYESLQTGAMGKAAK |
| Ga0208161_10263878 | 3300025646 | Aqueous | MDKMNYEEDFEKYPTPELQYEGAMKYCTYESIQTGAPGKMA |
| Ga0256319_11108272 | 3300026454 | Freshwater | MENYSEDIAKYPTPDKQYDGAKKYETYESLQTGAMGKSAK |
| Ga0255240_11292603 | 3300026568 | Freshwater | MENYKEEEITKYPTPDKQYEGAMKYETYESVQTGAMGKAAK |
| Ga0255116_10278463 | 3300027124 | Freshwater | VMENYTEEDIAKYPTPDKQYDGAKKYETYESLQTGAMGKSAK |
| Ga0255066_10646253 | 3300027131 | Freshwater | MENYEEDITKYPTPDKQYDGAKKYETYESLQTGALGKAAK |
| Ga0255110_10166221 | 3300027132 | Freshwater | EEDGKEEVMENYTEEDIAKYPTPDKQYDGAKKYETYESLQTGAMGKSAK |
| Ga0255076_10844551 | 3300027141 | Freshwater | EEVMENYSEDITKYPTPDKQYDGAKKYETYESLQTGALGKAAK |
| Ga0255063_10199942 | 3300027151 | Freshwater | MENYSEDITKYPTPDKQYDGAKKYETYESLQTGAMGKAAK |
| Ga0209300_10373581 | 3300027365 | Deep Subsurface | MENYTEEDIAKYPTPDKQYEGAMKYCTYESIQTGAMGKSAK |
| Ga0208788_11255172 | 3300027499 | Deep Subsurface | MENYEEDIMKYPTPDKQYEGAMKFQSYESVQTGAMGKAAK |
| Ga0209651_12115241 | 3300027581 | Freshwater Lake | EDGEEEVMENYTEEVTKYPTPDKQYEAAMKYCTYESVQTGAQGKNC |
| Ga0208966_10697223 | 3300027586 | Freshwater Lentic | MMDNYTEEDIAKYPTPDKQYAAAMKYCAYDSIQTGAMGKAAK |
| Ga0208974_10710364 | 3300027608 | Freshwater Lentic | MENYSEDITKYPTPDKQYEGAMKYETYESLQTGAMGKSAK |
| Ga0208974_10988233 | 3300027608 | Freshwater Lentic | MENYEEDITKYPTPDKQYDGAKKYETYESLQTGALGKATK |
| Ga0208942_10484293 | 3300027627 | Freshwater Lentic | MENYTEEITKYPTPDKQYQGAAKYETYESIQTGAQGKAC |
| Ga0208975_10250574 | 3300027659 | Freshwater Lentic | MENYEEDITKYPTPDKQYDGAKKYETYESLQTGAMGKAAK |
| Ga0208975_10859242 | 3300027659 | Freshwater Lentic | MENYEEDITKYPTPDKQYDGAKKYETYESIQTGAQGKAC |
| Ga0209077_11632353 | 3300027675 | Freshwater Sediment | VMENYSEDITKYPTPDKQYDGAKKYETYESLQTGAMGKSAK |
| Ga0209769_10627212 | 3300027679 | Freshwater Lake | VMDNYEEDITKYPTPDKQYEGAKKYETYESVQTGAMGKAAK |
| Ga0209551_10558354 | 3300027689 | Freshwater Lake | MENYTEDITKYPTPDKQYDGAKKYETYESLQTGAMGKAAK |
| Ga0209704_10420613 | 3300027693 | Freshwater Sediment | MMKDYMESEDLQKYPTPELQYEGAMKYCTYESIQTGAPGKMA |
| Ga0209704_11540412 | 3300027693 | Freshwater Sediment | MENYTEDITKYPTPDKQYEGAMKYCTYESIQTGAMGKSAK |
| Ga0209704_11649673 | 3300027693 | Freshwater Sediment | EDGEEELMENYSEDITKYPTPDKQYDGAKKYETYESVQTGAMGKSAK |
| Ga0209443_11775651 | 3300027707 | Freshwater Lake | KEEVMDNYTEEDITKYPTPDKQYEGAKKYETYESIQTGAQGKAC |
| Ga0209617_103329182 | 3300027720 | Freshwater And Sediment | MENYEEDITKYPTPDKQYEAAMKYCTYESIQTGAQGKAC |
| (restricted) Ga0247836_10729785 | 3300027728 | Freshwater | MENYEEYITKYPTPDKQYEGAMKYCTYESIQTGAMGKSAK |
| Ga0209442_11000004 | 3300027732 | Freshwater Lake | MDNYTEEDITKYPTPDKQYESAMKYCTYESIQTGAQGKAC |
| Ga0209190_10037586 | 3300027736 | Freshwater Lake | MENYEEEITKYPTPDKQYEGAKKYETYESLQTGAMGKAAK |
| Ga0209596_11876951 | 3300027754 | Freshwater Lake | MGHNGKMEMESEEYITKYPTPDKQYEGAAKYETYESIQTGAQGKAC |
| Ga0209444_102554952 | 3300027756 | Freshwater Lake | MAHYTEEEITKYPTPDKQYDGAKKYETYESLQTGAMGKATK |
| Ga0209134_101649212 | 3300027764 | Freshwater Lake | MENYTEEDIAKYPTPDKQYDGAKKYETYESLQTGAMGKPAK |
| Ga0209134_102589291 | 3300027764 | Freshwater Lake | EEDGKEEVMENYTEEDITKYPTPDKQYEGAKKYETYESIQTGAMGKAAK |
| Ga0209246_101140042 | 3300027785 | Freshwater Lake | MMDNYTEEDITKYPTPDKQYASAMKYCTYESIQTGAQGKAC |
| Ga0209246_102039182 | 3300027785 | Freshwater Lake | MDNYTEEDITKYPTPDKQYEGAKKYETYESIQTGANGKAAK |
| Ga0209972_1000116122 | 3300027793 | Freshwater Lake | MENYAKMEMESDEYITKYPTPDKQYESAMKYCTYESIQTGAMGKAAK |
| Ga0209972_103513871 | 3300027793 | Freshwater Lake | MENYAKMEMESDEYITKYPTPDKQYAGAMKYCTYESIQTGAMGKAAK |
| Ga0209107_101496594 | 3300027797 | Freshwater And Sediment | MENYKEEEIAKYPTPDKQYEGAMKYETYESLQTGAMGKSAK |
| Ga0209107_101620724 | 3300027797 | Freshwater And Sediment | MGHYTEEDITKYPTPDKQYEGAMKYETYESIQTGAQGKAC |
| Ga0209107_102030022 | 3300027797 | Freshwater And Sediment | MENYTEESIVKYPTPDKQYDGAKKYETYESLQTGTAGKAAK |
| Ga0209107_102597153 | 3300027797 | Freshwater And Sediment | MENYTEEITKYPTPDKQYESSMKYCTYESIQTGAQGKAC |
| Ga0209107_104487353 | 3300027797 | Freshwater And Sediment | MENYEEDITKYPTPDKQYDGAKKYETYESIQTGANGKAAK |
| Ga0209229_100001215 | 3300027805 | Freshwater And Sediment | MENYEEDITKYPTPDKQYEGAMKFQSYESVQTGAMGKSAK |
| Ga0209229_100391205 | 3300027805 | Freshwater And Sediment | MENYEEDITKYPTPDKQYDGAKKYETYESIQTGAMGKAAK |
| Ga0209354_101342835 | 3300027808 | Freshwater Lake | NDEELCYEEDGKEEVMDNYTQEDITKYPTPDKQYEGAKKYETYESIQTGAQGKAC |
| Ga0209354_102504331 | 3300027808 | Freshwater Lake | MENYEEDITKYPTPDKQYDGAKKYETYESVQTGAQGKAC |
| Ga0209354_102517701 | 3300027808 | Freshwater Lake | DEELCYEEDGKEEVMDNYTEEDITKYPTPDKQYEGAKKYETYESIQTGANGKAAK |
| Ga0209354_103403421 | 3300027808 | Freshwater Lake | ESYEEDGQEEIMENYTEEITKYPTPDKQYEGAMKYETYESIQTGAQGKAC |
| Ga0209990_10000126117 | 3300027816 | Freshwater Lake | EMESDEYITKYPTPDKQYEGAMKYCTYESIQTGAMGKAAK |
| Ga0209990_102253091 | 3300027816 | Freshwater Lake | MENYAKMEMESDEYITKYPTPDKQYAGAMKYCTYESI |
| Ga0209253_103059613 | 3300027900 | Freshwater Lake Sediment | MENYAKMESDEYITKYPTPDKQYEGAMKYCTYESIQTGAMGKAVK |
| Ga0209298_103314552 | 3300027973 | Freshwater Lake | MENYAAVEAAEQITKYPTPDKQYDSAMKYCTYESLQTGAQGKSAK |
| (restricted) Ga0247834_12446803 | 3300027977 | Freshwater | KEVMENYEEDITKYPTPDKQYEAAMKYCTYESLQTGAMGKPAK |
| Ga0247723_100017849 | 3300028025 | Deep Subsurface Sediment | MENYPEMEMESEEYITKYPTPDKQYAGAMKYSTYESLQTGAMGKAAK |
| Ga0247723_100018949 | 3300028025 | Deep Subsurface Sediment | MENYSKMENESDEYITKYPTPDKQYAGAMKYCTYESIQTGAMGKAAK |
| Ga0247723_100121615 | 3300028025 | Deep Subsurface Sediment | MENYTEEDIAKYPTPDKQYDSAKKYETYESLQTGAMGKSAK |
| Ga0247723_10120261 | 3300028025 | Deep Subsurface Sediment | MENYEKMESDEYITKYPTPDKQYQSAMKYCTYESIQTGAMGKAAK |
| Ga0247723_10247155 | 3300028025 | Deep Subsurface Sediment | MENYATMESDEYITKYPTPDKQYEGAMKYCTYESIQTGAMGKAAK |
| Ga0247723_10388433 | 3300028025 | Deep Subsurface Sediment | MENYTEEDIAKYPTPDKQYDGAKKYETYESLQTGAMGKAAK |
| Ga0247723_10999522 | 3300028025 | Deep Subsurface Sediment | MENYEEEITKYPTPDKQYDGAKKYETYESLQTGAMGKSAK |
| Ga0255255_10878351 | 3300028085 | Freshwater | MENYTEESITKYPTPDKQYDGAKKYETYESLQTGAMGKSAK |
| (restricted) Ga0247843_10248668 | 3300028569 | Freshwater | MENYTEEVTKYPTPDKQYEAAMKYCTYESLQTGAMGKPAK |
| (restricted) Ga0247843_10533285 | 3300028569 | Freshwater | MENYEEDITKYPTPDKQYEGAMKYCTYESIQTGAMGKSAK |
| Ga0307377_110552661 | 3300031673 | Soil | MENYSEDITKYPTPDKQYEAAMKYCTYESIQTGAQGKA |
| Ga0315291_100895198 | 3300031707 | Sediment | MMDNYTEEDITKYPTPDKQYEAAMKYCTYESIQTGTMGKAAK |
| Ga0315291_101118326 | 3300031707 | Sediment | MENYTEESITKYPTPDKQYEAAMKYCTYESLQTGAMGKSAK |
| Ga0315291_102211445 | 3300031707 | Sediment | MMDNYTEEDIAKYPTPDKQYAGAMKYCAYDSIQTGAMGKPAK |
| Ga0315291_105449334 | 3300031707 | Sediment | MENYSEDITKYPTPDKQYDGAKKYETYESIQTGAQGKAC |
| Ga0315291_105898003 | 3300031707 | Sediment | MENYEEDITKYPTPDKQYEGAKKYETYESVQTGAQGKAC |
| Ga0315291_108059224 | 3300031707 | Sediment | YTEESITKYPTPDKQYDGAKKYETYESIQTGAQGKNC |
| Ga0315291_112024603 | 3300031707 | Sediment | MENYSEDITKYPTPDKQYEGASKYETYESIQTGAQGKAC |
| Ga0315907_102630441 | 3300031758 | Freshwater | MENYTEDITKYPTPDKQYEGAKKYETYESLQTGAMGKSAK |
| Ga0315288_103635475 | 3300031772 | Sediment | MENYTEESITKYPTPDKQYDGAKKYETYESIQTGAQGKNC |
| Ga0315899_107263222 | 3300031784 | Freshwater | MENYAKMEMESDEYIAKYPTPDKQYAGAMKYCTYESIQTGAMGKAAK |
| Ga0315899_109622513 | 3300031784 | Freshwater | MENYEEDITKYPTPDKQYEGAMKFQSYESVQTGAMGKAAK |
| Ga0315899_109681591 | 3300031784 | Freshwater | MENYTEESIVKYPTPDKQYDGAKKYETYESLQTGAMGKSAK |
| Ga0315900_102349416 | 3300031787 | Freshwater | MENYAKMEMESDEYITKYPTPDKQYVGAMKYCTYESIQTGAMGKAAK |
| Ga0315900_104211843 | 3300031787 | Freshwater | MENYEEDITKYPTPDKQFPSNTKYETYESLQTGAMGKSAK |
| Ga0315900_106425282 | 3300031787 | Freshwater | MENYATMESDEYITKYPTPDKQYEGAMKYCTYESIQTGAMGKAVK |
| Ga0315909_102043641 | 3300031857 | Freshwater | GMEEDLMPYPTPDKQYPNAAKYSSYESVQTGAMGKMPS |
| Ga0315909_102397674 | 3300031857 | Freshwater | MENYTEEDIAKYPTPDKQYEGAMKFQSYESIQTGAMGKAAK |
| Ga0315909_102713491 | 3300031857 | Freshwater | ESDEYITKYPTPDKQYEGAMKYCTYESIQTGAMGKAAK |
| Ga0315909_102990514 | 3300031857 | Freshwater | MENYKEEEITKYPTPDKQYDGAKKYETYESLQTGAMGKAAK |
| Ga0315909_105410613 | 3300031857 | Freshwater | MENYTEESITKYPTPDKQYDGAKKYETYESLQTGAMGKAAK |
| Ga0315285_108535611 | 3300031885 | Sediment | MENYEEDITKYPTPDKQYEGAMKFQSYESVQTGAQGKAC |
| Ga0315904_100026214 | 3300031951 | Freshwater | MENYKEEEITKYPTPDKQYDGAKKYETYESVQTGAMGKSAK |
| Ga0315904_100580918 | 3300031951 | Freshwater | MENYSEDITKYPTPDKQYDGAKKYETYESLQTGAMGKSAK |
| Ga0315904_102671863 | 3300031951 | Freshwater | MENYEEDIAKYPTPDKQYEGAMKFQSYESVQTGAMGKSAK |
| Ga0315906_108153821 | 3300032050 | Freshwater | EVMENYKEEEITKYPTPDKQYDGAKKYETYESLQTGAMGKAAK |
| Ga0315905_101925318 | 3300032092 | Freshwater | MEKMSYEEYFEKYPTPELQYENAMKYSTYESVQTGAMGKATN |
| Ga0315902_104653954 | 3300032093 | Freshwater | VMENYEEDITKYPTPDKQFPSNTKYETYESLQTGAMGKSAK |
| Ga0315902_110851343 | 3300032093 | Freshwater | ENYEEDITKYPTPDKQYEGAMKFQSYESVQTGAMGKAAK |
| Ga0315277_108493844 | 3300032118 | Sediment | MMDNYTEEDIAKYSTPDKQYAGAMKYCAYDSIQTGAMGKPAK |
| Ga0315283_121987951 | 3300032164 | Sediment | MENYEEDITKYPTPDKQYDGAKKYETYESLQTGAQGKAC |
| Ga0315270_110609383 | 3300032275 | Sediment | GEEEVMENYEEDITKYPTPDKQYEGAKKYETYESVQTGAQGKAC |
| Ga0315273_102929491 | 3300032516 | Sediment | MVDNYTEEDIAKYPTPDKQYAGAMKYCAYDSIQTGAMGKPAK |
| Ga0334980_0097011_185_307 | 3300033816 | Freshwater | MENYEEDITKYPTPDKQYEGAMKFQSYESLQTGAMGKSAK |
| Ga0334977_0538573_234_356 | 3300033978 | Freshwater | MENYTEDITKYPTPDKQYDGAKKYETYESLQTGAPGKAAK |
| Ga0334981_0208873_794_904 | 3300033980 | Freshwater | MENYSEDITKYPTPDKQYDGAKKYETYESLQTGAPGK |
| Ga0334979_0110246_16_138 | 3300033996 | Freshwater | MENYSEDIVKYPTPDKQYEAAMKYCTYESIQTGAMGKAAK |
| Ga0334979_0487274_1_156 | 3300033996 | Freshwater | AWNEEDGKEEVMENYSEDITKYPTPDKQYDGAKKYETYESIQTGAMGKSAK |
| Ga0334986_0138882_844_981 | 3300034012 | Freshwater | MENYGKMEMSEDITKYPTPDKQYEGAMKYCTYESIQTGAMGKAAK |
| Ga0334986_0165619_843_971 | 3300034012 | Freshwater | MEKMSYEEYFEKYPTPELQYENAMKYCTYESIQTGAMGKVIS |
| Ga0334985_0277461_3_122 | 3300034018 | Freshwater | MESDEYITKYPTPDKQYESAMKYCTYESIQTGAMGKAAK |
| Ga0335005_0048726_1128_1250 | 3300034022 | Freshwater | MENYEEDITKYPTPDKQYDGAKKFETYESVQTGAMGKAAK |
| Ga0335005_0223562_336_461 | 3300034022 | Freshwater | MENYKEEEIAKYPTPDKQYEGASKYETYESLQTGAIGKSAK |
| Ga0334987_0070262_140_262 | 3300034061 | Freshwater | MENYDEDLTKYPTPDKQYEGAMKYCTYESIQTGAMGKAAK |
| Ga0334995_0086536_803_925 | 3300034062 | Freshwater | MENYSEDITKYPTPDKQYDGAKKYETYESIQTGAPGKAVK |
| Ga0335000_0442070_2_112 | 3300034063 | Freshwater | ESEDLQKYPTPELQYEGAMKYCTYESIQTGAPGKMA |
| Ga0334990_0012017_130_258 | 3300034068 | Freshwater | MMDNYTEEDIAKYPTPDKQYAAAMKYCTYESIQTGAMGKAAK |
| Ga0335028_0056894_1977_2105 | 3300034071 | Freshwater | MMKNYMESEDLQKYPTPELQYEGAMKYCTYESIQTGAPGKMA |
| Ga0335028_0116719_269_391 | 3300034071 | Freshwater | MENYEEDITKYPTPDKQYEGAMKYETYESLQTGAPGKAAK |
| Ga0335020_0446050_130_246 | 3300034082 | Freshwater | MENYEEDITKYPTPDKQYEGAKKYETYESLQTGVGGKK |
| Ga0335012_0405737_271_408 | 3300034093 | Freshwater | MENYGKMEMSEDIAKYPTPDKQYEGAMKYCTYESIQTGAMGKAAK |
| Ga0335012_0509752_446_568 | 3300034093 | Freshwater | MENYLEDITKYPTPDKQYDGAKKYETYESLQTGAMGKSAK |
| Ga0335022_0201163_283_405 | 3300034095 | Freshwater | MENYSEDITKYPTPDKQYDGAKKYETYESVQTGAPGKATK |
| Ga0335022_0306148_81_203 | 3300034095 | Freshwater | MENYSEEITKYPTPDKQYESAMKYCTYESLQTGAMGKSAK |
| Ga0335027_0193854_750_872 | 3300034101 | Freshwater | MENYEEDITKHPTPDKQYDGAKKYETYESLQTGAMGKSAK |
| Ga0335027_0835907_343_465 | 3300034101 | Freshwater | MENYSEDITKYPTPDKQYEGAKKYETYESLQTGAMGKAAK |
| Ga0335029_0622129_2_112 | 3300034102 | Freshwater | MENYEEDITKYPTPDKQYEGAMKFQSYESVQTGAMGK |
| Ga0335030_0215765_300_422 | 3300034103 | Freshwater | MENYTEDITKYPTPDKQYEGAKKYETYESIQTGAMGKKAK |
| Ga0335030_0375903_325_450 | 3300034103 | Freshwater | MMENYEEDITKYPTPDKQYEGAKKYETYESLQTGAMGKSVK |
| Ga0335031_0034168_3299_3424 | 3300034104 | Freshwater | MENYKEEEIAKYPTPDKQYEGAMKYETYESIQTGAMGKSAK |
| Ga0335031_0107498_1190_1312 | 3300034104 | Freshwater | MENYKEELQKYPTPELQYEGAMKYCTYESIQTGAMGKVIN |
| Ga0335035_0492916_528_671 | 3300034105 | Freshwater | EDGEEEVMENYSEDITKYPTPDKQYDGAKKYETYESLQTGAMGKSAK |
| Ga0335066_0099434_1702_1839 | 3300034112 | Freshwater | GEEEVMENYSEDITKYPTPDKQYDGAKKYETYESLQTGAPGKAAK |
| Ga0335066_0283606_3_107 | 3300034112 | Freshwater | MENYSEDITKYPTPDKQYDGAKKYETYESIQTGAM |
| Ga0335066_0623391_145_264 | 3300034112 | Freshwater | MENYKEELEKYPTPELQYEGAMKYCTYESIQTGAPGKMA |
| Ga0335056_0663853_210_332 | 3300034120 | Freshwater | MENYKEELEKYPTPELQYEGAMKYCTYESIQTGAMGKVIN |
| Ga0335058_0189621_1058_1201 | 3300034121 | Freshwater | EDGEEEVMENYSEDITKYPTPDKQYDGAKKYETYESVQTGAMGKSAK |
| Ga0335060_0124429_516_638 | 3300034122 | Freshwater | MENYTEDITKYPTPDKQYEGAKKYETYESLQTGAPGKAAK |
| Ga0335065_0140998_3_140 | 3300034200 | Freshwater | GEEEVMENYEEDITKYPTPDKQYDGAKKYETYESLQTGAPGKAAK |
| Ga0335049_0548271_1_117 | 3300034272 | Freshwater | NYEEDITKYPTPDKQYEGAKKYETYESLQTGAMGKSAK |
| Ga0335007_0261011_995_1117 | 3300034283 | Freshwater | MENYEEEITKYPTPDKQYESAMKYCTYESLQTGAMGKSAK |
| Ga0335013_0661173_195_317 | 3300034284 | Freshwater | MENYEEDITKYPTPDKQYEGAMKYETYESLQTGAMGKSAK |
| ⦗Top⦘ |