


| Basic Information | |
|---|---|
| Family ID | F005056 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 413 |
| Average Sequence Length | 42 residues |
| Representative Sequence | TAFEQAEMILYAALDPAIASKARKGDFVKCLDHFDLLQTAIN |
| Number of Associated Samples | 170 |
| Number of Associated Scaffolds | 413 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.70 % |
| % of genes near scaffold ends (potentially truncated) | 96.85 % |
| % of genes from short scaffolds (< 2000 bps) | 91.04 % |
| Associated GOLD sequencing projects | 157 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.30 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (59.080 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (23.971 % of family members) |
| Environment Ontology (ENVO) | Unclassified (33.414 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (46.489 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 54.29% β-sheet: 0.00% Coil/Unstructured: 45.71% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.30 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 413 Family Scaffolds |
|---|---|---|
| PF12762 | DDE_Tnp_IS1595 | 1.94 |
| PF04255 | DUF433 | 1.21 |
| PF04392 | ABC_sub_bind | 1.21 |
| PF01850 | PIN | 0.97 |
| PF01656 | CbiA | 0.97 |
| PF13614 | AAA_31 | 0.97 |
| PF00589 | Phage_integrase | 0.97 |
| PF13586 | DDE_Tnp_1_2 | 0.73 |
| PF00239 | Resolvase | 0.73 |
| PF00496 | SBP_bac_5 | 0.73 |
| PF01609 | DDE_Tnp_1 | 0.73 |
| PF08028 | Acyl-CoA_dh_2 | 0.48 |
| PF01979 | Amidohydro_1 | 0.48 |
| PF13610 | DDE_Tnp_IS240 | 0.48 |
| PF14104 | DUF4277 | 0.48 |
| PF01593 | Amino_oxidase | 0.48 |
| PF13613 | HTH_Tnp_4 | 0.48 |
| PF09339 | HTH_IclR | 0.48 |
| PF14319 | Zn_Tnp_IS91 | 0.48 |
| PF04754 | Transposase_31 | 0.48 |
| PF07592 | DDE_Tnp_ISAZ013 | 0.48 |
| PF00076 | RRM_1 | 0.48 |
| PF03400 | DDE_Tnp_IS1 | 0.48 |
| PF02585 | PIG-L | 0.48 |
| PF08450 | SGL | 0.48 |
| PF13340 | DUF4096 | 0.48 |
| PF02604 | PhdYeFM_antitox | 0.48 |
| PF13359 | DDE_Tnp_4 | 0.48 |
| PF01025 | GrpE | 0.48 |
| PF00873 | ACR_tran | 0.24 |
| PF13561 | adh_short_C2 | 0.24 |
| PF12680 | SnoaL_2 | 0.24 |
| PF13602 | ADH_zinc_N_2 | 0.24 |
| PF03473 | MOSC | 0.24 |
| PF02636 | Methyltransf_28 | 0.24 |
| PF08327 | AHSA1 | 0.24 |
| PF00211 | Guanylate_cyc | 0.24 |
| PF00067 | p450 | 0.24 |
| PF00144 | Beta-lactamase | 0.24 |
| PF13650 | Asp_protease_2 | 0.24 |
| PF04909 | Amidohydro_2 | 0.24 |
| PF02310 | B12-binding | 0.24 |
| PF00691 | OmpA | 0.24 |
| PF13358 | DDE_3 | 0.24 |
| PF12760 | Zn_Tnp_IS1595 | 0.24 |
| PF02518 | HATPase_c | 0.24 |
| PF13502 | AsmA_2 | 0.24 |
| PF01548 | DEDD_Tnp_IS110 | 0.24 |
| PF12974 | Phosphonate-bd | 0.24 |
| PF14113 | Tae4 | 0.24 |
| PF00857 | Isochorismatase | 0.24 |
| PF04014 | MazE_antitoxin | 0.24 |
| PF00216 | Bac_DNA_binding | 0.24 |
| PF01425 | Amidase | 0.24 |
| PF01844 | HNH | 0.24 |
| PF03811 | Zn_Tnp_IS1 | 0.24 |
| PF04851 | ResIII | 0.24 |
| PF03050 | DDE_Tnp_IS66 | 0.24 |
| PF05015 | HigB-like_toxin | 0.24 |
| PF00805 | Pentapeptide | 0.24 |
| PF13612 | DDE_Tnp_1_3 | 0.24 |
| PF00011 | HSP20 | 0.24 |
| PF02586 | SRAP | 0.24 |
| PF08388 | GIIM | 0.24 |
| PF09656 | PGPGW | 0.24 |
| PF12204 | DUF3598 | 0.24 |
| PF07969 | Amidohydro_3 | 0.24 |
| PF13546 | DDE_5 | 0.24 |
| PF13384 | HTH_23 | 0.24 |
| PF03741 | TerC | 0.24 |
| PF07589 | PEP-CTERM | 0.24 |
| PF02534 | T4SS-DNA_transf | 0.24 |
| PF13738 | Pyr_redox_3 | 0.24 |
| PF01526 | DDE_Tnp_Tn3 | 0.24 |
| PF00079 | Serpin | 0.24 |
| PF13531 | SBP_bac_11 | 0.24 |
| PF00881 | Nitroreductase | 0.24 |
| PF10263 | SprT-like | 0.24 |
| PF16694 | Cytochrome_P460 | 0.24 |
| PF02899 | Phage_int_SAM_1 | 0.24 |
| PF06803 | DUF1232 | 0.24 |
| PF13148 | DUF3987 | 0.24 |
| PF04365 | BrnT_toxin | 0.24 |
| PF04151 | PPC | 0.24 |
| PF07859 | Abhydrolase_3 | 0.24 |
| PF00903 | Glyoxalase | 0.24 |
| PF03767 | Acid_phosphat_B | 0.24 |
| PF05199 | GMC_oxred_C | 0.24 |
| PF13333 | rve_2 | 0.24 |
| PF02954 | HTH_8 | 0.24 |
| PF13401 | AAA_22 | 0.24 |
| PF00355 | Rieske | 0.24 |
| PF07929 | PRiA4_ORF3 | 0.24 |
| PF00528 | BPD_transp_1 | 0.24 |
| PF01638 | HxlR | 0.24 |
| PF01381 | HTH_3 | 0.24 |
| PF01087 | GalP_UDP_transf | 0.24 |
| PF01610 | DDE_Tnp_ISL3 | 0.24 |
| PF13649 | Methyltransf_25 | 0.24 |
| PF02012 | BNR | 0.24 |
| PF13676 | TIR_2 | 0.24 |
| PF07690 | MFS_1 | 0.24 |
| PF13343 | SBP_bac_6 | 0.24 |
| PF13185 | GAF_2 | 0.24 |
| PF13495 | Phage_int_SAM_4 | 0.24 |
| PF08682 | DUF1780 | 0.24 |
| PF04120 | Iron_permease | 0.24 |
| PF01734 | Patatin | 0.24 |
| PF00732 | GMC_oxred_N | 0.24 |
| PF01042 | Ribonuc_L-PSP | 0.24 |
| PF02333 | Phytase | 0.24 |
| PF13701 | DDE_Tnp_1_4 | 0.24 |
| PF14384 | BrnA_antitoxin | 0.24 |
| PF02826 | 2-Hacid_dh_C | 0.24 |
| PF06537 | DHOR | 0.24 |
| PF00664 | ABC_membrane | 0.24 |
| PF00248 | Aldo_ket_red | 0.24 |
| PF01695 | IstB_IS21 | 0.24 |
| PF13560 | HTH_31 | 0.24 |
| PF10282 | Lactonase | 0.24 |
| PF11848 | DUF3368 | 0.24 |
| PF09458 | H_lectin | 0.24 |
| PF00920 | ILVD_EDD | 0.24 |
| PF16998 | 17kDa_Anti_2 | 0.24 |
| PF13419 | HAD_2 | 0.24 |
| PF07885 | Ion_trans_2 | 0.24 |
| COG ID | Name | Functional Category | % Frequency in 413 Family Scaffolds |
|---|---|---|---|
| COG2442 | Predicted antitoxin component of a toxin-antitoxin system, DUF433 family | Defense mechanisms [V] | 1.21 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 1.21 |
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.73 |
| COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 0.73 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.73 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.73 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.73 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.73 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.73 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.73 |
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 0.48 |
| COG2120 | N-acetylglucosaminyl deacetylase, LmbE family | Carbohydrate transport and metabolism [G] | 0.48 |
| COG2161 | Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family | Defense mechanisms [V] | 0.48 |
| COG2303 | Choline dehydrogenase or related flavoprotein | Lipid transport and metabolism [I] | 0.48 |
| COG3386 | Sugar lactone lactonase YvrE | Carbohydrate transport and metabolism [G] | 0.48 |
| COG3391 | DNA-binding beta-propeller fold protein YncE | General function prediction only [R] | 0.48 |
| COG4118 | Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor | Defense mechanisms [V] | 0.48 |
| COG5464 | Recombination-promoting DNA endonuclease RpnC/YadD | Replication, recombination and repair [L] | 0.48 |
| COG0129 | Dihydroxyacid dehydratase/phosphogluconate dehydratase | Carbohydrate transport and metabolism [G] | 0.48 |
| COG0576 | Molecular chaperone GrpE (heat shock protein HSP-70) | Posttranslational modification, protein turnover, chaperones [O] | 0.48 |
| COG1662 | Transposase and inactivated derivatives, IS1 family | Mobilome: prophages, transposons [X] | 0.48 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.24 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.24 |
| COG1752 | Predicted acylesterase/phospholipase RssA, containd patatin domain | General function prediction only [R] | 0.24 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.24 |
| COG2124 | Cytochrome P450 | Defense mechanisms [V] | 0.24 |
| COG2135 | ssDNA abasic site-binding protein YedK/HMCES, SRAP family | Replication, recombination and repair [L] | 0.24 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.24 |
| COG2503 | Predicted secreted acid phosphatase | General function prediction only [R] | 0.24 |
| COG2929 | Ribonuclease BrnT, toxin component of the BrnT-BrnA toxin-antitoxin system | Defense mechanisms [V] | 0.24 |
| COG3339 | Uncharacterized membrane protein YkvA, DUF1232 family | Function unknown [S] | 0.24 |
| COG3436 | Transposase | Mobilome: prophages, transposons [X] | 0.24 |
| COG3464 | Transposase | Mobilome: prophages, transposons [X] | 0.24 |
| COG3488 | Uncharacterized conserved protein with two CxxC motifs, DUF1111 family | General function prediction only [R] | 0.24 |
| COG3505 | Type IV secretory pathway, VirD4 component, TraG/TraD family ATPase | Intracellular trafficking, secretion, and vesicular transport [U] | 0.24 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.24 |
| COG3549 | Plasmid maintenance system killer protein | Defense mechanisms [V] | 0.24 |
| COG3621 | Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotR | General function prediction only [R] | 0.24 |
| COG3677 | Transposase InsA | Mobilome: prophages, transposons [X] | 0.24 |
| COG3700 | Acid phosphatase, class B | Inorganic ion transport and metabolism [P] | 0.24 |
| COG4247 | 3-phytase (myo-inositol-hexaphosphate 3-phosphohydrolase) | Lipid transport and metabolism [I] | 0.24 |
| COG4644 | Transposase and inactivated derivatives, TnpA family | Mobilome: prophages, transposons [X] | 0.24 |
| COG4667 | Predicted phospholipase, patatin/cPLA2 family | Lipid transport and metabolism [I] | 0.24 |
| COG4826 | Serine protease inhibitor | Posttranslational modification, protein turnover, chaperones [O] | 0.24 |
| COG4973 | Site-specific recombinase XerC | Replication, recombination and repair [L] | 0.24 |
| COG4974 | Site-specific recombinase XerD | Replication, recombination and repair [L] | 0.24 |
| COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 0.24 |
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 0.24 |
| COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 0.24 |
| COG0657 | Acetyl esterase/lipase | Lipid transport and metabolism [I] | 0.24 |
| COG0776 | Bacterial nucleoid DNA-binding protein IHF-alpha | Replication, recombination and repair [L] | 0.24 |
| COG0861 | Tellurite resistance membrane protein TerC | Inorganic ion transport and metabolism [P] | 0.24 |
| COG1335 | Nicotinamidase-related amidase | Coenzyme transport and metabolism [H] | 0.24 |
| COG1357 | Uncharacterized conserved protein YjbI, contains pentapeptide repeats | Function unknown [S] | 0.24 |
| COG1484 | DNA replication protein DnaC | Replication, recombination and repair [L] | 0.24 |
| COG1535 | Isochorismate hydrolase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.24 |
| COG1565 | SAM-dependent methyltransferase, MidA family | General function prediction only [R] | 0.24 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.24 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 59.56 % |
| Unclassified | root | N/A | 40.44 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2162886007|SwRhRL2b_contig_3899274 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 836 | Open in IMG/M |
| 3300000890|JGI11643J12802_11989809 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 530 | Open in IMG/M |
| 3300000955|JGI1027J12803_102589557 | Not Available | 508 | Open in IMG/M |
| 3300000955|JGI1027J12803_108709094 | Not Available | 820 | Open in IMG/M |
| 3300004268|Ga0066398_10018999 | All Organisms → cellular organisms → Bacteria | 1133 | Open in IMG/M |
| 3300004463|Ga0063356_100360758 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales | 1844 | Open in IMG/M |
| 3300004463|Ga0063356_102698345 | Not Available | 764 | Open in IMG/M |
| 3300004633|Ga0066395_10615124 | Not Available | 638 | Open in IMG/M |
| 3300005180|Ga0066685_10098754 | All Organisms → cellular organisms → Bacteria | 1947 | Open in IMG/M |
| 3300005294|Ga0065705_10006821 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → delta proteobacterium NaphS2 | 3448 | Open in IMG/M |
| 3300005294|Ga0065705_10034092 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1502 | Open in IMG/M |
| 3300005294|Ga0065705_10302258 | Not Available | 1047 | Open in IMG/M |
| 3300005294|Ga0065705_10741221 | Not Available | 634 | Open in IMG/M |
| 3300005332|Ga0066388_100639619 | All Organisms → cellular organisms → Bacteria | 1680 | Open in IMG/M |
| 3300005332|Ga0066388_101913111 | Not Available | 1059 | Open in IMG/M |
| 3300005332|Ga0066388_102535289 | Not Available | 933 | Open in IMG/M |
| 3300005332|Ga0066388_102935650 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Gemmatales → Gemmataceae | 871 | Open in IMG/M |
| 3300005332|Ga0066388_102939951 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia autotrophica | 871 | Open in IMG/M |
| 3300005332|Ga0066388_102979616 | Not Available | 865 | Open in IMG/M |
| 3300005332|Ga0066388_103668053 | All Organisms → cellular organisms → Bacteria | 784 | Open in IMG/M |
| 3300005332|Ga0066388_103885612 | Not Available | 762 | Open in IMG/M |
| 3300005332|Ga0066388_103916349 | All Organisms → cellular organisms → Bacteria | 759 | Open in IMG/M |
| 3300005332|Ga0066388_103926431 | Not Available | 758 | Open in IMG/M |
| 3300005332|Ga0066388_104747091 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
| 3300005332|Ga0066388_106139192 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300005332|Ga0066388_106180191 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 604 | Open in IMG/M |
| 3300005332|Ga0066388_107393666 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300005332|Ga0066388_107679878 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 540 | Open in IMG/M |
| 3300005332|Ga0066388_108030911 | Not Available | 527 | Open in IMG/M |
| 3300005332|Ga0066388_108314752 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300005332|Ga0066388_108609619 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 507 | Open in IMG/M |
| 3300005347|Ga0070668_101472223 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 622 | Open in IMG/M |
| 3300005445|Ga0070708_100242295 | All Organisms → cellular organisms → Bacteria | 1693 | Open in IMG/M |
| 3300005468|Ga0070707_102200610 | Not Available | 519 | Open in IMG/M |
| 3300005471|Ga0070698_101885420 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 551 | Open in IMG/M |
| 3300005536|Ga0070697_101359086 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300005544|Ga0070686_101142985 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella gemina | 645 | Open in IMG/M |
| 3300005544|Ga0070686_101947902 | Not Available | 502 | Open in IMG/M |
| 3300005552|Ga0066701_10449641 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → Candidatus Portnoybacteria → Candidatus Portnoybacteria bacterium RIFCSPHIGHO2_12_FULL_38_9 | 800 | Open in IMG/M |
| 3300005552|Ga0066701_10949286 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella factor | 509 | Open in IMG/M |
| 3300005558|Ga0066698_10318226 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → Ktedonobacter racemifer | 1077 | Open in IMG/M |
| 3300005561|Ga0066699_10923030 | Not Available | 608 | Open in IMG/M |
| 3300005615|Ga0070702_101446091 | Not Available | 563 | Open in IMG/M |
| 3300005713|Ga0066905_100120942 | All Organisms → cellular organisms → Bacteria | 1827 | Open in IMG/M |
| 3300005764|Ga0066903_100716269 | All Organisms → cellular organisms → Bacteria | 1768 | Open in IMG/M |
| 3300005764|Ga0066903_101036616 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1504 | Open in IMG/M |
| 3300005764|Ga0066903_101098105 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1466 | Open in IMG/M |
| 3300005764|Ga0066903_101145793 | All Organisms → cellular organisms → Bacteria | 1439 | Open in IMG/M |
| 3300005764|Ga0066903_101208366 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella factor | 1404 | Open in IMG/M |
| 3300005764|Ga0066903_101448416 | All Organisms → cellular organisms → Bacteria | 1293 | Open in IMG/M |
| 3300005764|Ga0066903_102208612 | All Organisms → cellular organisms → Bacteria | 1061 | Open in IMG/M |
| 3300005764|Ga0066903_102910070 | Not Available | 928 | Open in IMG/M |
| 3300005764|Ga0066903_104366252 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
| 3300005764|Ga0066903_104502211 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 743 | Open in IMG/M |
| 3300005764|Ga0066903_104907808 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
| 3300005764|Ga0066903_105133226 | Not Available | 693 | Open in IMG/M |
| 3300005764|Ga0066903_107674473 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 555 | Open in IMG/M |
| 3300005764|Ga0066903_108233137 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300005764|Ga0066903_108388707 | Not Available | 527 | Open in IMG/M |
| 3300005843|Ga0068860_100763889 | All Organisms → cellular organisms → Bacteria | 979 | Open in IMG/M |
| 3300005937|Ga0081455_10168269 | All Organisms → cellular organisms → Bacteria | 1672 | Open in IMG/M |
| 3300005981|Ga0081538_10020020 | All Organisms → cellular organisms → Bacteria | 4945 | Open in IMG/M |
| 3300005981|Ga0081538_10215745 | Not Available | 767 | Open in IMG/M |
| 3300005981|Ga0081538_10305881 | Not Available | 583 | Open in IMG/M |
| 3300005983|Ga0081540_1080007 | Not Available | 1475 | Open in IMG/M |
| 3300005985|Ga0081539_10074777 | All Organisms → cellular organisms → Bacteria | 1803 | Open in IMG/M |
| 3300006041|Ga0075023_100596108 | Not Available | 513 | Open in IMG/M |
| 3300006049|Ga0075417_10236643 | Not Available | 872 | Open in IMG/M |
| 3300006049|Ga0075417_10374730 | Not Available | 700 | Open in IMG/M |
| 3300006049|Ga0075417_10447679 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300006058|Ga0075432_10060487 | All Organisms → cellular organisms → Bacteria | 1348 | Open in IMG/M |
| 3300006196|Ga0075422_10159648 | All Organisms → cellular organisms → Bacteria | 906 | Open in IMG/M |
| 3300006844|Ga0075428_100135034 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium | 2683 | Open in IMG/M |
| 3300006844|Ga0075428_100197838 | All Organisms → cellular organisms → Bacteria | 2173 | Open in IMG/M |
| 3300006844|Ga0075428_100548847 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella | 1235 | Open in IMG/M |
| 3300006844|Ga0075428_100585014 | Not Available | 1193 | Open in IMG/M |
| 3300006844|Ga0075428_100996828 | All Organisms → cellular organisms → Bacteria | 887 | Open in IMG/M |
| 3300006844|Ga0075428_101301377 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
| 3300006844|Ga0075428_101949122 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_2_20CM_2_54_8 | 609 | Open in IMG/M |
| 3300006844|Ga0075428_102376352 | Not Available | 544 | Open in IMG/M |
| 3300006844|Ga0075428_102569681 | Not Available | 521 | Open in IMG/M |
| 3300006844|Ga0075428_102650563 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300006845|Ga0075421_100171670 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium | 2701 | Open in IMG/M |
| 3300006845|Ga0075421_100627303 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1259 | Open in IMG/M |
| 3300006845|Ga0075421_101026720 | Not Available | 931 | Open in IMG/M |
| 3300006845|Ga0075421_101875366 | Not Available | 642 | Open in IMG/M |
| 3300006845|Ga0075421_102347451 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300006846|Ga0075430_100263324 | Not Available | 1428 | Open in IMG/M |
| 3300006846|Ga0075430_100348819 | All Organisms → cellular organisms → Bacteria | 1222 | Open in IMG/M |
| 3300006846|Ga0075430_100378988 | Not Available | 1167 | Open in IMG/M |
| 3300006846|Ga0075430_100643125 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 875 | Open in IMG/M |
| 3300006846|Ga0075430_100818300 | Not Available | 767 | Open in IMG/M |
| 3300006847|Ga0075431_100268607 | All Organisms → cellular organisms → Bacteria | 1729 | Open in IMG/M |
| 3300006847|Ga0075431_101280210 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
| 3300006847|Ga0075431_101412452 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300006847|Ga0075431_101626004 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 603 | Open in IMG/M |
| 3300006847|Ga0075431_101908836 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella factor | 549 | Open in IMG/M |
| 3300006847|Ga0075431_102217770 | Not Available | 503 | Open in IMG/M |
| 3300006852|Ga0075433_10107506 | All Organisms → cellular organisms → Bacteria | 2473 | Open in IMG/M |
| 3300006852|Ga0075433_10468065 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1110 | Open in IMG/M |
| 3300006852|Ga0075433_10496402 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 1074 | Open in IMG/M |
| 3300006852|Ga0075433_11287497 | Not Available | 634 | Open in IMG/M |
| 3300006852|Ga0075433_11461748 | Not Available | 591 | Open in IMG/M |
| 3300006852|Ga0075433_11738418 | Not Available | 537 | Open in IMG/M |
| 3300006853|Ga0075420_100854330 | All Organisms → cellular organisms → Bacteria | 783 | Open in IMG/M |
| 3300006853|Ga0075420_101254551 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300006853|Ga0075420_101413075 | Not Available | 597 | Open in IMG/M |
| 3300006853|Ga0075420_101814740 | Not Available | 522 | Open in IMG/M |
| 3300006854|Ga0075425_100279485 | All Organisms → cellular organisms → Bacteria | 1922 | Open in IMG/M |
| 3300006871|Ga0075434_100191442 | All Organisms → cellular organisms → Bacteria | 2066 | Open in IMG/M |
| 3300006876|Ga0079217_10213482 | Not Available | 997 | Open in IMG/M |
| 3300006880|Ga0075429_100224960 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Gemmatales → Gemmataceae → Gemmata → unclassified Gemmata → Gemmata sp. | 1643 | Open in IMG/M |
| 3300006880|Ga0075429_100362304 | All Organisms → cellular organisms → Bacteria | 1269 | Open in IMG/M |
| 3300006880|Ga0075429_100689674 | Not Available | 895 | Open in IMG/M |
| 3300006880|Ga0075429_100878744 | All Organisms → cellular organisms → Bacteria | 785 | Open in IMG/M |
| 3300006880|Ga0075429_101199379 | Not Available | 662 | Open in IMG/M |
| 3300006880|Ga0075429_101230167 | Not Available | 653 | Open in IMG/M |
| 3300006880|Ga0075429_101737788 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300006880|Ga0075429_101798064 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 532 | Open in IMG/M |
| 3300006880|Ga0075429_101862266 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella palauensis | 521 | Open in IMG/M |
| 3300006880|Ga0075429_101957850 | Not Available | 507 | Open in IMG/M |
| 3300006969|Ga0075419_10247398 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1191 | Open in IMG/M |
| 3300006969|Ga0075419_10869882 | Not Available | 649 | Open in IMG/M |
| 3300007076|Ga0075435_101332079 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
| 3300007255|Ga0099791_10100210 | Not Available | 1333 | Open in IMG/M |
| 3300007258|Ga0099793_10067083 | All Organisms → cellular organisms → Bacteria | 1614 | Open in IMG/M |
| 3300009012|Ga0066710_100395959 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2057 | Open in IMG/M |
| 3300009012|Ga0066710_100619882 | Not Available | 1643 | Open in IMG/M |
| 3300009012|Ga0066710_101284462 | All Organisms → cellular organisms → Bacteria | 1135 | Open in IMG/M |
| 3300009012|Ga0066710_101505673 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella | 1038 | Open in IMG/M |
| 3300009012|Ga0066710_102833751 | Not Available | 684 | Open in IMG/M |
| 3300009090|Ga0099827_10786585 | Not Available | 823 | Open in IMG/M |
| 3300009094|Ga0111539_10360238 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Lacipirellulaceae → Pirellulimonas → Pirellulimonas nuda | 1693 | Open in IMG/M |
| 3300009094|Ga0111539_10746181 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1139 | Open in IMG/M |
| 3300009094|Ga0111539_10774144 | Not Available | 1117 | Open in IMG/M |
| 3300009094|Ga0111539_10891842 | All Organisms → cellular organisms → Bacteria | 1034 | Open in IMG/M |
| 3300009094|Ga0111539_12171484 | Not Available | 644 | Open in IMG/M |
| 3300009100|Ga0075418_10263833 | All Organisms → cellular organisms → Bacteria | 1835 | Open in IMG/M |
| 3300009100|Ga0075418_10659285 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division NC10 → unclassified candidate division NC10 → candidate division NC10 bacterium | 1127 | Open in IMG/M |
| 3300009100|Ga0075418_10907781 | Not Available | 952 | Open in IMG/M |
| 3300009100|Ga0075418_11062402 | Not Available | 877 | Open in IMG/M |
| 3300009100|Ga0075418_11216110 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_2_20CM_2_54_8 | 817 | Open in IMG/M |
| 3300009100|Ga0075418_11951603 | Not Available | 639 | Open in IMG/M |
| 3300009100|Ga0075418_12419405 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 573 | Open in IMG/M |
| 3300009100|Ga0075418_13161113 | Not Available | 501 | Open in IMG/M |
| 3300009137|Ga0066709_100161886 | All Organisms → cellular organisms → Bacteria | 2881 | Open in IMG/M |
| 3300009137|Ga0066709_100358987 | All Organisms → cellular organisms → Bacteria | 2005 | Open in IMG/M |
| 3300009137|Ga0066709_101120148 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella | 1158 | Open in IMG/M |
| 3300009147|Ga0114129_10033976 | All Organisms → cellular organisms → Bacteria | 7203 | Open in IMG/M |
| 3300009147|Ga0114129_10553934 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1495 | Open in IMG/M |
| 3300009147|Ga0114129_10633519 | Not Available | 1382 | Open in IMG/M |
| 3300009147|Ga0114129_10701984 | Not Available | 1300 | Open in IMG/M |
| 3300009147|Ga0114129_10948133 | All Organisms → cellular organisms → Bacteria | 1087 | Open in IMG/M |
| 3300009147|Ga0114129_11105838 | Not Available | 992 | Open in IMG/M |
| 3300009147|Ga0114129_12421699 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 628 | Open in IMG/M |
| 3300009147|Ga0114129_12541175 | Not Available | 612 | Open in IMG/M |
| 3300009147|Ga0114129_12656092 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300009156|Ga0111538_10358356 | All Organisms → cellular organisms → Bacteria | 1846 | Open in IMG/M |
| 3300009156|Ga0111538_10384772 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1776 | Open in IMG/M |
| 3300009156|Ga0111538_10790528 | All Organisms → cellular organisms → Bacteria | 1202 | Open in IMG/M |
| 3300009156|Ga0111538_11253220 | Not Available | 937 | Open in IMG/M |
| 3300009162|Ga0075423_10462893 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1333 | Open in IMG/M |
| 3300009162|Ga0075423_12354784 | Not Available | 580 | Open in IMG/M |
| 3300009168|Ga0105104_10474268 | Not Available | 702 | Open in IMG/M |
| 3300009515|Ga0129286_10122378 | Not Available | 806 | Open in IMG/M |
| 3300009553|Ga0105249_10240782 | Not Available | 1789 | Open in IMG/M |
| 3300009553|Ga0105249_10966505 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 920 | Open in IMG/M |
| 3300009553|Ga0105249_11079940 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 872 | Open in IMG/M |
| 3300009553|Ga0105249_12311139 | Not Available | 610 | Open in IMG/M |
| 3300009553|Ga0105249_13478476 | Not Available | 507 | Open in IMG/M |
| 3300009792|Ga0126374_10300215 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae → unclassified Desulfobulbaceae → Desulfobulbaceae bacterium BRH_c16a | 1076 | Open in IMG/M |
| 3300009792|Ga0126374_11195085 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 608 | Open in IMG/M |
| 3300009792|Ga0126374_11470266 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300009822|Ga0105066_1103603 | Not Available | 630 | Open in IMG/M |
| 3300010042|Ga0126314_11506293 | Not Available | 505 | Open in IMG/M |
| 3300010043|Ga0126380_10184011 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 1380 | Open in IMG/M |
| 3300010043|Ga0126380_10333384 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 1096 | Open in IMG/M |
| 3300010043|Ga0126380_10457429 | Not Available | 967 | Open in IMG/M |
| 3300010043|Ga0126380_10600985 | All Organisms → cellular organisms → Bacteria | 866 | Open in IMG/M |
| 3300010043|Ga0126380_10942651 | Not Available | 721 | Open in IMG/M |
| 3300010043|Ga0126380_11064662 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
| 3300010043|Ga0126380_11202136 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 653 | Open in IMG/M |
| 3300010043|Ga0126380_12298678 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300010046|Ga0126384_10181421 | Not Available | 1650 | Open in IMG/M |
| 3300010046|Ga0126384_10186581 | All Organisms → cellular organisms → Bacteria | 1630 | Open in IMG/M |
| 3300010046|Ga0126384_10285305 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella | 1351 | Open in IMG/M |
| 3300010046|Ga0126384_10410486 | All Organisms → cellular organisms → Bacteria | 1146 | Open in IMG/M |
| 3300010046|Ga0126384_10422932 | All Organisms → cellular organisms → Bacteria | 1130 | Open in IMG/M |
| 3300010046|Ga0126384_11228001 | Not Available | 692 | Open in IMG/M |
| 3300010046|Ga0126384_11687643 | Not Available | 599 | Open in IMG/M |
| 3300010046|Ga0126384_11804908 | Not Available | 581 | Open in IMG/M |
| 3300010046|Ga0126384_12128403 | Not Available | 539 | Open in IMG/M |
| 3300010046|Ga0126384_12370788 | Not Available | 513 | Open in IMG/M |
| 3300010046|Ga0126384_12405545 | Not Available | 510 | Open in IMG/M |
| 3300010047|Ga0126382_10055275 | All Organisms → cellular organisms → Bacteria | 2350 | Open in IMG/M |
| 3300010047|Ga0126382_10080600 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 2034 | Open in IMG/M |
| 3300010047|Ga0126382_10097771 | Not Available | 1887 | Open in IMG/M |
| 3300010047|Ga0126382_10305659 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Halieaceae → Congregibacter → Congregibacter litoralis | 1196 | Open in IMG/M |
| 3300010047|Ga0126382_10393320 | Not Available | 1079 | Open in IMG/M |
| 3300010047|Ga0126382_10600379 | All Organisms → cellular organisms → Bacteria | 906 | Open in IMG/M |
| 3300010047|Ga0126382_10628231 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Tylenchomorpha → Tylenchoidea → Tylenchidae → Tylenchinae → Labrys | 889 | Open in IMG/M |
| 3300010047|Ga0126382_10717027 | All Organisms → cellular organisms → Bacteria | 841 | Open in IMG/M |
| 3300010047|Ga0126382_11614239 | Not Available | 602 | Open in IMG/M |
| 3300010047|Ga0126382_11861028 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300010047|Ga0126382_12264130 | Not Available | 524 | Open in IMG/M |
| 3300010321|Ga0134067_10331777 | Not Available | 594 | Open in IMG/M |
| 3300010358|Ga0126370_10046497 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2731 | Open in IMG/M |
| 3300010358|Ga0126370_10048020 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 2695 | Open in IMG/M |
| 3300010358|Ga0126370_10050251 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2646 | Open in IMG/M |
| 3300010358|Ga0126370_10131973 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1790 | Open in IMG/M |
| 3300010358|Ga0126370_10166685 | All Organisms → cellular organisms → Bacteria | 1626 | Open in IMG/M |
| 3300010358|Ga0126370_10328369 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Herpetosiphonales → Herpetosiphonaceae → unclassified Herpetosiphonaceae → Herpetosiphonaceae bacterium | 1226 | Open in IMG/M |
| 3300010358|Ga0126370_10569185 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium CG_4_8_14_3_um_filter_66_20 | 972 | Open in IMG/M |
| 3300010358|Ga0126370_10969129 | Not Available | 774 | Open in IMG/M |
| 3300010358|Ga0126370_11605968 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 622 | Open in IMG/M |
| 3300010359|Ga0126376_10280071 | All Organisms → cellular organisms → Bacteria | 1437 | Open in IMG/M |
| 3300010359|Ga0126376_10424305 | Not Available | 1206 | Open in IMG/M |
| 3300010359|Ga0126376_11466674 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 710 | Open in IMG/M |
| 3300010359|Ga0126376_11865182 | Not Available | 640 | Open in IMG/M |
| 3300010359|Ga0126376_12195173 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 597 | Open in IMG/M |
| 3300010359|Ga0126376_13138876 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300010359|Ga0126376_13166096 | Not Available | 509 | Open in IMG/M |
| 3300010360|Ga0126372_10882711 | Not Available | 895 | Open in IMG/M |
| 3300010360|Ga0126372_11631385 | Not Available | 684 | Open in IMG/M |
| 3300010360|Ga0126372_11941869 | Not Available | 634 | Open in IMG/M |
| 3300010361|Ga0126378_11078921 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Peregrinibacteria → Candidatus Peribacteria → unclassified Candidatus Peribacteria → Candidatus Peribacteria bacterium RIFCSPHIGHO2_01_FULL_51_35 | 905 | Open in IMG/M |
| 3300010361|Ga0126378_11336595 | Not Available | 811 | Open in IMG/M |
| 3300010361|Ga0126378_12189069 | Not Available | 631 | Open in IMG/M |
| 3300010361|Ga0126378_12577210 | Not Available | 581 | Open in IMG/M |
| 3300010362|Ga0126377_11075291 | Not Available | 873 | Open in IMG/M |
| 3300010362|Ga0126377_11093642 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 866 | Open in IMG/M |
| 3300010362|Ga0126377_11220090 | All Organisms → cellular organisms → Bacteria | 823 | Open in IMG/M |
| 3300010362|Ga0126377_11896430 | Not Available | 672 | Open in IMG/M |
| 3300010362|Ga0126377_12395912 | Not Available | 604 | Open in IMG/M |
| 3300010362|Ga0126377_12528257 | Not Available | 589 | Open in IMG/M |
| 3300010362|Ga0126377_12745215 | Not Available | 567 | Open in IMG/M |
| 3300010362|Ga0126377_13175153 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300010362|Ga0126377_13577580 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_2_20CM_53_11 | 503 | Open in IMG/M |
| 3300010366|Ga0126379_10706329 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1102 | Open in IMG/M |
| 3300010366|Ga0126379_11695241 | Not Available | 737 | Open in IMG/M |
| 3300010366|Ga0126379_11706967 | All Organisms → cellular organisms → Archaea → environmental samples → uncultured archaeon | 734 | Open in IMG/M |
| 3300010366|Ga0126379_11818604 | Not Available | 713 | Open in IMG/M |
| 3300010366|Ga0126379_13172359 | Not Available | 550 | Open in IMG/M |
| 3300010398|Ga0126383_10180862 | All Organisms → cellular organisms → Bacteria | 2004 | Open in IMG/M |
| 3300010398|Ga0126383_10563309 | Not Available | 1206 | Open in IMG/M |
| 3300010398|Ga0126383_10923033 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 960 | Open in IMG/M |
| 3300010398|Ga0126383_10938630 | All Organisms → cellular organisms → Bacteria | 952 | Open in IMG/M |
| 3300010398|Ga0126383_11590594 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
| 3300010398|Ga0126383_12481695 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 603 | Open in IMG/M |
| 3300010398|Ga0126383_13076674 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 545 | Open in IMG/M |
| 3300010398|Ga0126383_13502223 | Not Available | 513 | Open in IMG/M |
| 3300011119|Ga0105246_11997253 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300011271|Ga0137393_10991031 | Not Available | 716 | Open in IMG/M |
| 3300011412|Ga0137424_1120562 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 548 | Open in IMG/M |
| 3300012021|Ga0120192_10024769 | Not Available | 965 | Open in IMG/M |
| 3300012199|Ga0137383_10304781 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Acidiferrobacterales → Acidiferrobacteraceae → Acidiferrobacter → unclassified Acidiferrobacter → Acidiferrobacter sp. SPIII_3 | 1167 | Open in IMG/M |
| 3300012199|Ga0137383_10645863 | All Organisms → cellular organisms → Bacteria | 774 | Open in IMG/M |
| 3300012204|Ga0137374_10096806 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexi incertae sedis → SAR202 cluster → SAR202 cluster bacterium Io17-Chloro-G9 | 2797 | Open in IMG/M |
| 3300012206|Ga0137380_10363367 | Not Available | 1290 | Open in IMG/M |
| 3300012206|Ga0137380_10529668 | Not Available | 1035 | Open in IMG/M |
| 3300012206|Ga0137380_10759164 | Not Available | 839 | Open in IMG/M |
| 3300012206|Ga0137380_11017571 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 708 | Open in IMG/M |
| 3300012206|Ga0137380_11077191 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
| 3300012207|Ga0137381_10259975 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1509 | Open in IMG/M |
| 3300012207|Ga0137381_10382657 | All Organisms → cellular organisms → Bacteria | 1227 | Open in IMG/M |
| 3300012207|Ga0137381_10462533 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Candidatus Vecturithrix → Candidatus Vecturithrix granuli | 1107 | Open in IMG/M |
| 3300012207|Ga0137381_10829251 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 801 | Open in IMG/M |
| 3300012207|Ga0137381_11338623 | Not Available | 609 | Open in IMG/M |
| 3300012209|Ga0137379_10512340 | Not Available | 1108 | Open in IMG/M |
| 3300012211|Ga0137377_11305047 | Not Available | 656 | Open in IMG/M |
| 3300012212|Ga0150985_122878011 | Not Available | 504 | Open in IMG/M |
| 3300012349|Ga0137387_10678571 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 746 | Open in IMG/M |
| 3300012351|Ga0137386_10596071 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 795 | Open in IMG/M |
| 3300012355|Ga0137369_10705638 | Not Available | 693 | Open in IMG/M |
| 3300012356|Ga0137371_10515985 | All Organisms → cellular organisms → Bacteria | 922 | Open in IMG/M |
| 3300012358|Ga0137368_10065448 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2977 | Open in IMG/M |
| 3300012360|Ga0137375_10685337 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 839 | Open in IMG/M |
| 3300012362|Ga0137361_10643332 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 970 | Open in IMG/M |
| 3300012362|Ga0137361_10952602 | Not Available | 777 | Open in IMG/M |
| 3300012364|Ga0134027_1039668 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → unclassified Nitrospira → Nitrospira sp. | 661 | Open in IMG/M |
| 3300012469|Ga0150984_110954505 | Not Available | 601 | Open in IMG/M |
| 3300012685|Ga0137397_10154959 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1698 | Open in IMG/M |
| 3300012918|Ga0137396_10633187 | All Organisms → cellular organisms → Bacteria | 790 | Open in IMG/M |
| 3300012923|Ga0137359_10068501 | All Organisms → cellular organisms → Bacteria | 3101 | Open in IMG/M |
| 3300012923|Ga0137359_11094500 | Not Available | 682 | Open in IMG/M |
| 3300012923|Ga0137359_11348544 | Not Available | 601 | Open in IMG/M |
| 3300012925|Ga0137419_11836556 | Not Available | 519 | Open in IMG/M |
| 3300012930|Ga0137407_10108468 | All Organisms → cellular organisms → Bacteria | 2392 | Open in IMG/M |
| 3300012944|Ga0137410_10809798 | All Organisms → cellular organisms → Bacteria | 787 | Open in IMG/M |
| 3300012948|Ga0126375_10875147 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia piptadeniae | 719 | Open in IMG/M |
| 3300012948|Ga0126375_11258360 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella | 619 | Open in IMG/M |
| 3300012948|Ga0126375_11316616 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300012948|Ga0126375_11566374 | Not Available | 566 | Open in IMG/M |
| 3300012948|Ga0126375_11865631 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 527 | Open in IMG/M |
| 3300012971|Ga0126369_10042779 | All Organisms → cellular organisms → Bacteria | 3817 | Open in IMG/M |
| 3300012971|Ga0126369_10080734 | All Organisms → cellular organisms → Bacteria | 2884 | Open in IMG/M |
| 3300012971|Ga0126369_10162686 | All Organisms → cellular organisms → Bacteria | 2113 | Open in IMG/M |
| 3300012971|Ga0126369_10283324 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1649 | Open in IMG/M |
| 3300012971|Ga0126369_10499751 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont | 1274 | Open in IMG/M |
| 3300012971|Ga0126369_11187827 | Not Available | 853 | Open in IMG/M |
| 3300012971|Ga0126369_11800177 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 701 | Open in IMG/M |
| 3300012971|Ga0126369_11826735 | Not Available | 696 | Open in IMG/M |
| 3300012971|Ga0126369_12227136 | Not Available | 635 | Open in IMG/M |
| 3300012971|Ga0126369_12517284 | Not Available | 600 | Open in IMG/M |
| 3300012971|Ga0126369_13368651 | Not Available | 524 | Open in IMG/M |
| 3300012971|Ga0126369_13699002 | Not Available | 501 | Open in IMG/M |
| 3300012972|Ga0134077_10353624 | Not Available | 626 | Open in IMG/M |
| 3300013297|Ga0157378_11632603 | Not Available | 691 | Open in IMG/M |
| 3300013306|Ga0163162_10528011 | Not Available | 1309 | Open in IMG/M |
| 3300013306|Ga0163162_11186498 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 866 | Open in IMG/M |
| 3300013306|Ga0163162_11843600 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 692 | Open in IMG/M |
| 3300013306|Ga0163162_13071410 | Not Available | 536 | Open in IMG/M |
| 3300014271|Ga0075326_1056609 | Not Available | 1051 | Open in IMG/M |
| 3300014326|Ga0157380_10633821 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1063 | Open in IMG/M |
| 3300014968|Ga0157379_10471989 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1160 | Open in IMG/M |
| 3300015053|Ga0137405_1077229 | All Organisms → cellular organisms → Bacteria → Atribacterota → unclassified Atribacterota → Candidatus Atribacteria bacterium HGW-Atribacteria-1 | 1245 | Open in IMG/M |
| 3300015371|Ga0132258_10162265 | Not Available | 5375 | Open in IMG/M |
| 3300015371|Ga0132258_11194549 | All Organisms → cellular organisms → Bacteria | 1923 | Open in IMG/M |
| 3300016294|Ga0182041_11785624 | Not Available | 570 | Open in IMG/M |
| 3300016319|Ga0182033_10174651 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella | 1684 | Open in IMG/M |
| 3300016319|Ga0182033_10206001 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia | 1568 | Open in IMG/M |
| 3300016319|Ga0182033_12219728 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300016371|Ga0182034_11665520 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300016371|Ga0182034_11913836 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 523 | Open in IMG/M |
| 3300016387|Ga0182040_11081914 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 671 | Open in IMG/M |
| 3300016404|Ga0182037_10543415 | All Organisms → cellular organisms → Bacteria | 980 | Open in IMG/M |
| 3300016422|Ga0182039_11820582 | Not Available | 558 | Open in IMG/M |
| 3300018076|Ga0184609_10239094 | Not Available | 849 | Open in IMG/M |
| 3300018422|Ga0190265_10160684 | Not Available | 2211 | Open in IMG/M |
| 3300020170|Ga0179594_10198528 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 751 | Open in IMG/M |
| 3300021560|Ga0126371_10430386 | All Organisms → cellular organisms → Bacteria | 1464 | Open in IMG/M |
| 3300021560|Ga0126371_11600385 | Not Available | 778 | Open in IMG/M |
| 3300022413|Ga0224508_10670968 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 637 | Open in IMG/M |
| 3300024330|Ga0137417_1073626 | Not Available | 1695 | Open in IMG/M |
| 3300025910|Ga0207684_10516097 | Not Available | 1024 | Open in IMG/M |
| 3300025945|Ga0207679_11641168 | Not Available | 589 | Open in IMG/M |
| 3300025961|Ga0207712_10048180 | All Organisms → cellular organisms → Bacteria | 2963 | Open in IMG/M |
| 3300025961|Ga0207712_10345805 | All Organisms → cellular organisms → Bacteria | 1235 | Open in IMG/M |
| 3300025961|Ga0207712_11731150 | Not Available | 560 | Open in IMG/M |
| 3300025961|Ga0207712_11864222 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300025972|Ga0207668_10510366 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1036 | Open in IMG/M |
| 3300025972|Ga0207668_10748905 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 862 | Open in IMG/M |
| 3300026075|Ga0207708_10458428 | All Organisms → cellular organisms → Bacteria | 1063 | Open in IMG/M |
| 3300026075|Ga0207708_11194744 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
| 3300026088|Ga0207641_10789885 | Not Available | 939 | Open in IMG/M |
| 3300026118|Ga0207675_100736154 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 997 | Open in IMG/M |
| 3300026524|Ga0209690_1057780 | All Organisms → cellular organisms → Bacteria | 1704 | Open in IMG/M |
| 3300027511|Ga0209843_1005229 | All Organisms → cellular organisms → Bacteria | 2999 | Open in IMG/M |
| 3300027576|Ga0209003_1090314 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300027636|Ga0214469_1074531 | Not Available | 1019 | Open in IMG/M |
| 3300027655|Ga0209388_1235411 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 500 | Open in IMG/M |
| 3300027671|Ga0209588_1227322 | Not Available | 575 | Open in IMG/M |
| 3300027766|Ga0209796_10303808 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300027873|Ga0209814_10023674 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium | 2504 | Open in IMG/M |
| 3300027873|Ga0209814_10248401 | Not Available | 771 | Open in IMG/M |
| 3300027874|Ga0209465_10202119 | Not Available | 992 | Open in IMG/M |
| 3300027880|Ga0209481_10236539 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella palauensis | 918 | Open in IMG/M |
| 3300027907|Ga0207428_10859708 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 642 | Open in IMG/M |
| 3300027909|Ga0209382_10149085 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium | 2711 | Open in IMG/M |
| 3300027909|Ga0209382_10422872 | Not Available | 1480 | Open in IMG/M |
| 3300027909|Ga0209382_10617619 | All Organisms → cellular organisms → Bacteria | 1178 | Open in IMG/M |
| 3300027909|Ga0209382_10633879 | Not Available | 1159 | Open in IMG/M |
| 3300027909|Ga0209382_10868400 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella factor | 953 | Open in IMG/M |
| 3300027909|Ga0209382_10972795 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium | 887 | Open in IMG/M |
| 3300027909|Ga0209382_11289715 | Not Available | 741 | Open in IMG/M |
| 3300027909|Ga0209382_11534221 | Not Available | 662 | Open in IMG/M |
| 3300027909|Ga0209382_12042654 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300027909|Ga0209382_12165491 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300027952|Ga0209889_1038975 | Not Available | 1017 | Open in IMG/M |
| 3300028380|Ga0268265_12331551 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300028587|Ga0247828_10284843 | All Organisms → cellular organisms → Bacteria | 904 | Open in IMG/M |
| 3300028819|Ga0307296_10827366 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300030619|Ga0268386_10018881 | All Organisms → cellular organisms → Bacteria | 5408 | Open in IMG/M |
| 3300030619|Ga0268386_10034730 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 3991 | Open in IMG/M |
| 3300030620|Ga0302046_11164004 | Not Available | 607 | Open in IMG/M |
| 3300031229|Ga0299913_10120774 | All Organisms → cellular organisms → Bacteria | 2573 | Open in IMG/M |
| 3300031229|Ga0299913_10708551 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 984 | Open in IMG/M |
| 3300031229|Ga0299913_11000933 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella factor | 802 | Open in IMG/M |
| 3300031543|Ga0318516_10530152 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 675 | Open in IMG/M |
| 3300031545|Ga0318541_10340794 | All Organisms → cellular organisms → Bacteria | 837 | Open in IMG/M |
| 3300031545|Ga0318541_10390932 | Not Available | 777 | Open in IMG/M |
| 3300031546|Ga0318538_10780375 | Not Available | 519 | Open in IMG/M |
| 3300031547|Ga0310887_10249110 | All Organisms → cellular organisms → Bacteria | 990 | Open in IMG/M |
| 3300031771|Ga0318546_11355879 | Not Available | 500 | Open in IMG/M |
| 3300031820|Ga0307473_10945525 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300031845|Ga0318511_10331877 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
| 3300031890|Ga0306925_12058940 | Not Available | 536 | Open in IMG/M |
| 3300031912|Ga0306921_10940365 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 979 | Open in IMG/M |
| 3300031912|Ga0306921_11798729 | Not Available | 659 | Open in IMG/M |
| 3300031940|Ga0310901_10334485 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae → Nitrococcus → Nitrococcus mobilis → Nitrococcus mobilis Nb-231 | 644 | Open in IMG/M |
| 3300031942|Ga0310916_10523177 | All Organisms → cellular organisms → Bacteria | 1010 | Open in IMG/M |
| 3300031945|Ga0310913_10785416 | Not Available | 672 | Open in IMG/M |
| 3300031945|Ga0310913_11097253 | Not Available | 556 | Open in IMG/M |
| 3300031946|Ga0310910_11105543 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Hoyosella | 617 | Open in IMG/M |
| 3300031947|Ga0310909_10336746 | Not Available | 1266 | Open in IMG/M |
| 3300031947|Ga0310909_11189004 | Not Available | 617 | Open in IMG/M |
| 3300032002|Ga0307416_103718979 | Not Available | 511 | Open in IMG/M |
| 3300032059|Ga0318533_10601209 | All Organisms → cellular organisms → Bacteria | 807 | Open in IMG/M |
| 3300032059|Ga0318533_10943652 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 633 | Open in IMG/M |
| 3300032066|Ga0318514_10330270 | Not Available | 807 | Open in IMG/M |
| 3300032075|Ga0310890_10353250 | All Organisms → cellular organisms → Bacteria | 1076 | Open in IMG/M |
| 3300032075|Ga0310890_11485566 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300032076|Ga0306924_10849402 | Not Available | 1014 | Open in IMG/M |
| 3300032174|Ga0307470_10307579 | All Organisms → cellular organisms → Bacteria | 1078 | Open in IMG/M |
| 3300032179|Ga0310889_10560868 | Not Available | 585 | Open in IMG/M |
| 3300032180|Ga0307471_103704746 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300032261|Ga0306920_100194881 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 3024 | Open in IMG/M |
| 3300032261|Ga0306920_102525033 | Not Available | 706 | Open in IMG/M |
| 3300033289|Ga0310914_11636078 | Not Available | 548 | Open in IMG/M |
| 3300033407|Ga0214472_10001934 | All Organisms → cellular organisms → Bacteria | 22498 | Open in IMG/M |
| 3300034670|Ga0314795_083322 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 618 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 23.97% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 23.49% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 9.69% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 8.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.12% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.63% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.18% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.18% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.21% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 1.21% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.94% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.94% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.97% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.97% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.97% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.73% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.73% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.73% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.73% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.73% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.73% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.48% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.48% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.48% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.48% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.24% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.24% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.24% |
| Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment | 0.24% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.24% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.24% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.24% |
| Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 0.24% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.24% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.24% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.24% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.24% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.24% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.24% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.24% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.24% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.24% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.24% |
| Agave | Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave | 0.24% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
| 3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004268 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Host-Associated | Open in IMG/M |
| 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
| 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
| 3300006196 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 | Host-Associated | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300009515 | Microbial community of beach aquifer sediment core from Cape Shores, Lewes, Delaware, USA - CF-2 | Environmental | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009822 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40 | Environmental | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300011412 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT620_2 | Environmental | Open in IMG/M |
| 3300012021 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - T1 | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_0_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014271 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailA_D2 | Environmental | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022413 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_21 | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026524 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300027511 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_20_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027576 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027636 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57 HiSeq | Environmental | Open in IMG/M |
| 3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027766 | Agave microbial communities from Guanajuato, Mexico - Or.Sf.rz (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027952 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_0_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028587 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3 | Environmental | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300030619 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (Novaseq) | Environmental | Open in IMG/M |
| 3300030620 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111 | Environmental | Open in IMG/M |
| 3300031229 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38 | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031940 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D2 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032179 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033407 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT140D175 | Environmental | Open in IMG/M |
| 3300034670 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8R4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| SwRhRL2b_0180.00005990 | 2162886007 | Switchgrass Rhizosphere | QAELVLQAALDPTIASRAKKGEFVLCFDHFDLLQTARN |
| JGI11643J12802_119898092 | 3300000890 | Soil | FEQAELILRAALDPTIASRARGGEFVKCLDHFDLLQTAIN* |
| JGI1027J12803_1025895571 | 3300000955 | Soil | RNFRHQNAFEQAELILYAALDPTIASKARKGDFVRWLDHFDLLQTAIN* |
| JGI1027J12803_1087090942 | 3300000955 | Soil | AELILWAALDTAMATRARRDAFVKRLDYFGLLQVAIN* |
| Ga0066398_100189993 | 3300004268 | Tropical Forest Soil | QCLRNFRQRNAFEQAQLILQAALDPTIAHRAKKGEFVTCFDHFDLLQTAIN* |
| Ga0063356_1003607581 | 3300004463 | Arabidopsis Thaliana Rhizosphere | QLTAFAQAELILYAALDPSVASRAKKGEFVRCFDHFDLLQTAIN* |
| Ga0063356_1026983451 | 3300004463 | Arabidopsis Thaliana Rhizosphere | LRNFRQRNAFEQAELILQAALDPAIARRAKKGEFVKCFDRFDLLQTAIN* |
| Ga0066395_106151242 | 3300004633 | Tropical Forest Soil | FEQAEMILYAALDPCIAGKAKKGEFVKCLDHFDLLQSARN* |
| Ga0066685_100987544 | 3300005180 | Soil | YQNAFEQAELILQAALDPAIASRARRGEFVKCLDHFDLLQTAIN* |
| Ga0065705_100068211 | 3300005294 | Switchgrass Rhizosphere | RNAFEQAELILQAALDPTIANRAKKGEFVKCFDYFDLLQTAIN* |
| Ga0065705_100340922 | 3300005294 | Switchgrass Rhizosphere | LRNFYQLTAFEQAEMILYAALDPAIASKARKGDFVRCLDHFNLLQSPIN* |
| Ga0065705_103022582 | 3300005294 | Switchgrass Rhizosphere | NFYQLTAFEQAEMILYAALDPAIASQARKGDFVRCLDHFDLLQSPIN* |
| Ga0065705_107412211 | 3300005294 | Switchgrass Rhizosphere | LTAFEQAEMILYAALDPAVASRAKKGEFVACLDHFTLLQSTIN* |
| Ga0066388_1006396193 | 3300005332 | Tropical Forest Soil | RNFYQLTACEQAEMILYAALDPAVASRAKKGEFVTCLDHFELLQSSRN* |
| Ga0066388_1019131112 | 3300005332 | Tropical Forest Soil | RNFHQLTACEQAEMMLYAALDPATASRARQGDFVQCLDHFNLLQTARN* |
| Ga0066388_1025352891 | 3300005332 | Tropical Forest Soil | QLTAFEQAEMILYAALDPAVAGKAKKGDFVRGLDHFKLLQSPIN* |
| Ga0066388_1029356501 | 3300005332 | Tropical Forest Soil | RQLTAFEQAEMILYAALDPAVASRARKGNVVRCLDHFDLLQMARN* |
| Ga0066388_1029399512 | 3300005332 | Tropical Forest Soil | EQAELILRAALDPTIARKARRGEFVKCIDHFDLLQIAIN* |
| Ga0066388_1029796161 | 3300005332 | Tropical Forest Soil | LTAFEQAEMILYAALDPSIASKAKKGEFVKCLDHFDLLQSARN* |
| Ga0066388_1036680532 | 3300005332 | Tropical Forest Soil | NAFEQAELILQAALDPAIARRVKQGEFVTCFDHFDLLQTTRN* |
| Ga0066388_1038856121 | 3300005332 | Tropical Forest Soil | LTAFEQAEMILYAALDPSIASKAKKGEFVKCLDHFDLLQSTRN* |
| Ga0066388_1039163492 | 3300005332 | Tropical Forest Soil | RNFYQLTAFEQAEMILYAALDPAIASKARKGDFVRCLDHFDLLQSPIN* |
| Ga0066388_1039264312 | 3300005332 | Tropical Forest Soil | HQLTAFEQAEMILYAALDPAVAGKARKGDFVRCLDHFKLLQSPIN* |
| Ga0066388_1047470912 | 3300005332 | Tropical Forest Soil | QQNACEQAELILYAALDPVIASRARKGEFVKCFDHFDLLQTAIN* |
| Ga0066388_1061391921 | 3300005332 | Tropical Forest Soil | AFEQAEMILYAALDPSIASKAKKGEFVKCLDHFDLLQSARN* |
| Ga0066388_1061801911 | 3300005332 | Tropical Forest Soil | RNFHQLTAFEQAEMILYAALDPAVAGKARKGEFVQGLDHFKLLQSPIN* |
| Ga0066388_1073936661 | 3300005332 | Tropical Forest Soil | NFRQLTAFEQAEMILYAALDPAIASRARQGDFVTCLDHFNLLQTARN* |
| Ga0066388_1076798781 | 3300005332 | Tropical Forest Soil | EQAEMILYAALDPAVAGKARKGDFVRGLDHFKLLQSPIN* |
| Ga0066388_1080309111 | 3300005332 | Tropical Forest Soil | FLRNFHQLTAFEQAEMILYAALDPAVAGKARKGDFVKCLDHFKLLQSPIN* |
| Ga0066388_1083147522 | 3300005332 | Tropical Forest Soil | HQLTAFEQAEMILYAALDPAVAGKARKGDFVRYLDHFKLLQSPIN* |
| Ga0066388_1086096192 | 3300005332 | Tropical Forest Soil | SQLTAFEQAEMILYAALDPAIASKARQGDFVRCLGHFDLLQSPIN* |
| Ga0070668_1014722231 | 3300005347 | Switchgrass Rhizosphere | EQAEMILYAALDPSIASKAKKGEFVKCLDHFDLLQSARN* |
| Ga0070708_1002422953 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | RQQNAFEQAELILRAALDPTIARKARRGEFVKCIDHFDLLQIAIN* |
| Ga0070707_1022006102 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | RQQNAFEQAELILRAVLDPAMTSRAKKGAFVTCFDHFDLLQTAIN* |
| Ga0070698_1018854201 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | RHQNAFEQAELIIQAALDPALARKARQGEFVKCFDHFDLLQTAIN* |
| Ga0070697_1013590861 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MSNACEQAEMILYAALDPSIASRARRGEFVRCLDHFDLLQ |
| Ga0070686_1011429851 | 3300005544 | Switchgrass Rhizosphere | NFHQLTAFEQAEMILHAALDPAIASRAKKGEFVTCLDHFELLQCTIN* |
| Ga0070686_1019479021 | 3300005544 | Switchgrass Rhizosphere | EQAELILYAALDPAIASKARTGDFVKALDHFDLLQTARN* |
| Ga0066701_104496411 | 3300005552 | Soil | AEMILYAALDPAVASKARKGDFVRCLDHFKLLQSPIN* |
| Ga0066701_109492861 | 3300005552 | Soil | QAEMILYAALDPAIASRARQGDFVKCLDHFNLLQTARN* |
| Ga0066698_103182263 | 3300005558 | Soil | TAFEQAEMILYATLDPAVASKARKGDFVRCLDHFKLLQSPIN* |
| Ga0066699_109230301 | 3300005561 | Soil | RNFHQLTAFEQAEMILYAALDPAVASKARKGDFVRCLDHFKLLQSPMN* |
| Ga0070702_1014460911 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | QLTAFEQAEMILYAALDPAIASKARKGDFVRCLDHFNLLQSPIN* |
| Ga0066905_1001209421 | 3300005713 | Tropical Forest Soil | TAFEQAEMILYAALDPSIANKAKKGEFVKCLDHFDLLQSARN* |
| Ga0066903_1007162691 | 3300005764 | Tropical Forest Soil | TELILQAALDPAIARRARRGEFVTCFDHFDLLQTAIN* |
| Ga0066903_1010366163 | 3300005764 | Tropical Forest Soil | RNFHQLTAFEQGEMILYAALDPSIASKAKKGEFAKCLDHFDLLQSARN* |
| Ga0066903_1010981051 | 3300005764 | Tropical Forest Soil | AEMILYAALDPTLASRAKKGEFVTCLDHFELLQSPIN* |
| Ga0066903_1011457932 | 3300005764 | Tropical Forest Soil | LTAFEQAEMILYAALDPAVAGKAKKGDFVRCLDHFKLLQSPIN* |
| Ga0066903_1012083661 | 3300005764 | Tropical Forest Soil | LWNVRQHNACEQAEMILYAALDPSIARRARKGEFVRYLDRFDLLQTTIN* |
| Ga0066903_1014484163 | 3300005764 | Tropical Forest Soil | LQPLTCEQAELILQAALDPTIARKAKQGEFVTCFDHFHLLQTAIN* |
| Ga0066903_1022086121 | 3300005764 | Tropical Forest Soil | QAELILHAALDPSVASKASKGDFVRCLDHFELLQTVIN* |
| Ga0066903_1029100702 | 3300005764 | Tropical Forest Soil | AELILHAALDPSVASKASKGDFVRCLDHFELLQTVIN* |
| Ga0066903_1043662521 | 3300005764 | Tropical Forest Soil | QAEMILYAALDPAIASKSRKGDFVRFLDHFDLLQAR* |
| Ga0066903_1045022112 | 3300005764 | Tropical Forest Soil | RNFHQLTAFEQAEMILYAALDPAVAGKARKGDFVRGLDHFKLLQSPIN* |
| Ga0066903_1049078082 | 3300005764 | Tropical Forest Soil | QLTACEQAEMILYAALDPAIASRAKQGDFVTCLDHFNLLQTARN* |
| Ga0066903_1051332261 | 3300005764 | Tropical Forest Soil | AELILQAALDPTIASRAKKGEFVKCFDHFDLLQTAIN* |
| Ga0066903_1076744732 | 3300005764 | Tropical Forest Soil | FRQLTAFEQAEMILYAALDPAVASRARKGDFVRCLDHFDLLQTARN* |
| Ga0066903_1082331371 | 3300005764 | Tropical Forest Soil | AEMILYAALDPAIASKARQGDFVRCLDHFKLLQSPIN* |
| Ga0066903_1083887071 | 3300005764 | Tropical Forest Soil | RQYNAFEQAELILQAALDPAIARRAKKGEFVTCFDHFDLLQTAIN* |
| Ga0068860_1007638892 | 3300005843 | Switchgrass Rhizosphere | MVNNLTMPAEMILYAALDPAIARKARKGDFVRNLDHFDLLQSPIN* |
| Ga0081455_101682691 | 3300005937 | Tabebuia Heterophylla Rhizosphere | LSDFYQLTAFEQAEMILYAALDPAIASKARKGDFVRCLDCFDLLQSPIN* |
| Ga0081538_100200201 | 3300005981 | Tabebuia Heterophylla Rhizosphere | LRNFHQLTAFEQAEMIWYAALDPAVAGKARPGEFVRCLDHFKLLQSPIN* |
| Ga0081538_102157453 | 3300005981 | Tabebuia Heterophylla Rhizosphere | NFRQLTAFEQAEMILYAALDPAVASRARKGDFVRCLDYFDLLQTARN* |
| Ga0081538_103058812 | 3300005981 | Tabebuia Heterophylla Rhizosphere | AFEQAEMIWYAALDPAVACKARPGEFVRCLDHFKLLQSPIN* |
| Ga0081540_10800072 | 3300005983 | Tabebuia Heterophylla Rhizosphere | FLRIFRERNAFEQAELILQAALDPTIARRARQGEFVVCFDHFELLQIAIN* |
| Ga0081539_100747771 | 3300005985 | Tabebuia Heterophylla Rhizosphere | LHAFEQAERSLRAALEAAIARRATKGEVVTYFDHFDLLQTARN* |
| Ga0075023_1005961082 | 3300006041 | Watersheds | QAERILRAARDPAIASRAKKGEFVKGFDHFDLLHTARN* |
| Ga0075417_102366431 | 3300006049 | Populus Rhizosphere | CEQAERILYAALDPAVASRVRKGDFVRCLDHFDLLQTARN* |
| Ga0075417_103747302 | 3300006049 | Populus Rhizosphere | AEMILYAALDPAVASRARKGDFVRCLDHFDLLQTARN* |
| Ga0075417_104476791 | 3300006049 | Populus Rhizosphere | EMILYAALDPAVAGKARKGDFVRWLDHFKLLQSPIN* |
| Ga0075432_100604873 | 3300006058 | Populus Rhizosphere | NAFEQAELILQAALDPTIARRAKKGEFVTCFDHFDLLQTAIN* |
| Ga0075422_101596481 | 3300006196 | Populus Rhizosphere | QNAFEQAELILRAALDPTIARRAKKGEFVTCFDHFNLLQTAIN* |
| Ga0075428_1001350344 | 3300006844 | Populus Rhizosphere | EMILYAALDPSIASKAKKGEFVKCLDHFDLLQSARN* |
| Ga0075428_1001978385 | 3300006844 | Populus Rhizosphere | QHNACEQAELILRAALDPTIASRAKKGEFVMCFDHFDLLQTAIN* |
| Ga0075428_1005488473 | 3300006844 | Populus Rhizosphere | QNAFAQAELILRAALDPTIAPKARRGEFVKCINHFDLLQIAIN* |
| Ga0075428_1005850141 | 3300006844 | Populus Rhizosphere | ILYAALDPAVAGKAKKGDFVRWLDRFKLLQSPIN* |
| Ga0075428_1009968281 | 3300006844 | Populus Rhizosphere | FHQLTAFEQAELILHAALDPSIASRARKGEFVKCLDHFDLLQSRIN* |
| Ga0075428_1013013774 | 3300006844 | Populus Rhizosphere | QAEMILYAALDPTVASRAKKGEFVTCLDHFELLQSPIN* |
| Ga0075428_1019491221 | 3300006844 | Populus Rhizosphere | LRNFHQLTAFEQAEMILYAALDPSIASKAKKGEFVKCLDRLDLLQSARN* |
| Ga0075428_1023763521 | 3300006844 | Populus Rhizosphere | ILRAALDPTIAPKARRGEFVKCIDHFDLLQIAIN* |
| Ga0075428_1025696811 | 3300006844 | Populus Rhizosphere | ILQAALDPTIARRAKKGEFVTCFDHFDLLQTAIN* |
| Ga0075428_1026505631 | 3300006844 | Populus Rhizosphere | AELILRAALDPTIAPKARRGEFVKCIDHFDLLQIAIN* |
| Ga0075421_1001716701 | 3300006845 | Populus Rhizosphere | QAEMILYAALDPSIASKAKKGEFVKCLDHFDLLQSARN* |
| Ga0075421_1006273031 | 3300006845 | Populus Rhizosphere | AELILRAALDPTIARKARRGEFVKYLDHFDLLQSAIN* |
| Ga0075421_1010267203 | 3300006845 | Populus Rhizosphere | EMILYAALDPTIASKSRKGDFVRCLDHFDLLQSPIN* |
| Ga0075421_1018753661 | 3300006845 | Populus Rhizosphere | RNFRQQNAFEQAELIVRAALDPAITCRVKKGEFVTCFDHFDLLQTAIN* |
| Ga0075421_1023474512 | 3300006845 | Populus Rhizosphere | LRNFHQLTAFEQAEMILYAALDPTVASRAKKGEFVTCLDHFELLQSPIN* |
| Ga0075430_1002633241 | 3300006846 | Populus Rhizosphere | FEQAELILQAALDPAIARKAKKGEFVTCFDHFDLLQTAIN* |
| Ga0075430_1003488193 | 3300006846 | Populus Rhizosphere | AEMILYAALDPTVASRAKKGEFVTCLDHFELLQSPIN* |
| Ga0075430_1003789883 | 3300006846 | Populus Rhizosphere | RQQNAFEQAELILRAALDPGIASRAKRGEYVTCFDHFDLLGTGSV* |
| Ga0075430_1006431252 | 3300006846 | Populus Rhizosphere | ILYAALDPAVASRARKGDFVRCLDYFDLLQTASN* |
| Ga0075430_1008183001 | 3300006846 | Populus Rhizosphere | LTACEQAEMILYAALDPTVASRARKGDFVRCLDHFDLLQTARN* |
| Ga0075431_1001158224 | 3300006847 | Populus Rhizosphere | MNVRHRNAFEQAALDPAIASRARKGEFVRCLDHFGLLQTVIS* |
| Ga0075431_1002686071 | 3300006847 | Populus Rhizosphere | AEMILYAALDPAVAGKARKGDFVRCLDHFKLLQSPIN* |
| Ga0075431_1012802101 | 3300006847 | Populus Rhizosphere | AEMILYAALDPSIASKAKKGEFVKCLDHFDLLQTARN* |
| Ga0075431_1014124521 | 3300006847 | Populus Rhizosphere | AFEQAEMILYAALDPAIASQARKGDFVRCLDHFDLLQSPIN* |
| Ga0075431_1016260041 | 3300006847 | Populus Rhizosphere | ELILQAALDPAIARRAKKGEFVTCLDHFDLLQTARN* |
| Ga0075431_1019088362 | 3300006847 | Populus Rhizosphere | FEQAEMILYAALDPAIASQARKGDFVRCLDHFDLLQRPIN* |
| Ga0075431_1022177702 | 3300006847 | Populus Rhizosphere | NFRQLTACEQAERILYAALDPAVASRVRKGDFVRCLDHFDLLQTARN* |
| Ga0075433_101075065 | 3300006852 | Populus Rhizosphere | FEQAEMILQAALDPTIASRAKKGEFVTCFDHFGLLQTAIN* |
| Ga0075433_104680651 | 3300006852 | Populus Rhizosphere | MILYAALDPAVASRARKGDFVRCLDHFDLLQTARN |
| Ga0075433_104964022 | 3300006852 | Populus Rhizosphere | ILRAALDPTIARKARRGEFVKYLDHFDLLQSAIN* |
| Ga0075433_112874971 | 3300006852 | Populus Rhizosphere | NAFEQAELILQAALDPTIANRAKKGEFVKRFDHFDLLQTVIN* |
| Ga0075433_114617481 | 3300006852 | Populus Rhizosphere | FEQAEMILYAALDPSIASKAKKGEFVKCLDHFDLLQSARN* |
| Ga0075433_117384182 | 3300006852 | Populus Rhizosphere | AFEQAEMILYAALDPAIASKARKGDFVRCLDHFDLLQSPIN* |
| Ga0075420_1008543302 | 3300006853 | Populus Rhizosphere | QAEMILYAALDPAIASKARKGDFVRCLDHFDLLQSPIN* |
| Ga0075420_1012545511 | 3300006853 | Populus Rhizosphere | ILYAALDPAVASRARKGDFVRCLDHFDLLQTARN* |
| Ga0075420_1014130751 | 3300006853 | Populus Rhizosphere | QQNAFEQAELIVRAALDPAITCRVKKGEFVTCFDHFDLLQTAIN* |
| Ga0075420_1018147401 | 3300006853 | Populus Rhizosphere | NFHQLTAFEQAEMILYAALDPAVAGKARKGDFVRCLDHFKLLQSPIN* |
| Ga0075425_1002794854 | 3300006854 | Populus Rhizosphere | NAFEQAEMILQAALDPTIASRAKKGEFVTCFDHFDLLQTAIN* |
| Ga0075434_1001914421 | 3300006871 | Populus Rhizosphere | NFRQQNAFEQAELILGAALDPPIASRARKGEFVTCFDHFDLLQTAIN* |
| Ga0079217_102134822 | 3300006876 | Agricultural Soil | AELILHAALDPTVANKGRKGDFVRCLDHFELLQTAIN* |
| Ga0075429_1002249601 | 3300006880 | Populus Rhizosphere | QQNAFEQAELILRAALDPAIATRARRGAFVKYLDHFDLLQIAIN* |
| Ga0075429_1003623041 | 3300006880 | Populus Rhizosphere | ILYAALDPTVASRAKKGEFVTCLDHFELLQSPIN* |
| Ga0075429_1006896741 | 3300006880 | Populus Rhizosphere | FEQAEMILYAALDPSIAGKAKKGEFVKCLDHFDLLQSARN* |
| Ga0075429_1008787441 | 3300006880 | Populus Rhizosphere | AFEQAEMILYAALDPAIASRARQGDFVTCLDHFNLLQTARN* |
| Ga0075429_1011993793 | 3300006880 | Populus Rhizosphere | EMILYAALDPTVASRAKKGEFVTCLDHFELLQSPIN* |
| Ga0075429_1012301671 | 3300006880 | Populus Rhizosphere | EQAELILQAALDPVIACRAKKGEFVRCLDHFDLLQIAIN* |
| Ga0075429_1017377882 | 3300006880 | Populus Rhizosphere | ILYAALDPAVAGKARKGDFVRCLDHFKLLQSLIN* |
| Ga0075429_1017980641 | 3300006880 | Populus Rhizosphere | AFEQAEMILCAALDPSIASRARKGEFVKCLDHFDLLQTAIN* |
| Ga0075429_1018622662 | 3300006880 | Populus Rhizosphere | EQAELILQAALDPTIARRAKKGEFVKCFDHFDLLVWLK* |
| Ga0075429_1019578501 | 3300006880 | Populus Rhizosphere | RNFHQLTAFEQAEMILYAALDPSIASKAKKGEFVKCLDHFDLLQSARN* |
| Ga0075419_102473981 | 3300006969 | Populus Rhizosphere | NAFEQAELILRVALDPSITSRAKKGEFVKCFDHFDLLQTAIN* |
| Ga0075419_108698822 | 3300006969 | Populus Rhizosphere | NCRQQNACAQAELILRAALDPAIAMRARRGAWVKCLDHFALLPIARN* |
| Ga0075435_1013320792 | 3300007076 | Populus Rhizosphere | FEQAEMILYAALEPSIASKAKKGAFVQCLDHFDLLQSIRN* |
| Ga0099791_101002103 | 3300007255 | Vadose Zone Soil | LILRAALDPTIANRARKGEFVKYFDHFDLLQTAIN* |
| Ga0099793_100670831 | 3300007258 | Vadose Zone Soil | AEMILYAALGPAVAGKARKGDFVRCLDHFKLLQSPIH* |
| Ga0066710_1003959591 | 3300009012 | Grasslands Soil | QAELILRAALDPAMTGRAKKGEFVKCFDHFDLLQTAIN |
| Ga0066710_1006198821 | 3300009012 | Grasslands Soil | LRNFHQLTAFEQAEMILYAALDPSIASKAKKGEFVKCLDHFDLLQSARN |
| Ga0066710_1012844621 | 3300009012 | Grasslands Soil | QAELIVWAALDPAIAPRARRGEFVKCLDHFDLLHIARN |
| Ga0066710_1015056732 | 3300009012 | Grasslands Soil | LRNFRQHNACEQAELILRAALDPTIARRAKKGEFVKCFDHFDLLQTAIN |
| Ga0066710_1028337511 | 3300009012 | Grasslands Soil | NAGEQAELILRAALDRATASRARRAEFVKYPDHFDLLQNIIN |
| Ga0099827_107865851 | 3300009090 | Vadose Zone Soil | LILQAALDPAITSRAKKGEFVKCFDHFDFLQMAIN* |
| Ga0111539_103602384 | 3300009094 | Populus Rhizosphere | FLRNFYQLTAFEQAEMILYAALDPAIAGKARKGDFVRSLDHFDLLQSPIN* |
| Ga0111539_107461812 | 3300009094 | Populus Rhizosphere | FRQLNAFEQAELILQAALDPAIAGRAKKGEFVTCFDHFNLLQTARN* |
| Ga0111539_107741442 | 3300009094 | Populus Rhizosphere | ILYAALDPSIASKAKKGEFVKCLDHFDLLQSARN* |
| Ga0111539_108918421 | 3300009094 | Populus Rhizosphere | QAELILRAALDPTIAPKARRGEFVKCIDHFDLLQIAIN* |
| Ga0111539_121714841 | 3300009094 | Populus Rhizosphere | ELILQAALDPAIASRAKKGEFVKYFDHFDLLQTAIN* |
| Ga0075418_102638331 | 3300009100 | Populus Rhizosphere | AEMILYAALDPAIASQARKGDFVRCLDHFDLLQSPIN* |
| Ga0075418_106592851 | 3300009100 | Populus Rhizosphere | QLTVFEQAEMILYAALAPAIASKARKGDFVRYLDHFDLLQSPIN* |
| Ga0075418_109077811 | 3300009100 | Populus Rhizosphere | LTAFEQAEMILYAALDPAIASKARKGDFVRCLDHFKLLQSPIN* |
| Ga0075418_110624021 | 3300009100 | Populus Rhizosphere | LRNFRQHNAFEQAELILQAALDPAIASRARRGEFVACFDHFDLLQTARN* |
| Ga0075418_112161103 | 3300009100 | Populus Rhizosphere | EQAEMILYAALDPSIASKAKKGEFVKCLDRLDLLQSARN* |
| Ga0075418_119516032 | 3300009100 | Populus Rhizosphere | RNFSQLTAFEQAEMILYAALDPAIASKARKVDFVRYLDHFDLLQSPIN* |
| Ga0075418_124194052 | 3300009100 | Populus Rhizosphere | LQFLRNLRQRNAFEQAELILQAALDPASARRAKQGEFVTCFDHFDLLQTARN |
| Ga0075418_131611131 | 3300009100 | Populus Rhizosphere | QAEMILYAALDPAVASRARKGDFVRCLDHFDLLQTARN* |
| Ga0066709_1001618861 | 3300009137 | Grasslands Soil | QAELILRAALDPAMTGRAKKGEFVKCFDHFDLLQTAIN* |
| Ga0066709_1003589875 | 3300009137 | Grasslands Soil | QAELILQAALDPSVASRARKGEFVKCFDHFDLLQTAIN* |
| Ga0066709_1011201482 | 3300009137 | Grasslands Soil | FEQAEMILYAALDPSIASKAKKREFVKCLDHFDVLQSARN* |
| Ga0114129_1003397610 | 3300009147 | Populus Rhizosphere | EQAELILQAALDPARARRAKKGEFVTCFDHFDLLQTAIN* |
| Ga0114129_105539341 | 3300009147 | Populus Rhizosphere | PLLKHYPFEQAEMILQAALDPTIASRAKKGEFVTCFDHFDLLQTAIN* |
| Ga0114129_106335193 | 3300009147 | Populus Rhizosphere | EQAELILQAALDPAIARKAKKGEFVTCFDHFDLLQTAIN* |
| Ga0114129_107019841 | 3300009147 | Populus Rhizosphere | QRTAFEQAEMILYAALDPAIASKARQGDFVRCLDHFDLLQGPIN* |
| Ga0114129_109481331 | 3300009147 | Populus Rhizosphere | ELILHAALDPSVASKARKGDFVRLMDHFDLLQTAIN* |
| Ga0114129_111058381 | 3300009147 | Populus Rhizosphere | FRQLTAFEQAEMILYAALDPAVASRARKGDFVRRLDHFDLLQTARN* |
| Ga0114129_124216991 | 3300009147 | Populus Rhizosphere | LILQAALDPAIARRAKKGEFVTCLDHFDLLQTARN* |
| Ga0114129_125411752 | 3300009147 | Populus Rhizosphere | EQAEMILYAALDPAVAGKARKGDFVRCLDHFKLLQSPIN* |
| Ga0114129_126560922 | 3300009147 | Populus Rhizosphere | AFEQAGLILRAALDPTIARKARRGEFVKYLDHFDLLQSAIN* |
| Ga0111538_103583564 | 3300009156 | Populus Rhizosphere | RNFRQQNACEQAELIIRAALDPTIARKARRGEFVRCVDHFGLLQIAIN* |
| Ga0111538_103847721 | 3300009156 | Populus Rhizosphere | MILYAALDPAVAGKARKGDFVRCLDHFKLLQSLIN* |
| Ga0111538_107905281 | 3300009156 | Populus Rhizosphere | EMILQAALDPTIASRAKKGEFVTCFDHFDLLQTAIN* |
| Ga0111538_112532201 | 3300009156 | Populus Rhizosphere | AFEQAEMILYAALDPAVAGKARKGDFVRCLGHFKLLQSPIN* |
| Ga0075423_104628933 | 3300009162 | Populus Rhizosphere | AFEQAEMILYAALDPAIASRARQGDFVKCLDHFNLLQTARN* |
| Ga0075423_123547841 | 3300009162 | Populus Rhizosphere | LILQAALDPAIARRAKQGEFVTCFDHFDLLQTARN* |
| Ga0105104_104742682 | 3300009168 | Freshwater Sediment | FRQLNAFEQAELLIQAALDPAIASRAKKGEFVTCFDHFDLLQTAIN* |
| Ga0129286_101223781 | 3300009515 | Sediment | ILYAALDPAIASKARKGDFVRCLDHFDFLQTAIN* |
| Ga0105249_102407821 | 3300009553 | Switchgrass Rhizosphere | FEQAEMILYAALDPAIASQARKGDFVRLLDHFDLLQSPIN* |
| Ga0105249_109665052 | 3300009553 | Switchgrass Rhizosphere | AFEQAEMILYAALDPAIASKARKGDFVRCLDHFDLLQSSIN* |
| Ga0105249_110799401 | 3300009553 | Switchgrass Rhizosphere | LILQAAVDPSIASKAKKGEFVMCLDHFDLLQSARN* |
| Ga0105249_123111391 | 3300009553 | Switchgrass Rhizosphere | FHQLTAFEQAEMILYAALDPAVAGKARKGEFVRGLDHFKLLQSPIN* |
| Ga0105249_134784761 | 3300009553 | Switchgrass Rhizosphere | NFHQLTAFEQAEMILYAALDPAIACKAKKGEFVKWLDHFALLQTARN* |
| Ga0126374_103002151 | 3300009792 | Tropical Forest Soil | MIVYAALDLAIASRARQGDFVKCLDHFNLLQTARN* |
| Ga0126374_111950851 | 3300009792 | Tropical Forest Soil | TAFEQAELILYAALDPAVAGKARKGEFVRGLDHFKLLQSPIN* |
| Ga0126374_114702661 | 3300009792 | Tropical Forest Soil | FLRNFHQLTAFEQAEMILYAALDPSIASRARQGEFVKCLDHFNLLQSARN* |
| Ga0105066_11036033 | 3300009822 | Groundwater Sand | EQAELILQAALEPAIASKARRGAFVTCFDHFDLLQTTRN* |
| Ga0126314_115062931 | 3300010042 | Serpentine Soil | EQAEMILYAALDPAVASRARRGDFVWCLDHFDLLQTARN* |
| Ga0126380_101840113 | 3300010043 | Tropical Forest Soil | LILQAALDPAIARRAKQGEFVTCFDHFDLLQTAIN* |
| Ga0126380_103333843 | 3300010043 | Tropical Forest Soil | FEQAEMILYAALDPSIASKAKKGEFVKRLDHFDLLQTARN* |
| Ga0126380_104574291 | 3300010043 | Tropical Forest Soil | QAELILQAALDPTIASRARRGEFVKCFDHFDLLQTPIN* |
| Ga0126380_106009852 | 3300010043 | Tropical Forest Soil | QYNAFEQAELILQAAFDPAMARRAKKGELGMCFDHFDLPPTARN* |
| Ga0126380_109426513 | 3300010043 | Tropical Forest Soil | RNFRQLTAFEQAEMILYAALDPAVASRARTGDFVRCLDYFDLLQTARN* |
| Ga0126380_110646623 | 3300010043 | Tropical Forest Soil | EQAELILQAALDPAIARRARQGEFVRCFDHFDLLQTAIN* |
| Ga0126380_112021361 | 3300010043 | Tropical Forest Soil | LTAFEQAEMILYAALDPAVAGKARKGEFVRGLDHFKLLQSPIN* |
| Ga0126380_122986782 | 3300010043 | Tropical Forest Soil | LTAFEQAEMILYAALDPAVASRARRGDFVRCLDHFDLLQTARN* |
| Ga0126384_101814211 | 3300010046 | Tropical Forest Soil | LNAFEQAEMILQAALDPTIASRARQGDFVRCLDHFKLLQSPIN* |
| Ga0126384_101865813 | 3300010046 | Tropical Forest Soil | FQFLRNFRQLTAFEQAEMILYAALDPAVAGKARKGDFVRCLDHFKLLQSPIN* |
| Ga0126384_102853051 | 3300010046 | Tropical Forest Soil | AFEQAEMILYAALDPAVAGKARKGDFVRCLDPFKLLQSPIN* |
| Ga0126384_104104861 | 3300010046 | Tropical Forest Soil | AFEQAELILQAALDPAVASRAKKGEFVTCFAHFDLLQTAIN* |
| Ga0126384_104229321 | 3300010046 | Tropical Forest Soil | QFLRNFHQLTAFEQAEMILYAALEPAVASKARQGDFVRCLDHFKLLQSPIN* |
| Ga0126384_112280011 | 3300010046 | Tropical Forest Soil | FEQAEMILYAALDPAVASRARRGDFVRYLDHFDLLQTARN* |
| Ga0126384_116876431 | 3300010046 | Tropical Forest Soil | QAEMILYAALDPSIASRARQGDFVKCLDHFNLLQTARN* |
| Ga0126384_118049081 | 3300010046 | Tropical Forest Soil | LILWAALDPAIASRARRGDVVRSLDHFDLLQTTIN* |
| Ga0126384_121284031 | 3300010046 | Tropical Forest Soil | FHQLTAFEQAEMILYAALDPAIASKAKKGEFVKCLDHFDLLQSARN* |
| Ga0126384_123707881 | 3300010046 | Tropical Forest Soil | ILYAALDPAIASKARKGDFVRHLDHFDLLQSPIN* |
| Ga0126384_124055451 | 3300010046 | Tropical Forest Soil | QAEMILYAALDPGVAGKARKGDFVRCLDHFKLLQSPIN* |
| Ga0126382_100552751 | 3300010047 | Tropical Forest Soil | LILRAALDPVIASRAKKGEFVKCFDHFDLLQTVIN* |
| Ga0126382_100806001 | 3300010047 | Tropical Forest Soil | QLTAFEQAEMILYAALDPAVASKARQGEFVRCLDHFKLLQSPIN* |
| Ga0126382_100977711 | 3300010047 | Tropical Forest Soil | FLRNFHQLTAFEQAEMILYAALDPAVAGKARQGDFVRCLDHFKLLQSPIN* |
| Ga0126382_103056591 | 3300010047 | Tropical Forest Soil | LTAFEQAEMILYAALDPAVASRARRGDFVRCLDHFDLLQTTRN* |
| Ga0126382_103933202 | 3300010047 | Tropical Forest Soil | LRNFHQLTAFEQAEMILYAGLGPAVVGKAKKGDFVRGLDHFKLLQSPIN* |
| Ga0126382_106003793 | 3300010047 | Tropical Forest Soil | RNFRQQNACEQAELILQAALDPTIARKAKKGELVTRFDHFDLLQMAIN* |
| Ga0126382_106282311 | 3300010047 | Tropical Forest Soil | NAFEQAEVILQAALDPAIARRARQGELVRCFDHFDLLQTAIN* |
| Ga0126382_107170272 | 3300010047 | Tropical Forest Soil | EQAEMILYAALDPAVAGKARQGDFVRCLDHFKLLQSPIN* |
| Ga0126382_116142392 | 3300010047 | Tropical Forest Soil | RNFHQLTAFEQAEMILYAALAPSIVSKAKKGEFVKCLDHFDLLQSARN* |
| Ga0126382_118610281 | 3300010047 | Tropical Forest Soil | RNFRQLTAFEQAEMILYAALDPAVASRARKGAFVRCLDHFDLLQTVRN* |
| Ga0126382_122641301 | 3300010047 | Tropical Forest Soil | QNAFEQAEMILQAALDPSVASRARKGEFVTCFDHFDLLQTAIN* |
| Ga0134067_103317771 | 3300010321 | Grasslands Soil | VLRNFHQLTAFEQAEMILYDELDPAVAGKARKGDFVRRLDHFKLLQSPIN* |
| Ga0126370_100464971 | 3300010358 | Tropical Forest Soil | LTAFEQAEMILYAALDPAVACKARKGDFVRCLDHFKLLQSPIN* |
| Ga0126370_100480201 | 3300010358 | Tropical Forest Soil | AFEQAEMIVYAALDPAIASRARQGDFVKCLDHFNLLQTARN* |
| Ga0126370_100502515 | 3300010358 | Tropical Forest Soil | EMILYAALDPAVAGKARKGEFVRGLDHFKLLQSPIN* |
| Ga0126370_101319735 | 3300010358 | Tropical Forest Soil | HQLTACEQAEMILYAALDPSIASKAKKGEFVKCLDHFDLLQSARN* |
| Ga0126370_101666853 | 3300010358 | Tropical Forest Soil | ILQAALDPAIAGRAKKGEFVTCFDHFDLLQTAIN* |
| Ga0126370_103283691 | 3300010358 | Tropical Forest Soil | QAEMILYAALDPTVASRAKKGEFVVCLDHFELLQSPIT* |
| Ga0126370_105691853 | 3300010358 | Tropical Forest Soil | TAFEQAEMILYAALDPAVAGKARKGDFVRFLDHFKLLQSPIN* |
| Ga0126370_109691291 | 3300010358 | Tropical Forest Soil | RNFRQLTAFEQTEMILYAALDPSVASRARKGEFVKCLDHFDLLQTARN* |
| Ga0126370_116059681 | 3300010358 | Tropical Forest Soil | HQLTAFEQAEMILYAALDPAVADKARKGDFVRCLDHFKLLQSPIN* |
| Ga0126376_102800711 | 3300010359 | Tropical Forest Soil | LTACEQAEMILYAALDPAVAGKAKKGDFVRCLDHFKLLQSPIN* |
| Ga0126376_104243053 | 3300010359 | Tropical Forest Soil | FKQAEMILYDALDPAVASKARKGDFVRWLDHFKLLQSPIN* |
| Ga0126376_114666742 | 3300010359 | Tropical Forest Soil | LRNFHQLTAFEQAEMILYAALDPAIASRARQGDFVKCLDHFNLLQTARN* |
| Ga0126376_118651822 | 3300010359 | Tropical Forest Soil | LTAFEQAEMILYAALDPSIASKAKKGKFVKRLDHFDLLQTARN* |
| Ga0126376_121951732 | 3300010359 | Tropical Forest Soil | AELILQAALDPAIARRAKKGEFVTCFDHFDLLQTARK* |
| Ga0126376_131388761 | 3300010359 | Tropical Forest Soil | TAFEQAEMILYAALDPAIASKARKGDFVKCLDHFDLLQTAIN* |
| Ga0126376_131660962 | 3300010359 | Tropical Forest Soil | EQAELILRAALDSSIARKARRGELVECIDYFDLLQIAIN* |
| Ga0126372_108827111 | 3300010360 | Tropical Forest Soil | RNFHQLTAFEQAEMILYAALDPAVAGKARKGDFVRCLDHFKLLQSPIN* |
| Ga0126372_116313852 | 3300010360 | Tropical Forest Soil | ILYAALDPAVAGKAKKGDFVRCLDHFKLLQSPRN* |
| Ga0126372_119418691 | 3300010360 | Tropical Forest Soil | HQLTAFEQAEMILYAALDPTLASRAKKGEFVTCLDHFELLQSPIN* |
| Ga0126378_110789212 | 3300010361 | Tropical Forest Soil | NFSQRNAFEQAELILQAALDPSIASRAKKGEFVMYFDHFDLLQTAIN* |
| Ga0126378_113365951 | 3300010361 | Tropical Forest Soil | NFRQHNAFEQAELILRAALDPTIASRARKGEFVTCFDHFDLLQTARN* |
| Ga0126378_121890692 | 3300010361 | Tropical Forest Soil | EMILYAALDPAVAGKAKKGDFVRGLDHFKLLQSPIN* |
| Ga0126378_125772102 | 3300010361 | Tropical Forest Soil | HQLTAFEQAEMILYAALDPAVAGKARKGDFVRCLDHFRLLQSPIN* |
| Ga0126377_110752911 | 3300010362 | Tropical Forest Soil | FLRNVRQHNAFEQAELILQAALDPAIASRARRSEFVTCFDHFDLLQTTRN* |
| Ga0126377_110936422 | 3300010362 | Tropical Forest Soil | NFRQLTAFEQAEMILYAALDPAVASRARTGDFVRCLDYFDLLQTARN* |
| Ga0126377_112200902 | 3300010362 | Tropical Forest Soil | EQAELILRAALEPTMASRARRGEVVKCFDHFDLLQTARN* |
| Ga0126377_118964301 | 3300010362 | Tropical Forest Soil | LRNFRQLTAFEQAEMILYAALDPAVSSRARKGDFVRCLDHFDLLQTARN* |
| Ga0126377_123959122 | 3300010362 | Tropical Forest Soil | LLRAALDPAIANRARRGEFVKHLDHFDLLQIAIN* |
| Ga0126377_125282571 | 3300010362 | Tropical Forest Soil | FRQQNACEQAELILQAALDPAIARRARQGEFVRCFDHFDLLQTARN* |
| Ga0126377_127452152 | 3300010362 | Tropical Forest Soil | EQAELILRAALDPAIARKARRGELVKYLDHFDLLQSAIN* |
| Ga0126377_131751531 | 3300010362 | Tropical Forest Soil | QAELILRAALDPTIARKARRGEFVRCVDHFDLLQIAIN* |
| Ga0126377_135775801 | 3300010362 | Tropical Forest Soil | EQAELILQAALDPAIARRAKKGEFVTCFDHFDLLQYCGQF* |
| Ga0126379_107063294 | 3300010366 | Tropical Forest Soil | QLTAFEQAEMILYAALDPAVAGKARKGDFVRCLDHFKLLQSQIN* |
| Ga0126379_116952411 | 3300010366 | Tropical Forest Soil | ELILRVALDPTIASQARRGEFVKALDHFGLLQTAIN* |
| Ga0126379_117069671 | 3300010366 | Tropical Forest Soil | HQLTAFEQAEMMLYAALDPAIASRARQGDFVTCLDHFNLLQTARN* |
| Ga0126379_118186042 | 3300010366 | Tropical Forest Soil | EQAELILRAALEPTIASRARQGEFVKCFDHFDLLQTAIN* |
| Ga0126379_131723591 | 3300010366 | Tropical Forest Soil | NACEQAELILQAALDPTIAHRAKRGEFVKCLDHFDLLQTAIN* |
| Ga0126383_101808623 | 3300010398 | Tropical Forest Soil | QNAFEQAGLILRAALDPTIARKARKGEFVKYLDHFDLLQSAIN* |
| Ga0126383_105633093 | 3300010398 | Tropical Forest Soil | RHQNAGEQAEIILQAALDPAVASRARRGEFVQYLDHFDLLVLTR* |
| Ga0126383_109230332 | 3300010398 | Tropical Forest Soil | FLRNFRQQNACEQAELILRAVLDPVIASRAKKGEFVTCFDHFDLLQTAIN* |
| Ga0126383_109386302 | 3300010398 | Tropical Forest Soil | RQQNAFEQAELILRAALDPTIARKARRGEFVKYLDHFDLLQSAIN* |
| Ga0126383_115905941 | 3300010398 | Tropical Forest Soil | QAEHILYAALDPAVASRARRGDFVRCLDHFDLLQTARN* |
| Ga0126383_124816951 | 3300010398 | Tropical Forest Soil | QAEMILYAALDPSIARRARKGEFVRCLDYFDLLQTAIN* |
| Ga0126383_130766742 | 3300010398 | Tropical Forest Soil | EQAEMILYAALDPAVASRAKKGEFVTCLDHFELLQSSRN* |
| Ga0126383_135022231 | 3300010398 | Tropical Forest Soil | NYRQRNAFEQAELILQAALDPVIASRAKKGEFVKCFDHFDLLQTAIN* |
| Ga0105246_119972532 | 3300011119 | Miscanthus Rhizosphere | RQRNAFEQAELILQAALDPAIASRAKKGEFVKCFDHFDLLQTAIN* |
| Ga0137393_109910311 | 3300011271 | Vadose Zone Soil | ACEQAALIVHAALDPVIASRAKEGEFVKCLEHFDLLQTAIN* |
| Ga0137424_11205621 | 3300011412 | Soil | NAFEQAELILYAALDPTIASKARKGDFVRCLDHFELLQSPIN* |
| Ga0120192_100247691 | 3300012021 | Terrestrial | NSRYQNAFEQAEMILQAALDPSVASKARKGDFVTCLDHFDLLQSARN* |
| Ga0137383_103047812 | 3300012199 | Vadose Zone Soil | FEQAELIIQAALDPAIASRAKKGEFVKCFDHFDLLQTAIN* |
| Ga0137383_106458632 | 3300012199 | Vadose Zone Soil | ILYLALAPVIASRAIKGEFLKCFDHFDLLQTAIK* |
| Ga0137374_100968065 | 3300012204 | Vadose Zone Soil | NAFEQAELILQVALDPAMASRAKKGEFVKCFDHFDLLQTAIN* |
| Ga0137380_103633671 | 3300012206 | Vadose Zone Soil | AFEQAELILRAALDPAMTGRAKKGEFVKCFDHFDLLQTATN* |
| Ga0137380_105296683 | 3300012206 | Vadose Zone Soil | QLMAFEQAEMILYAALDPAIASRARQGDFVKCLDHFNLLQTPRN* |
| Ga0137380_107591641 | 3300012206 | Vadose Zone Soil | RNFHQLTAFEQAEMILYAALEPAVAGKARKGDFVRWLDHFKLLQSLIN* |
| Ga0137380_110175711 | 3300012206 | Vadose Zone Soil | ACEQAELILRAALDPAIANRARRGEFVKCLDHFDLLQIAIN* |
| Ga0137380_110771911 | 3300012206 | Vadose Zone Soil | EQAELILRAALDPTIASRARKGEFVKCFDHFDLLQTARN* |
| Ga0137381_102599751 | 3300012207 | Vadose Zone Soil | TELILWVALDPAIASRARRGEFVKSLDHFDLLQTAIN* |
| Ga0137381_103826571 | 3300012207 | Vadose Zone Soil | CEQAELILQAALDPSVASKARQGDLLRWLDHFDLLQTVIN* |
| Ga0137381_104625331 | 3300012207 | Vadose Zone Soil | LKLATSYQLTAFEQAEMILYAALDPAVAGKARKGDFVRCLDHFKLLQSPIN* |
| Ga0137381_108292511 | 3300012207 | Vadose Zone Soil | FEQAGLILRAALDPTMARKARRGEFVKYLDHFDLLQSAIN* |
| Ga0137381_113386231 | 3300012207 | Vadose Zone Soil | YNAFEQAELILQAALDPALARRAKKGDFVTCVDHFDLLQTARN* |
| Ga0137379_105123401 | 3300012209 | Vadose Zone Soil | EMILYAALDPAVAGKARKGDFVRCLDHFKLLQSPIN* |
| Ga0137377_113050472 | 3300012211 | Vadose Zone Soil | HQLTAFEQAEMILYAALDPSIASKAKKGEFVKCLDHFDLLQSARN* |
| Ga0150985_1228780111 | 3300012212 | Avena Fatua Rhizosphere | PTNGHKNACEQAELILYAALATVIASRARKGEFGTCFDHFDLLQTARN* |
| Ga0137387_106785712 | 3300012349 | Vadose Zone Soil | RDFYQLTELEQAEMILYAALDPAIASQARKGDFVRCLDHFDLLQSPIN* |
| Ga0137386_105960712 | 3300012351 | Vadose Zone Soil | QNAFEQAELILQAALDPAIASRARRGEFVKCLDHFDLLQTAIN* |
| Ga0137369_107056381 | 3300012355 | Vadose Zone Soil | QNAFEQAELILHAALDPAVACKARKGAFVTCFDHFNLLQTAIN* |
| Ga0137371_105159853 | 3300012356 | Vadose Zone Soil | FLQFLRKLHQLTAFEPAEMILYAAFEQAVAGKARKGDFVRCLDHFKLLQSPIN* |
| Ga0137368_100654481 | 3300012358 | Vadose Zone Soil | EQAEMILRAALDPSVAGKARRGDFVKCFDRFDLRQTPIN* |
| Ga0137375_106853371 | 3300012360 | Vadose Zone Soil | RNFRQLNAFEQAEMLLHAELDPTIASRAKRGEFVRCFDHFDLLQTAMH* |
| Ga0137361_106433321 | 3300012362 | Vadose Zone Soil | QQNAFEQAELILRAALDPAMASRAKKGEFVKCFDHFDLLQTAIN* |
| Ga0137361_109526022 | 3300012362 | Vadose Zone Soil | LRAALDPTIASRAKKGEFVKGFDHFDLLQTDIEQPLT* |
| Ga0134027_10396682 | 3300012364 | Grasslands Soil | EQAELILRAALDPLIARKARRGEFVRYVDHFDLLQIAIN* |
| Ga0150984_1109545051 | 3300012469 | Avena Fatua Rhizosphere | QNAFQQAELILYAALDPAIASRALKGEFVQCFDHFGLLQTPIN* |
| Ga0137397_101549591 | 3300012685 | Vadose Zone Soil | NFRQQNAFEQAELILQAALDPAIANRAKKWEFVKCFDHFDLLQTAIN* |
| Ga0137396_106331871 | 3300012918 | Vadose Zone Soil | RERNAFEQTELILQAAFDPAIASRAKKGEFVTCFDHFGLLQIAIH* |
| Ga0137359_100685011 | 3300012923 | Vadose Zone Soil | RNAFEQAELIIQAALDPAIASRAKKGEFVKCFDHFDLLQTAIN* |
| Ga0137359_110945002 | 3300012923 | Vadose Zone Soil | ILRAALDPTIASRAKKGEFVKGFDHFDLLQTDIEQPLT* |
| Ga0137359_113485441 | 3300012923 | Vadose Zone Soil | NAFEQAELILQAALDPAIASRARRGDFVKDFDRFDLLQTVIN* |
| Ga0137419_118365561 | 3300012925 | Vadose Zone Soil | FLRNFRQQNAFEQAEMILYAALDPSMARRARKGEFVRCLDHFGLLQTAIN* |
| Ga0137407_101084681 | 3300012930 | Vadose Zone Soil | QAELILQAALDPAIASRARRGDFVKDFDRFDLLQTVIN* |
| Ga0137410_108097981 | 3300012944 | Vadose Zone Soil | QTELILQAAFDPAIASRAKKGEFVTCFDHFGLLQIAIH* |
| Ga0126375_108751471 | 3300012948 | Tropical Forest Soil | RNFHQLTAFEQAEMILYAALDPTVASRAKKGAFVTCLDHFELLQSPIN* |
| Ga0126375_112583601 | 3300012948 | Tropical Forest Soil | FLRNFRQLTAFEQAEMILYAALDPAVAGKARKGDFVRCLDQFKLLQSPIN* |
| Ga0126375_113166161 | 3300012948 | Tropical Forest Soil | MILYAALDPAVASRAKKGEFVTCLDHFELLQSSRN* |
| Ga0126375_115663742 | 3300012948 | Tropical Forest Soil | FEQAEMILYAALDPAVAGKARQGDFVKCLDHFNLLQSPIN* |
| Ga0126375_118656311 | 3300012948 | Tropical Forest Soil | NFSQLTAFEQAEMILYAALDPAIASKARQGDFVRCLDHFDLLQSPIN* |
| Ga0126369_100427791 | 3300012971 | Tropical Forest Soil | QTELILQAALDPAIARRARRGEFVTCFDHFDLLQTAIN* |
| Ga0126369_100807341 | 3300012971 | Tropical Forest Soil | NACEQAELLLRAALDPAIANRARRGEFVKCLDHFDLLQMAIN* |
| Ga0126369_101626865 | 3300012971 | Tropical Forest Soil | QAEMILHAALDPAVAGKARKGDFVRCLDHFKLLQSPIN* |
| Ga0126369_102833241 | 3300012971 | Tropical Forest Soil | NFRQHNAFEQAEMILYAALDPVVAGKARKGDFVQCLDHFNLLQTARN* |
| Ga0126369_104997512 | 3300012971 | Tropical Forest Soil | FHQHNAFEQAEMILYAALDPAIAYRVRKGDFVRCLDHFDLLQSPIN* |
| Ga0126369_111878272 | 3300012971 | Tropical Forest Soil | LRNFRQLTAFEQAEMILYAALDPAIASRARQGEFVTCLDHFNLLQTARN* |
| Ga0126369_118001771 | 3300012971 | Tropical Forest Soil | QLNAFEQAELILQAALDPAIARRARRGEFVTCFDHFDLLQTAIN* |
| Ga0126369_118267352 | 3300012971 | Tropical Forest Soil | EMIVYAALDPAIASKARKGDFVRCLDHFNLLQSPIN* |
| Ga0126369_122271361 | 3300012971 | Tropical Forest Soil | ELILHAALDPSVASKASKGDFVRCLDHFELLQTVIN* |
| Ga0126369_125172841 | 3300012971 | Tropical Forest Soil | HQLTAFEQAEMILYAALDPAVAGKARKGDFVRFLDHFKLLQSPIN* |
| Ga0126369_133686512 | 3300012971 | Tropical Forest Soil | QNAFEQTELILWAALDPAIARRTRRGEFVGSLDHFDLLQTAIN* |
| Ga0126369_136990022 | 3300012971 | Tropical Forest Soil | AFEQAEMILYAALDPSIASKAKKGEFVQCLDHFNLLQSARN* |
| Ga0134077_103536241 | 3300012972 | Grasslands Soil | LRNFRQQNAFEQAELILQAALDPAIASRAKKGEFVKCFDHFDLLQTAIN* |
| Ga0157378_116326032 | 3300013297 | Miscanthus Rhizosphere | MVNNLTMPAEMILYAALDPAIARKARKGDFVRFLDYFDLLQSPIN* |
| Ga0163162_105280113 | 3300013306 | Switchgrass Rhizosphere | RQLNACEQAELILQAALDPAIARRAKKGEFVTCFDHFDLLQTAIN* |
| Ga0163162_111864981 | 3300013306 | Switchgrass Rhizosphere | EMMLYAALDPAIASKARKGDFVRCLDHFKLLQSPIN* |
| Ga0163162_118436002 | 3300013306 | Switchgrass Rhizosphere | RNFHQLTAFEQAEMILYAALDPAIASRARQGDFVQCLDHFNLLQTARN* |
| Ga0163162_130714101 | 3300013306 | Switchgrass Rhizosphere | LILQAALDPTIASRAKKGEFVKCFDHFDLLQTAIN* |
| Ga0075326_10566092 | 3300014271 | Natural And Restored Wetlands | RNFHQLTAFEQAEMILYAALDPTIASKAKKGEFVKRLDHFDLLQTARN* |
| Ga0157380_106338212 | 3300014326 | Switchgrass Rhizosphere | RNFHQLTAYEQAVILYAALDPAVAGKARKGEFVRGLDHFKLLQSPIN* |
| Ga0157379_104719891 | 3300014968 | Switchgrass Rhizosphere | LTAFEQAEMILYAALDPAVAGKARQGDFVRCLDHFKLLQSPIN* |
| Ga0137405_10772291 | 3300015053 | Vadose Zone Soil | NAFKQAEMILQAALDPAIASRARRGEFVTCFDYFDLLQTPIN* |
| Ga0132258_101622657 | 3300015371 | Arabidopsis Rhizosphere | EQAELILQAALDPAIAKRAKKGEFVKCFDHFDLLQTARN* |
| Ga0132258_111945492 | 3300015371 | Arabidopsis Rhizosphere | AFEQAEMILYAALDPAVAGKARKGDFVRCLDHFKLLQSPIN* |
| Ga0182041_117856241 | 3300016294 | Soil | AFEQAELILQAALDPTIARRAKKGEFVKCFDHFDLLQTAIN |
| Ga0182033_101746512 | 3300016319 | Soil | LRNFYQLTAFEQAEMILYAALPPATARKARRGDFVRCLDYFDLLQSPIN |
| Ga0182033_102060013 | 3300016319 | Soil | AFEQVELILQAALDPAIARRARQGEFVRCFDHFDLLQTAIN |
| Ga0182033_122197282 | 3300016319 | Soil | LRNFYQLTAFEQAEMILYAALDPAIASKARKGDFVRCLDHFDLLQRPIN |
| Ga0182034_116655201 | 3300016371 | Soil | LRNFRQQTAFAQAELILRAALDPAIANRARRGEFVRCLDHFDLLQTAIN |
| Ga0182034_119138361 | 3300016371 | Soil | LSDFHQLTAFEQAEMILYAALDPTVASRAKKGEFVTCLDHFEL |
| Ga0182040_110819143 | 3300016387 | Soil | FEQAELILRAALDPTIARKARKGEFVKYLDHFDLLQSAIN |
| Ga0182037_105434152 | 3300016404 | Soil | GESDMVLRAALDATSRRKARRGEFVKYLDHFDLLQSAIN |
| Ga0182039_118205821 | 3300016422 | Soil | NACEQAELILQAALDPTIASRAKKGEFVKYFDHFDLLQTAIN |
| Ga0184609_102390942 | 3300018076 | Groundwater Sediment | FWRNFSQLTACEQAEMILYAALDPAIASKARKGDFVRYLDHFDLLQSPIY |
| Ga0190265_101606845 | 3300018422 | Soil | LTAFEPAEMILSAALDPAAASKARKGDFVKGLDHVDLLQTAIN |
| Ga0179594_101985283 | 3300020170 | Vadose Zone Soil | LAAFEQAELILYAALDPAIASRAQQGVFVRCLDHFDLLQTAIN |
| Ga0126371_104303863 | 3300021560 | Tropical Forest Soil | EQAEIILQAALDPAVASRARRGEFVQYLDHFDLLVLTR |
| Ga0126371_116003851 | 3300021560 | Tropical Forest Soil | EMILYAALDPAVASRARRGDFVRCLDHFDLLQITRN |
| Ga0224508_106709682 | 3300022413 | Sediment | MIWYAAFDPAIASRANKGEFVTQLDHFFYLLQTAIN |
| Ga0137417_10736262 | 3300024330 | Vadose Zone Soil | RQYNAFEQAELILQAALDPAIARRAKKGEFVTCFDHFDLLQTARN |
| Ga0207684_105160972 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | RNAYEQAELILQAALDPTIANRAKKGEFVKCFDHFDLLQTAIN |
| Ga0207679_116411681 | 3300025945 | Corn Rhizosphere | FEQAEMILYAALDPAVASRARQGDFVRCLDHFDLLQTARN |
| Ga0207712_100481805 | 3300025961 | Switchgrass Rhizosphere | QNACEQAELILRAALDPVIASRARRGEFFRCLDHFDLLQTAIN |
| Ga0207712_103458051 | 3300025961 | Switchgrass Rhizosphere | EQAELILQAALDPTIASRAKKGEFVKCFDHFDLLQTAIN |
| Ga0207712_117311502 | 3300025961 | Switchgrass Rhizosphere | NAFEQAELVLQAALDPTIASRAKKGEFVLCFDHFDLLQTARN |
| Ga0207712_118642222 | 3300025961 | Switchgrass Rhizosphere | FEQAEMILYAALDPAVAGKARKGDFVRCLDHFKLLQSPIN |
| Ga0207668_105103663 | 3300025972 | Switchgrass Rhizosphere | AELILRAALDPTIARKARKGEFVKYLDHFDLLQSAIN |
| Ga0207668_107489051 | 3300025972 | Switchgrass Rhizosphere | FEQAELILHAALDPTVASKARKGDFVRCLDHFELLQTAIN |
| Ga0207708_104584283 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | NFPQLTAFEQAEMILYAALDPVIASRARQGDFVQCLDHFNLLQTARN |
| Ga0207708_111947443 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | LQCLRNFHQLTAFEQAEMILYAALDPAVAGKARKGDFVRCPDHFKLLQSPIN |
| Ga0207641_107898853 | 3300026088 | Switchgrass Rhizosphere | RYQNAFEQTELILWAALDPAIARRARRGEFVRSLDHFDLLQTAIN |
| Ga0207675_1007361543 | 3300026118 | Switchgrass Rhizosphere | FLSNFRQLHACEQAELILQAALDPAIAGRAKKGECVTCFDHFHLLQTAIN |
| Ga0209690_10577802 | 3300026524 | Soil | RERNAFEQTELILQAALDPAIASRAKKGEFVKCFDHFDLLQTAINWLFRT |
| Ga0209843_10052297 | 3300027511 | Groundwater Sand | NFRQQNAFEQAELILRAALDPTIAPKARRGEFVKCMDHFDLLQIAIN |
| Ga0209003_10903141 | 3300027576 | Forest Soil | NFRQQTAFEQAELILHAALDPVIASRAKKGKFVKCFDHFDLLQTAIN |
| Ga0214469_10745311 | 3300027636 | Soil | LTAFEQAEMILYAALDPTIASKAKKGEFVKRLDHFDLLQTARN |
| Ga0209388_12354112 | 3300027655 | Vadose Zone Soil | LILRAALDPTIANRARKGEFVKYFDHFDLLQTAIN |
| Ga0209588_12273221 | 3300027671 | Vadose Zone Soil | FEQAEMILQAALDPTIASRARQGQFVTWFDHFDLLQTAII |
| Ga0209796_103038082 | 3300027766 | Agave | EQAEMILYAALDPAIASKARQGDFVKCLDHFNLLQTARN |
| Ga0209814_100236741 | 3300027873 | Populus Rhizosphere | AFEQAEMILYAALDPSIASKAKKGEFVKCLDHFDLLQSARN |
| Ga0209814_102484013 | 3300027873 | Populus Rhizosphere | ACEQAELILQAALDPARARRAKKGEFVTCFDHFDLLQTAIN |
| Ga0209465_102021191 | 3300027874 | Tropical Forest Soil | ELILRAALDPTIVRRAKKGEFVKCFDHFDLLQTAIN |
| Ga0209481_102365394 | 3300027880 | Populus Rhizosphere | EQAELILQAALDPAIARRAKKGEFVTCLDHFDLLQTARN |
| Ga0207428_108597082 | 3300027907 | Populus Rhizosphere | LLKHYPFEQAEMILQAALDPTIASRAKKGEFVTCFDHFDLLQTAIN |
| Ga0209382_101490853 | 3300027909 | Populus Rhizosphere | FEQAEMILYAALDPSIASKAKKGEFVKCLDHFDLLQSARN |
| Ga0209382_104228723 | 3300027909 | Populus Rhizosphere | EQAEMILYAALAPAIASQARKGDFVRCLDHFDLLQSPIN |
| Ga0209382_106176192 | 3300027909 | Populus Rhizosphere | NFRQLNAFEQAELILQAALDPAIAGRAKKGEFVTCFDHFNLLQTARN |
| Ga0209382_106338791 | 3300027909 | Populus Rhizosphere | QFLRNFHQLTAFEQAEMILYAALDPAVAGKARQGDFVRCLDHFKLLQSPIN |
| Ga0209382_108684002 | 3300027909 | Populus Rhizosphere | YQLTAFEQAEMILYAALDPAIASQARKGDFVRCLDHFDLLQRPIN |
| Ga0209382_109727951 | 3300027909 | Populus Rhizosphere | AEMILYAALDPAVAGKARKGDFVRCLDHFKLLQSPIN |
| Ga0209382_112897153 | 3300027909 | Populus Rhizosphere | EMILYAALDPTVASRAKKGEFVTCLDHFELLQSPIN |
| Ga0209382_115342213 | 3300027909 | Populus Rhizosphere | EQAEMILYAALDPTIASKSRKGDFVRCLDHFDLLQSPIN |
| Ga0209382_120426542 | 3300027909 | Populus Rhizosphere | EQAELILYAALDPAVASKARKGDFVRCLDHFELLQSPIN |
| Ga0209382_121654912 | 3300027909 | Populus Rhizosphere | QAEMILYAALDPTVASRAKKGEFVTCLDHFELLQSPIN |
| Ga0209889_10389753 | 3300027952 | Groundwater Sand | HLRACEQAELILQAALEPAIASKARRGAFVTCFDHFDLLQTTRN |
| Ga0268265_123315511 | 3300028380 | Switchgrass Rhizosphere | RYQNAFEQTELILWAALDPAIASKARRGDFVRSLDHFDLLQTAIN |
| Ga0247828_102848431 | 3300028587 | Soil | QLTAFEQAEMILYAALDPAIASKARKGDFVRCLDHFDLLQSPIN |
| Ga0307296_108273662 | 3300028819 | Soil | AELILRAALDPAIARKARRGEFVTCMDHFDLLQIAIN |
| Ga0268386_100188811 | 3300030619 | Soil | EMILYAALDPAIASRAKKGDFVRYLDHFGLLQTAIN |
| Ga0268386_100347301 | 3300030619 | Soil | NFHQLTAFEQAEMILYAALDPAVASRAKKGKFVTCLDHFELLQSGIN |
| Ga0302046_111640041 | 3300030620 | Soil | FEQAEMILYAALDPAIASRARKGEFVTCLDHFELLQSATN |
| Ga0299913_101207741 | 3300031229 | Soil | FLRNFHQLTAFEQAEMILYAALDPSVASRAKKGDFVMCFDHLDLLQTAIN |
| Ga0299913_107085511 | 3300031229 | Soil | EQAEMILYAALDPAIASRAKKGDFVRYLDHFGLLQTAIN |
| Ga0299913_110009331 | 3300031229 | Soil | EQAEMILYAALEPAIASRAKKGDFVRCLDHFDLLQTAIN |
| Ga0318516_105301522 | 3300031543 | Soil | HQLTAFEQAELILYAALDPAVAGKARKGDFVRCLDHFQLLQSPIN |
| Ga0318541_103407941 | 3300031545 | Soil | EQAELILHAALDPVIASRAKKGEFVKCFDHFDLLQTAIN |
| Ga0318541_103909321 | 3300031545 | Soil | QNACEQGEMILYAALNPSIARRARKGELVRCLDHFDFYKQAG |
| Ga0318538_107803751 | 3300031546 | Soil | FEQAEMMLYAALDPAIASRASQGDFVKCLDHFNLLQTARN |
| Ga0310887_102491101 | 3300031547 | Soil | AQAELILRAALDPTIAPKARRGEFVKCIDHFDLLQIAIN |
| Ga0310915_105079071 | 3300031573 | Soil | ILYAALDPAVASKARKGDFVRCLDHFKLLQSPICDPLAERR |
| Ga0318546_113558791 | 3300031771 | Soil | TACEQAEMLLYAALDPAVASRARKGNFVGRLDHFDLLQTARN |
| Ga0307473_109455251 | 3300031820 | Hardwood Forest Soil | ELILQAALDPAIASRAKKGEFVKCFDHFDLLQTAIN |
| Ga0318511_103318772 | 3300031845 | Soil | EQAGLIIRAALDPTIARKARRGEFVKYLDHFDLLQSAIN |
| Ga0306925_120589402 | 3300031890 | Soil | HAQLILYAVLDPAVAGKAKKGDCVRCPDHFKLLQSPIN |
| Ga0306921_109403651 | 3300031912 | Soil | QPNACEQAELILQAALDPAIARRARQGEFVRCFDHFDLLQTVIN |
| Ga0306921_117987291 | 3300031912 | Soil | QAEMILYAALDPAIASQARKGDFARCLDHFDLLQSPIN |
| Ga0310901_103344851 | 3300031940 | Soil | FEQAELVLQAALDPTIASRAKKGEFVLCFDHFDLLQTARN |
| Ga0310916_105231771 | 3300031942 | Soil | FEQAEMILYAALDPAVASRARKGNFVGRLDHFDLLQTARN |
| Ga0310913_107854162 | 3300031945 | Soil | FLRNFRQLTAFEQAEMILYAALDPSIASKAKKGEFVKHLDYFDLLQTARN |
| Ga0310913_110972531 | 3300031945 | Soil | ACEQGEMILYAALNPSIARRARKGELVRCLDHFDFYKPAG |
| Ga0310910_111055432 | 3300031946 | Soil | TAFEQAEMIVYAALDPAIASRASQGDFVTCLDHFNLLQTARN |
| Ga0310909_103367462 | 3300031947 | Soil | NFRQLTAFEQAEMILYATLDPAVASRARKGDFVRCLDHFDLLQTARN |
| Ga0310909_111890041 | 3300031947 | Soil | RNFYQLTAFEQAEMILYAALDPAIASKARKGDFVRCLDHFDLLQSPIN |
| Ga0307416_1037189792 | 3300032002 | Rhizosphere | NSRQRNAFEQAEFILQAALDPAIARRARQGEFVRCFDHFDLLQTAIN |
| Ga0318533_106012091 | 3300032059 | Soil | IPSISMLSQQNAFEQAGLILRAALDPTIARMARRGEFVTYLDHFDLLQSAIN |
| Ga0318533_109436521 | 3300032059 | Soil | EQAEMILYAALDPSIASKAKKGEFVKCLDHFDLLQSARN |
| Ga0318514_103302704 | 3300032066 | Soil | AEMILYAALDPAVASRARTGDFVRCLDYFDLLQTARN |
| Ga0310890_103532502 | 3300032075 | Soil | SRAGRRNAFEQAELILQAALDPTIARRARQGEFVVCFDHFEFLQIAIN |
| Ga0310890_114855661 | 3300032075 | Soil | SLLHAALDPAVASKARKGDFVRCLDHFELLQSPIN |
| Ga0306924_108494021 | 3300032076 | Soil | FLRNFHQLTAFEQAEMILYAALDPTVAGKARKGDFVRCLDHFKLLQSPIN |
| Ga0307470_103075792 | 3300032174 | Hardwood Forest Soil | NAFEQAELILRAALGPAITGRAKKGEFVKCFDHFDLLQTVIN |
| Ga0310889_105608682 | 3300032179 | Soil | TFHQLTAFEQAEMILYAALDPAVTGKARKGDFVRYLDHFKLLQSPIN |
| Ga0307471_1037047461 | 3300032180 | Hardwood Forest Soil | ACEQAELILYAALDPAIASKARKGDFVKALDHFDLLQTARN |
| Ga0306920_1001948815 | 3300032261 | Soil | QQNTFEQAGLILRAALDPTIARKARKGEFVKYLDHFDLLQSAIN |
| Ga0306920_1025250331 | 3300032261 | Soil | ELILRAALDPVIASRAKKGEFVKCFDHFDLLQTAIN |
| Ga0310914_116360781 | 3300033289 | Soil | CEQAEMILYAALDPAIASKARKGDFVRCLDHFDLLQSPIN |
| Ga0214472_1000193425 | 3300033407 | Soil | AELILQAALDPSVASKARKGDFVKALDHFELLQSPIN |
| Ga0314795_083322_504_617 | 3300034670 | Soil | AEMILYAALDPAVAGKAKKGDFVRWLDHFKLLQSPIN |
| ⦗Top⦘ |