


| Basic Information | |
|---|---|
| Family ID | F004334 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 443 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MAQVIEFYIPARFHKKVKWVPPEERGKVIEFPAEVRKSA |
| Number of Associated Samples | 255 |
| Number of Associated Scaffolds | 443 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 82.38 % |
| % of genes near scaffold ends (potentially truncated) | 22.80 % |
| % of genes from short scaffolds (< 2000 bps) | 67.27 % |
| Associated GOLD sequencing projects | 225 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.19 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (78.104 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (18.736 % of family members) |
| Environment Ontology (ENVO) | Unclassified (24.831 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (46.501 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 8.96% β-sheet: 0.00% Coil/Unstructured: 91.04% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.19 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 443 Family Scaffolds |
|---|---|---|
| PF13186 | SPASM | 12.64 |
| PF00174 | Oxidored_molyb | 8.13 |
| PF05193 | Peptidase_M16_C | 4.29 |
| PF04366 | Ysc84 | 3.16 |
| PF00027 | cNMP_binding | 2.26 |
| PF03544 | TonB_C | 2.03 |
| PF13180 | PDZ_2 | 2.03 |
| PF00440 | TetR_N | 1.81 |
| PF07731 | Cu-oxidase_2 | 1.81 |
| PF02446 | Glyco_hydro_77 | 1.58 |
| PF16656 | Pur_ac_phosph_N | 1.13 |
| PF13305 | TetR_C_33 | 1.13 |
| PF14537 | Cytochrom_c3_2 | 1.13 |
| PF13365 | Trypsin_2 | 1.13 |
| PF01292 | Ni_hydr_CYTB | 0.90 |
| PF13545 | HTH_Crp_2 | 0.90 |
| PF00115 | COX1 | 0.90 |
| PF03707 | MHYT | 0.90 |
| PF01814 | Hemerythrin | 0.90 |
| PF13493 | DUF4118 | 0.68 |
| PF00210 | Ferritin | 0.68 |
| PF00106 | adh_short | 0.68 |
| PF03479 | PCC | 0.68 |
| PF00248 | Aldo_ket_red | 0.68 |
| PF00196 | GerE | 0.45 |
| PF14559 | TPR_19 | 0.45 |
| PF09723 | Zn-ribbon_8 | 0.45 |
| PF02518 | HATPase_c | 0.45 |
| PF03446 | NAD_binding_2 | 0.45 |
| PF12704 | MacB_PCD | 0.45 |
| PF07992 | Pyr_redox_2 | 0.45 |
| PF03150 | CCP_MauG | 0.45 |
| PF04972 | BON | 0.45 |
| PF13490 | zf-HC2 | 0.45 |
| PF06723 | MreB_Mbl | 0.45 |
| PF07730 | HisKA_3 | 0.45 |
| PF13561 | adh_short_C2 | 0.23 |
| PF01569 | PAP2 | 0.23 |
| PF13298 | LigD_N | 0.23 |
| PF11138 | DUF2911 | 0.23 |
| PF01740 | STAS | 0.23 |
| PF05163 | DinB | 0.23 |
| PF04389 | Peptidase_M28 | 0.23 |
| PF00005 | ABC_tran | 0.23 |
| PF01161 | PBP | 0.23 |
| PF01202 | SKI | 0.23 |
| PF12836 | HHH_3 | 0.23 |
| PF02113 | Peptidase_S13 | 0.23 |
| PF13353 | Fer4_12 | 0.23 |
| PF00190 | Cupin_1 | 0.23 |
| PF08281 | Sigma70_r4_2 | 0.23 |
| PF04542 | Sigma70_r2 | 0.23 |
| PF08388 | GIIM | 0.23 |
| PF01061 | ABC2_membrane | 0.23 |
| PF03030 | H_PPase | 0.23 |
| PF13738 | Pyr_redox_3 | 0.23 |
| PF07963 | N_methyl | 0.23 |
| PF09285 | Elong-fact-P_C | 0.23 |
| PF12867 | DinB_2 | 0.23 |
| PF14588 | YjgF_endoribonc | 0.23 |
| PF00072 | Response_reg | 0.23 |
| PF08239 | SH3_3 | 0.23 |
| PF05201 | GlutR_N | 0.23 |
| PF00903 | Glyoxalase | 0.23 |
| PF16576 | HlyD_D23 | 0.23 |
| PF13466 | STAS_2 | 0.23 |
| PF06897 | DUF1269 | 0.23 |
| PF01381 | HTH_3 | 0.23 |
| PF10017 | Methyltransf_33 | 0.23 |
| PF10009 | DUF2252 | 0.23 |
| PF00483 | NTP_transferase | 0.23 |
| PF13442 | Cytochrome_CBB3 | 0.23 |
| PF00884 | Sulfatase | 0.23 |
| PF00326 | Peptidase_S9 | 0.23 |
| PF07732 | Cu-oxidase_3 | 0.23 |
| PF00033 | Cytochrome_B | 0.23 |
| PF03743 | TrbI | 0.23 |
| PF14417 | MEDS | 0.23 |
| PF05598 | DUF772 | 0.23 |
| PF01156 | IU_nuc_hydro | 0.23 |
| PF01966 | HD | 0.23 |
| PF00589 | Phage_integrase | 0.23 |
| PF14522 | Cytochrome_C7 | 0.23 |
| PF08448 | PAS_4 | 0.23 |
| PF14256 | YwiC | 0.23 |
| PF00990 | GGDEF | 0.23 |
| PF07676 | PD40 | 0.23 |
| PF03709 | OKR_DC_1_N | 0.23 |
| PF00512 | HisKA | 0.23 |
| PF02738 | MoCoBD_1 | 0.23 |
| PF13590 | DUF4136 | 0.23 |
| COG ID | Name | Functional Category | % Frequency in 443 Family Scaffolds |
|---|---|---|---|
| COG2041 | Molybdopterin-dependent catalytic subunit of periplasmic DMSO/TMAO and protein-methionine-sulfoxide reductases | Energy production and conversion [C] | 8.13 |
| COG3915 | Uncharacterized conserved protein | Function unknown [S] | 8.13 |
| COG2930 | Lipid-binding SYLF domain, Ysc84/FYVE family | Lipid transport and metabolism [I] | 3.16 |
| COG2132 | Multicopper oxidase with three cupredoxin domains (includes cell division protein FtsP and spore coat protein CotA) | Cell cycle control, cell division, chromosome partitioning [D] | 2.03 |
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 2.03 |
| COG1640 | 4-alpha-glucanotransferase | Carbohydrate transport and metabolism [G] | 1.58 |
| COG1969 | Ni,Fe-hydrogenase I cytochrome b subunit | Energy production and conversion [C] | 0.90 |
| COG2864 | Cytochrome b subunit of formate dehydrogenase | Energy production and conversion [C] | 0.90 |
| COG3038 | Cytochrome b561 | Energy production and conversion [C] | 0.90 |
| COG3300 | MHYT domain, NO-binding membrane sensor | Signal transduction mechanisms [T] | 0.90 |
| COG3658 | Cytochrome b subunit of Ni2+-dependent hydrogenase | Energy production and conversion [C] | 0.90 |
| COG4117 | Thiosulfate reductase cytochrome b subunit | Inorganic ion transport and metabolism [P] | 0.90 |
| COG5001 | Cyclic di-GMP metabolism protein, combines GGDEF and EAL domains with a 6TM membrane domain | Signal transduction mechanisms [T] | 0.90 |
| COG1661 | Predicted DNA-binding protein with PD1-like DNA-binding motif, PPC/DUF296 domain | General function prediction only [R] | 0.68 |
| COG1858 | Cytochrome c peroxidase | Posttranslational modification, protein turnover, chaperones [O] | 0.45 |
| COG3850 | Signal transduction histidine kinase NarQ, nitrate/nitrite-specific | Signal transduction mechanisms [T] | 0.45 |
| COG3851 | Signal transduction histidine kinase UhpB, glucose-6-phosphate specific | Signal transduction mechanisms [T] | 0.45 |
| COG4564 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 0.45 |
| COG4585 | Signal transduction histidine kinase ComP | Signal transduction mechanisms [T] | 0.45 |
| COG1077 | Cell shape-determining ATPase MreB, actin-like superfamily | Cell cycle control, cell division, chromosome partitioning [D] | 0.45 |
| COG1881 | Uncharacterized conserved protein, phosphatidylethanolamine-binding protein (PEBP) family | General function prediction only [R] | 0.23 |
| COG1957 | Inosine-uridine nucleoside N-ribohydrolase | Nucleotide transport and metabolism [F] | 0.23 |
| COG2027 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.23 |
| COG2318 | Bacillithiol/mycothiol S-transferase BstA/DinB, DinB/YfiT family (unrelated to E. coli DinB) | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.23 |
| COG2948 | Type IV secretory pathway, VirB10 component | Intracellular trafficking, secretion, and vesicular transport [U] | 0.23 |
| COG3808 | Na+ or H+-translocating membrane pyrophosphatase | Energy production and conversion [C] | 0.23 |
| COG4803 | Uncharacterized membrane protein | Function unknown [S] | 0.23 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.23 |
| COG0373 | Glutamyl-tRNA reductase | Coenzyme transport and metabolism [H] | 0.23 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.23 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.23 |
| COG1290 | Cytochrome b subunit of the bc complex | Energy production and conversion [C] | 0.23 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.23 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 78.10 % |
| Unclassified | root | N/A | 21.90 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000364|INPhiseqgaiiFebDRAFT_101580219 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 815 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101909967 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 616 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101910862 | All Organisms → cellular organisms → Bacteria | 2448 | Open in IMG/M |
| 3300000789|JGI1027J11758_12601932 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1123 | Open in IMG/M |
| 3300001137|JGI12637J13337_1010739 | Not Available | 780 | Open in IMG/M |
| 3300001593|JGI12635J15846_10081464 | All Organisms → cellular organisms → Bacteria | 2367 | Open in IMG/M |
| 3300001661|JGI12053J15887_10051924 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3 | 2291 | Open in IMG/M |
| 3300001867|JGI12627J18819_10481073 | Not Available | 510 | Open in IMG/M |
| 3300002557|JGI25381J37097_1010890 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 1607 | Open in IMG/M |
| 3300002560|JGI25383J37093_10049254 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1364 | Open in IMG/M |
| 3300002561|JGI25384J37096_10083638 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1148 | Open in IMG/M |
| 3300002561|JGI25384J37096_10210494 | Not Available | 570 | Open in IMG/M |
| 3300002908|JGI25382J43887_10098021 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1553 | Open in IMG/M |
| 3300002910|JGI25615J43890_1040431 | Not Available | 763 | Open in IMG/M |
| 3300002914|JGI25617J43924_10115341 | Not Available | 950 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10006237 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3657 | Open in IMG/M |
| 3300004631|Ga0058899_12294069 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 564 | Open in IMG/M |
| 3300004633|Ga0066395_10121192 | Not Available | 1290 | Open in IMG/M |
| 3300004633|Ga0066395_10377950 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 793 | Open in IMG/M |
| 3300004633|Ga0066395_10463022 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 725 | Open in IMG/M |
| 3300004633|Ga0066395_10716576 | Not Available | 595 | Open in IMG/M |
| 3300005172|Ga0066683_10025432 | All Organisms → cellular organisms → Bacteria | 3363 | Open in IMG/M |
| 3300005174|Ga0066680_10019717 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 3668 | Open in IMG/M |
| 3300005175|Ga0066673_10163665 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1247 | Open in IMG/M |
| 3300005175|Ga0066673_10739502 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 565 | Open in IMG/M |
| 3300005176|Ga0066679_10250463 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1141 | Open in IMG/M |
| 3300005176|Ga0066679_10655979 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 683 | Open in IMG/M |
| 3300005178|Ga0066688_10299645 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1037 | Open in IMG/M |
| 3300005186|Ga0066676_10158731 | All Organisms → cellular organisms → Bacteria | 1428 | Open in IMG/M |
| 3300005186|Ga0066676_10681930 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 699 | Open in IMG/M |
| 3300005332|Ga0066388_100053953 | All Organisms → cellular organisms → Bacteria | 4171 | Open in IMG/M |
| 3300005332|Ga0066388_100403450 | All Organisms → cellular organisms → Bacteria | 2012 | Open in IMG/M |
| 3300005332|Ga0066388_101157022 | All Organisms → cellular organisms → Bacteria | 1317 | Open in IMG/M |
| 3300005332|Ga0066388_101710575 | Not Available | 1113 | Open in IMG/M |
| 3300005332|Ga0066388_101877920 | All Organisms → cellular organisms → Bacteria | 1068 | Open in IMG/M |
| 3300005434|Ga0070709_10158917 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1569 | Open in IMG/M |
| 3300005434|Ga0070709_10734103 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 771 | Open in IMG/M |
| 3300005434|Ga0070709_11578524 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 534 | Open in IMG/M |
| 3300005435|Ga0070714_100638709 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 1024 | Open in IMG/M |
| 3300005436|Ga0070713_100106570 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2437 | Open in IMG/M |
| 3300005436|Ga0070713_100423511 | All Organisms → cellular organisms → Bacteria | 1246 | Open in IMG/M |
| 3300005436|Ga0070713_102461292 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 503 | Open in IMG/M |
| 3300005437|Ga0070710_10084216 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1863 | Open in IMG/M |
| 3300005439|Ga0070711_100016957 | All Organisms → cellular organisms → Bacteria | 4632 | Open in IMG/M |
| 3300005445|Ga0070708_100033168 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 4485 | Open in IMG/M |
| 3300005445|Ga0070708_100173409 | All Organisms → cellular organisms → Bacteria | 2014 | Open in IMG/M |
| 3300005445|Ga0070708_101098750 | Not Available | 745 | Open in IMG/M |
| 3300005445|Ga0070708_101705652 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300005446|Ga0066686_10481311 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 846 | Open in IMG/M |
| 3300005467|Ga0070706_100029516 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 5053 | Open in IMG/M |
| 3300005468|Ga0070707_100103442 | All Organisms → cellular organisms → Bacteria | 2760 | Open in IMG/M |
| 3300005468|Ga0070707_100364518 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1404 | Open in IMG/M |
| 3300005468|Ga0070707_100394715 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1343 | Open in IMG/M |
| 3300005468|Ga0070707_100403340 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1327 | Open in IMG/M |
| 3300005468|Ga0070707_102099969 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 532 | Open in IMG/M |
| 3300005471|Ga0070698_100030416 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5598 | Open in IMG/M |
| 3300005471|Ga0070698_100209236 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_56_17 | 1886 | Open in IMG/M |
| 3300005471|Ga0070698_100324737 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1470 | Open in IMG/M |
| 3300005518|Ga0070699_100041300 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 3993 | Open in IMG/M |
| 3300005518|Ga0070699_100080556 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 83 | 2838 | Open in IMG/M |
| 3300005518|Ga0070699_100717486 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 914 | Open in IMG/M |
| 3300005518|Ga0070699_101615046 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 83 | 594 | Open in IMG/M |
| 3300005529|Ga0070741_10007166 | All Organisms → cellular organisms → Bacteria | 23322 | Open in IMG/M |
| 3300005529|Ga0070741_10018042 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 11495 | Open in IMG/M |
| 3300005536|Ga0070697_100001440 | All Organisms → cellular organisms → Bacteria | 18075 | Open in IMG/M |
| 3300005536|Ga0070697_100368580 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1242 | Open in IMG/M |
| 3300005536|Ga0070697_100513206 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1049 | Open in IMG/M |
| 3300005536|Ga0070697_100867759 | All Organisms → cellular organisms → Bacteria | 800 | Open in IMG/M |
| 3300005536|Ga0070697_100952762 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 762 | Open in IMG/M |
| 3300005536|Ga0070697_101311851 | Not Available | 646 | Open in IMG/M |
| 3300005538|Ga0070731_10012794 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 6082 | Open in IMG/M |
| 3300005538|Ga0070731_10122603 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1722 | Open in IMG/M |
| 3300005538|Ga0070731_10399273 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 914 | Open in IMG/M |
| 3300005538|Ga0070731_10852454 | Not Available | 604 | Open in IMG/M |
| 3300005538|Ga0070731_10900564 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300005542|Ga0070732_10015441 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4255 | Open in IMG/M |
| 3300005542|Ga0070732_10935544 | Not Available | 530 | Open in IMG/M |
| 3300005552|Ga0066701_10691353 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_56_17 | 613 | Open in IMG/M |
| 3300005554|Ga0066661_10123427 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1567 | Open in IMG/M |
| 3300005555|Ga0066692_10295490 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 1026 | Open in IMG/M |
| 3300005556|Ga0066707_10076132 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2013 | Open in IMG/M |
| 3300005558|Ga0066698_10440388 | All Organisms → cellular organisms → Bacteria | 891 | Open in IMG/M |
| 3300005559|Ga0066700_10065381 | All Organisms → cellular organisms → Bacteria | 2287 | Open in IMG/M |
| 3300005560|Ga0066670_10958674 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 522 | Open in IMG/M |
| 3300005566|Ga0066693_10409130 | Not Available | 552 | Open in IMG/M |
| 3300005569|Ga0066705_10014646 | All Organisms → cellular organisms → Bacteria | 3872 | Open in IMG/M |
| 3300005587|Ga0066654_10287222 | All Organisms → cellular organisms → Bacteria | 877 | Open in IMG/M |
| 3300005591|Ga0070761_10531299 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 727 | Open in IMG/M |
| 3300005598|Ga0066706_11511882 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 505 | Open in IMG/M |
| 3300005602|Ga0070762_10858824 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 83 | 617 | Open in IMG/M |
| 3300005764|Ga0066903_101708233 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1199 | Open in IMG/M |
| 3300005764|Ga0066903_104519893 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 742 | Open in IMG/M |
| 3300005764|Ga0066903_108166786 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300005881|Ga0075294_1034990 | Not Available | 528 | Open in IMG/M |
| 3300005921|Ga0070766_10276007 | All Organisms → cellular organisms → Bacteria | 1073 | Open in IMG/M |
| 3300005921|Ga0070766_11019311 | Not Available | 570 | Open in IMG/M |
| 3300006028|Ga0070717_10122433 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2230 | Open in IMG/M |
| 3300006028|Ga0070717_10735707 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 897 | Open in IMG/M |
| 3300006028|Ga0070717_10840481 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 835 | Open in IMG/M |
| 3300006028|Ga0070717_11027932 | Not Available | 750 | Open in IMG/M |
| 3300006041|Ga0075023_100204688 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 763 | Open in IMG/M |
| 3300006050|Ga0075028_100556993 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 676 | Open in IMG/M |
| 3300006052|Ga0075029_100497984 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 804 | Open in IMG/M |
| 3300006052|Ga0075029_100729023 | Not Available | 670 | Open in IMG/M |
| 3300006059|Ga0075017_101123934 | Not Available | 614 | Open in IMG/M |
| 3300006059|Ga0075017_101319023 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300006102|Ga0075015_100070231 | All Organisms → cellular organisms → Bacteria | 1703 | Open in IMG/M |
| 3300006162|Ga0075030_100052262 | All Organisms → cellular organisms → Bacteria | 3411 | Open in IMG/M |
| 3300006172|Ga0075018_10301841 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 790 | Open in IMG/M |
| 3300006173|Ga0070716_101603284 | Not Available | 535 | Open in IMG/M |
| 3300006174|Ga0075014_100017863 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2656 | Open in IMG/M |
| 3300006174|Ga0075014_100192585 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1023 | Open in IMG/M |
| 3300006175|Ga0070712_100003588 | All Organisms → cellular organisms → Bacteria | 9562 | Open in IMG/M |
| 3300006176|Ga0070765_100038924 | All Organisms → cellular organisms → Bacteria | 3786 | Open in IMG/M |
| 3300006755|Ga0079222_10791569 | Not Available | 772 | Open in IMG/M |
| 3300006791|Ga0066653_10239710 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 924 | Open in IMG/M |
| 3300006794|Ga0066658_10094874 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1398 | Open in IMG/M |
| 3300006794|Ga0066658_10180302 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1102 | Open in IMG/M |
| 3300006797|Ga0066659_10596761 | All Organisms → cellular organisms → Bacteria | 896 | Open in IMG/M |
| 3300006800|Ga0066660_10085173 | All Organisms → cellular organisms → Bacteria | 2191 | Open in IMG/M |
| 3300006800|Ga0066660_10170102 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1633 | Open in IMG/M |
| 3300006852|Ga0075433_10009175 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 7903 | Open in IMG/M |
| 3300006854|Ga0075425_101459419 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 773 | Open in IMG/M |
| 3300006893|Ga0073928_10000729 | All Organisms → cellular organisms → Bacteria | 70880 | Open in IMG/M |
| 3300006893|Ga0073928_10181164 | All Organisms → cellular organisms → Bacteria | 1668 | Open in IMG/M |
| 3300006893|Ga0073928_10181487 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1666 | Open in IMG/M |
| 3300006954|Ga0079219_10995108 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
| 3300007255|Ga0099791_10018893 | All Organisms → cellular organisms → Bacteria | 2949 | Open in IMG/M |
| 3300007258|Ga0099793_10000586 | All Organisms → cellular organisms → Bacteria | 10178 | Open in IMG/M |
| 3300007265|Ga0099794_10320542 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
| 3300009038|Ga0099829_10018443 | All Organisms → cellular organisms → Bacteria | 4733 | Open in IMG/M |
| 3300009038|Ga0099829_10083609 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2450 | Open in IMG/M |
| 3300009038|Ga0099829_10198412 | All Organisms → cellular organisms → Bacteria | 1623 | Open in IMG/M |
| 3300009038|Ga0099829_10745525 | All Organisms → cellular organisms → Bacteria | 814 | Open in IMG/M |
| 3300009038|Ga0099829_11370175 | Not Available | 584 | Open in IMG/M |
| 3300009038|Ga0099829_11579195 | Not Available | 541 | Open in IMG/M |
| 3300009088|Ga0099830_10029981 | All Organisms → cellular organisms → Bacteria | 3663 | Open in IMG/M |
| 3300009088|Ga0099830_10082380 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2362 | Open in IMG/M |
| 3300009088|Ga0099830_10235976 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1443 | Open in IMG/M |
| 3300009089|Ga0099828_10023696 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4840 | Open in IMG/M |
| 3300009090|Ga0099827_10200190 | Not Available | 1660 | Open in IMG/M |
| 3300009090|Ga0099827_10990760 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 729 | Open in IMG/M |
| 3300009137|Ga0066709_101033804 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1204 | Open in IMG/M |
| 3300009137|Ga0066709_101533112 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 959 | Open in IMG/M |
| 3300009143|Ga0099792_10017395 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3146 | Open in IMG/M |
| 3300009143|Ga0099792_10097214 | All Organisms → cellular organisms → Bacteria | 1539 | Open in IMG/M |
| 3300009162|Ga0075423_10116802 | All Organisms → cellular organisms → Bacteria | 2796 | Open in IMG/M |
| 3300010046|Ga0126384_10707633 | Not Available | 893 | Open in IMG/M |
| 3300010047|Ga0126382_10050591 | All Organisms → cellular organisms → Bacteria | 2430 | Open in IMG/M |
| 3300010048|Ga0126373_10279098 | All Organisms → cellular organisms → Bacteria | 1657 | Open in IMG/M |
| 3300010048|Ga0126373_11200562 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 825 | Open in IMG/M |
| 3300010048|Ga0126373_12325178 | Not Available | 596 | Open in IMG/M |
| 3300010358|Ga0126370_10707110 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 886 | Open in IMG/M |
| 3300010358|Ga0126370_11003583 | Not Available | 762 | Open in IMG/M |
| 3300010359|Ga0126376_10719253 | Not Available | 963 | Open in IMG/M |
| 3300010360|Ga0126372_10725617 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 974 | Open in IMG/M |
| 3300010360|Ga0126372_11635439 | Not Available | 684 | Open in IMG/M |
| 3300010360|Ga0126372_12595031 | Not Available | 558 | Open in IMG/M |
| 3300010361|Ga0126378_10003543 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 11815 | Open in IMG/M |
| 3300010361|Ga0126378_10720769 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1109 | Open in IMG/M |
| 3300010361|Ga0126378_11414610 | Not Available | 788 | Open in IMG/M |
| 3300010361|Ga0126378_13420555 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 504 | Open in IMG/M |
| 3300010376|Ga0126381_103980342 | Not Available | 575 | Open in IMG/M |
| 3300010398|Ga0126383_11635843 | Not Available | 733 | Open in IMG/M |
| 3300010398|Ga0126383_11855392 | Not Available | 691 | Open in IMG/M |
| 3300010398|Ga0126383_12323617 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300011270|Ga0137391_10437588 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1114 | Open in IMG/M |
| 3300011271|Ga0137393_10255862 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1487 | Open in IMG/M |
| 3300011271|Ga0137393_10553503 | Not Available | 987 | Open in IMG/M |
| 3300011271|Ga0137393_10745112 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 838 | Open in IMG/M |
| 3300012096|Ga0137389_10032293 | All Organisms → cellular organisms → Bacteria | 3810 | Open in IMG/M |
| 3300012096|Ga0137389_10382059 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_56_17 | 1201 | Open in IMG/M |
| 3300012189|Ga0137388_10005139 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 8708 | Open in IMG/M |
| 3300012189|Ga0137388_10356605 | All Organisms → cellular organisms → Bacteria | 1349 | Open in IMG/M |
| 3300012199|Ga0137383_10015726 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 5157 | Open in IMG/M |
| 3300012199|Ga0137383_10960122 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300012200|Ga0137382_10006434 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5936 | Open in IMG/M |
| 3300012200|Ga0137382_10051602 | All Organisms → cellular organisms → Bacteria | 2571 | Open in IMG/M |
| 3300012200|Ga0137382_10194865 | All Organisms → cellular organisms → Bacteria | 1390 | Open in IMG/M |
| 3300012200|Ga0137382_11308276 | Not Available | 511 | Open in IMG/M |
| 3300012203|Ga0137399_10130946 | All Organisms → cellular organisms → Bacteria | 1982 | Open in IMG/M |
| 3300012203|Ga0137399_10192838 | All Organisms → cellular organisms → Bacteria | 1650 | Open in IMG/M |
| 3300012203|Ga0137399_10777935 | Not Available | 806 | Open in IMG/M |
| 3300012205|Ga0137362_10115357 | Not Available | 2274 | Open in IMG/M |
| 3300012205|Ga0137362_10371717 | All Organisms → cellular organisms → Bacteria | 1238 | Open in IMG/M |
| 3300012207|Ga0137381_10232399 | Not Available | 1601 | Open in IMG/M |
| 3300012208|Ga0137376_10270655 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1474 | Open in IMG/M |
| 3300012208|Ga0137376_11031251 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 704 | Open in IMG/M |
| 3300012208|Ga0137376_11773384 | Not Available | 508 | Open in IMG/M |
| 3300012209|Ga0137379_11621037 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300012349|Ga0137387_10360307 | All Organisms → cellular organisms → Bacteria | 1053 | Open in IMG/M |
| 3300012361|Ga0137360_10161850 | All Organisms → cellular organisms → Bacteria | 1784 | Open in IMG/M |
| 3300012361|Ga0137360_10794309 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 814 | Open in IMG/M |
| 3300012362|Ga0137361_10815958 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 848 | Open in IMG/M |
| 3300012377|Ga0134029_1084641 | Not Available | 587 | Open in IMG/M |
| 3300012469|Ga0150984_111926363 | Not Available | 1189 | Open in IMG/M |
| 3300012582|Ga0137358_10056614 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2618 | Open in IMG/M |
| 3300012582|Ga0137358_10116140 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1817 | Open in IMG/M |
| 3300012685|Ga0137397_10053843 | All Organisms → cellular organisms → Bacteria | 2892 | Open in IMG/M |
| 3300012685|Ga0137397_10223374 | All Organisms → cellular organisms → Bacteria | 1402 | Open in IMG/M |
| 3300012923|Ga0137359_10088453 | All Organisms → cellular organisms → Bacteria | 2727 | Open in IMG/M |
| 3300012923|Ga0137359_10242400 | All Organisms → cellular organisms → Bacteria | 1608 | Open in IMG/M |
| 3300012925|Ga0137419_11103658 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 661 | Open in IMG/M |
| 3300012925|Ga0137419_11899905 | Not Available | 511 | Open in IMG/M |
| 3300012927|Ga0137416_10433489 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1120 | Open in IMG/M |
| 3300012929|Ga0137404_11441197 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300012929|Ga0137404_11629912 | Not Available | 599 | Open in IMG/M |
| 3300012930|Ga0137407_10225488 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1690 | Open in IMG/M |
| 3300012944|Ga0137410_11776037 | Not Available | 544 | Open in IMG/M |
| 3300012957|Ga0164303_10114926 | Not Available | 1361 | Open in IMG/M |
| 3300012971|Ga0126369_10060691 | All Organisms → cellular organisms → Bacteria | 3274 | Open in IMG/M |
| 3300012971|Ga0126369_10071776 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3040 | Open in IMG/M |
| 3300012986|Ga0164304_11877113 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 501 | Open in IMG/M |
| 3300015054|Ga0137420_1486541 | All Organisms → cellular organisms → Bacteria | 6879 | Open in IMG/M |
| 3300015193|Ga0167668_1003888 | All Organisms → cellular organisms → Bacteria | 3285 | Open in IMG/M |
| 3300015241|Ga0137418_10116735 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2384 | Open in IMG/M |
| 3300015241|Ga0137418_10225401 | All Organisms → cellular organisms → Bacteria | 1605 | Open in IMG/M |
| 3300015241|Ga0137418_11313444 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 504 | Open in IMG/M |
| 3300015264|Ga0137403_10125332 | All Organisms → cellular organisms → Bacteria | 2556 | Open in IMG/M |
| 3300015264|Ga0137403_11506212 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300015359|Ga0134085_10531333 | Not Available | 541 | Open in IMG/M |
| 3300015371|Ga0132258_10397503 | All Organisms → cellular organisms → Bacteria | 3423 | Open in IMG/M |
| 3300015371|Ga0132258_10892945 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2244 | Open in IMG/M |
| 3300015371|Ga0132258_11267924 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1863 | Open in IMG/M |
| 3300015372|Ga0132256_102049228 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 678 | Open in IMG/M |
| 3300016341|Ga0182035_11091971 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 710 | Open in IMG/M |
| 3300016404|Ga0182037_10982062 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 735 | Open in IMG/M |
| 3300016404|Ga0182037_10996616 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 730 | Open in IMG/M |
| 3300017927|Ga0187824_10000732 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 7452 | Open in IMG/M |
| 3300017927|Ga0187824_10038066 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1463 | Open in IMG/M |
| 3300017930|Ga0187825_10019541 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2269 | Open in IMG/M |
| 3300017930|Ga0187825_10086327 | All Organisms → cellular organisms → Bacteria | 1079 | Open in IMG/M |
| 3300017930|Ga0187825_10377283 | Not Available | 541 | Open in IMG/M |
| 3300017933|Ga0187801_10201677 | Not Available | 788 | Open in IMG/M |
| 3300017936|Ga0187821_10050010 | Not Available | 1498 | Open in IMG/M |
| 3300017936|Ga0187821_10300921 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 637 | Open in IMG/M |
| 3300017942|Ga0187808_10303609 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
| 3300017943|Ga0187819_10107731 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1664 | Open in IMG/M |
| 3300017959|Ga0187779_10000028 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 102778 | Open in IMG/M |
| 3300017966|Ga0187776_10095307 | Not Available | 1764 | Open in IMG/M |
| 3300017966|Ga0187776_10451007 | All Organisms → cellular organisms → Bacteria | 871 | Open in IMG/M |
| 3300017966|Ga0187776_11217365 | Not Available | 565 | Open in IMG/M |
| 3300017974|Ga0187777_11399370 | Not Available | 516 | Open in IMG/M |
| 3300017993|Ga0187823_10019659 | Not Available | 1690 | Open in IMG/M |
| 3300018006|Ga0187804_10208867 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 835 | Open in IMG/M |
| 3300018029|Ga0187787_10140517 | All Organisms → cellular organisms → Bacteria | 811 | Open in IMG/M |
| 3300018058|Ga0187766_11144617 | Not Available | 561 | Open in IMG/M |
| 3300018431|Ga0066655_10423121 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 879 | Open in IMG/M |
| 3300018433|Ga0066667_10062318 | All Organisms → cellular organisms → Bacteria | 2314 | Open in IMG/M |
| 3300018468|Ga0066662_10079439 | All Organisms → cellular organisms → Bacteria | 2236 | Open in IMG/M |
| 3300018468|Ga0066662_11938072 | Not Available | 616 | Open in IMG/M |
| 3300018482|Ga0066669_10015001 | All Organisms → cellular organisms → Bacteria | 4117 | Open in IMG/M |
| 3300018482|Ga0066669_10064109 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2395 | Open in IMG/M |
| 3300019789|Ga0137408_1146958 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 892 | Open in IMG/M |
| 3300019866|Ga0193756_1027318 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 802 | Open in IMG/M |
| 3300019882|Ga0193713_1028159 | All Organisms → cellular organisms → Bacteria | 1653 | Open in IMG/M |
| 3300019887|Ga0193729_1014132 | All Organisms → cellular organisms → Bacteria | 3549 | Open in IMG/M |
| 3300019888|Ga0193751_1000264 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 45419 | Open in IMG/M |
| 3300019888|Ga0193751_1004943 | All Organisms → cellular organisms → Bacteria | 7526 | Open in IMG/M |
| 3300019888|Ga0193751_1010522 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4888 | Open in IMG/M |
| 3300020004|Ga0193755_1004126 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4638 | Open in IMG/M |
| 3300020015|Ga0193734_1022328 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1195 | Open in IMG/M |
| 3300020062|Ga0193724_1068153 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 745 | Open in IMG/M |
| 3300020170|Ga0179594_10105420 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1017 | Open in IMG/M |
| 3300020170|Ga0179594_10363167 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 549 | Open in IMG/M |
| 3300020170|Ga0179594_10415225 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 511 | Open in IMG/M |
| 3300020199|Ga0179592_10252175 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 792 | Open in IMG/M |
| 3300020579|Ga0210407_10001506 | All Organisms → cellular organisms → Bacteria | 21678 | Open in IMG/M |
| 3300020579|Ga0210407_10032963 | All Organisms → cellular organisms → Bacteria | 3855 | Open in IMG/M |
| 3300020579|Ga0210407_10065918 | All Organisms → cellular organisms → Bacteria | 2715 | Open in IMG/M |
| 3300020579|Ga0210407_10269939 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1326 | Open in IMG/M |
| 3300020579|Ga0210407_11243250 | Not Available | 558 | Open in IMG/M |
| 3300020580|Ga0210403_11414864 | Not Available | 526 | Open in IMG/M |
| 3300020581|Ga0210399_10020482 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5235 | Open in IMG/M |
| 3300020581|Ga0210399_10065532 | All Organisms → cellular organisms → Bacteria | 2936 | Open in IMG/M |
| 3300020581|Ga0210399_10363095 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1209 | Open in IMG/M |
| 3300020583|Ga0210401_10001900 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 23684 | Open in IMG/M |
| 3300020583|Ga0210401_10007406 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 11010 | Open in IMG/M |
| 3300020583|Ga0210401_10028925 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5282 | Open in IMG/M |
| 3300020583|Ga0210401_10080783 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3060 | Open in IMG/M |
| 3300020583|Ga0210401_10084998 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2977 | Open in IMG/M |
| 3300020583|Ga0210401_10100087 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2724 | Open in IMG/M |
| 3300020583|Ga0210401_10316852 | All Organisms → cellular organisms → Bacteria | 1421 | Open in IMG/M |
| 3300020583|Ga0210401_10695502 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 877 | Open in IMG/M |
| 3300020583|Ga0210401_10837098 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 779 | Open in IMG/M |
| 3300021086|Ga0179596_10554654 | Not Available | 583 | Open in IMG/M |
| 3300021088|Ga0210404_10004917 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5381 | Open in IMG/M |
| 3300021088|Ga0210404_10237665 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 987 | Open in IMG/M |
| 3300021168|Ga0210406_10000247 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 80713 | Open in IMG/M |
| 3300021170|Ga0210400_10303131 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1311 | Open in IMG/M |
| 3300021170|Ga0210400_11406064 | Not Available | 556 | Open in IMG/M |
| 3300021171|Ga0210405_10749154 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 751 | Open in IMG/M |
| 3300021377|Ga0213874_10123083 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 883 | Open in IMG/M |
| 3300021404|Ga0210389_11493514 | Not Available | 514 | Open in IMG/M |
| 3300021406|Ga0210386_10793714 | Not Available | 814 | Open in IMG/M |
| 3300021432|Ga0210384_10000811 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 45760 | Open in IMG/M |
| 3300021432|Ga0210384_11467419 | Not Available | 587 | Open in IMG/M |
| 3300021474|Ga0210390_10252622 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1493 | Open in IMG/M |
| 3300021474|Ga0210390_11142289 | Not Available | 631 | Open in IMG/M |
| 3300021478|Ga0210402_11107310 | Not Available | 719 | Open in IMG/M |
| 3300021559|Ga0210409_10128124 | All Organisms → cellular organisms → Bacteria | 2332 | Open in IMG/M |
| 3300021559|Ga0210409_10257972 | All Organisms → cellular organisms → Bacteria | 1577 | Open in IMG/M |
| 3300021559|Ga0210409_10268144 | Not Available | 1543 | Open in IMG/M |
| 3300021560|Ga0126371_10000866 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 25380 | Open in IMG/M |
| 3300021560|Ga0126371_10095345 | All Organisms → cellular organisms → Bacteria | 2951 | Open in IMG/M |
| 3300021560|Ga0126371_11920155 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 711 | Open in IMG/M |
| 3300022557|Ga0212123_10000194 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 209756 | Open in IMG/M |
| 3300022557|Ga0212123_10008962 | All Organisms → cellular organisms → Bacteria | 14938 | Open in IMG/M |
| 3300022557|Ga0212123_10056760 | All Organisms → cellular organisms → Bacteria | 3515 | Open in IMG/M |
| 3300022726|Ga0242654_10038427 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1294 | Open in IMG/M |
| 3300022726|Ga0242654_10393774 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 530 | Open in IMG/M |
| 3300022756|Ga0222622_10457426 | All Organisms → cellular organisms → Bacteria | 907 | Open in IMG/M |
| 3300024288|Ga0179589_10468871 | Not Available | 582 | Open in IMG/M |
| 3300025910|Ga0207684_10013536 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 7053 | Open in IMG/M |
| 3300025922|Ga0207646_10003702 | All Organisms → cellular organisms → Bacteria | 17067 | Open in IMG/M |
| 3300025922|Ga0207646_10028274 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5105 | Open in IMG/M |
| 3300025922|Ga0207646_10087687 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2784 | Open in IMG/M |
| 3300025922|Ga0207646_10495862 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1100 | Open in IMG/M |
| 3300025928|Ga0207700_10156012 | All Organisms → cellular organisms → Bacteria | 1891 | Open in IMG/M |
| 3300026296|Ga0209235_1060576 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1771 | Open in IMG/M |
| 3300026297|Ga0209237_1013586 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4809 | Open in IMG/M |
| 3300026298|Ga0209236_1015015 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4463 | Open in IMG/M |
| 3300026298|Ga0209236_1310845 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 509 | Open in IMG/M |
| 3300026309|Ga0209055_1036779 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2193 | Open in IMG/M |
| 3300026318|Ga0209471_1010346 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4890 | Open in IMG/M |
| 3300026322|Ga0209687_1254111 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_56_17 | 546 | Open in IMG/M |
| 3300026325|Ga0209152_10013618 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2804 | Open in IMG/M |
| 3300026329|Ga0209375_1263185 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 571 | Open in IMG/M |
| 3300026332|Ga0209803_1026629 | All Organisms → cellular organisms → Bacteria | 2788 | Open in IMG/M |
| 3300026496|Ga0257157_1052411 | Not Available | 688 | Open in IMG/M |
| 3300026496|Ga0257157_1060614 | Not Available | 642 | Open in IMG/M |
| 3300026523|Ga0209808_1265765 | Not Available | 548 | Open in IMG/M |
| 3300026548|Ga0209161_10049375 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2762 | Open in IMG/M |
| 3300026548|Ga0209161_10585898 | Not Available | 500 | Open in IMG/M |
| 3300026551|Ga0209648_10050873 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3548 | Open in IMG/M |
| 3300026552|Ga0209577_10300243 | All Organisms → cellular organisms → Bacteria | 1198 | Open in IMG/M |
| 3300026557|Ga0179587_10498255 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
| 3300027073|Ga0208366_1013169 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 883 | Open in IMG/M |
| 3300027371|Ga0209418_1056961 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 696 | Open in IMG/M |
| 3300027535|Ga0209734_1040191 | Not Available | 879 | Open in IMG/M |
| 3300027562|Ga0209735_1003130 | All Organisms → cellular organisms → Bacteria | 2947 | Open in IMG/M |
| 3300027562|Ga0209735_1024408 | Not Available | 1249 | Open in IMG/M |
| 3300027591|Ga0209733_1005077 | Not Available | 3319 | Open in IMG/M |
| 3300027643|Ga0209076_1057570 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1103 | Open in IMG/M |
| 3300027645|Ga0209117_1068054 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1019 | Open in IMG/M |
| 3300027669|Ga0208981_1150020 | Not Available | 592 | Open in IMG/M |
| 3300027674|Ga0209118_1030300 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1663 | Open in IMG/M |
| 3300027706|Ga0209581_1000100 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 280979 | Open in IMG/M |
| 3300027738|Ga0208989_10049488 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1454 | Open in IMG/M |
| 3300027842|Ga0209580_10344820 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 742 | Open in IMG/M |
| 3300027842|Ga0209580_10405049 | Not Available | 680 | Open in IMG/M |
| 3300027846|Ga0209180_10767914 | Not Available | 519 | Open in IMG/M |
| 3300027862|Ga0209701_10042905 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2918 | Open in IMG/M |
| 3300027869|Ga0209579_10034045 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2767 | Open in IMG/M |
| 3300027869|Ga0209579_10060606 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2004 | Open in IMG/M |
| 3300027869|Ga0209579_10359802 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 787 | Open in IMG/M |
| 3300027874|Ga0209465_10345181 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 746 | Open in IMG/M |
| 3300027875|Ga0209283_10001737 | All Organisms → cellular organisms → Bacteria | 11995 | Open in IMG/M |
| 3300027875|Ga0209283_10085694 | All Organisms → cellular organisms → Bacteria | 2047 | Open in IMG/M |
| 3300027882|Ga0209590_10664391 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300027894|Ga0209068_10335958 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 853 | Open in IMG/M |
| 3300027903|Ga0209488_10015080 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5630 | Open in IMG/M |
| 3300027903|Ga0209488_10025905 | All Organisms → cellular organisms → Bacteria | 4263 | Open in IMG/M |
| 3300027903|Ga0209488_10073473 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE0068 | 2537 | Open in IMG/M |
| 3300027910|Ga0209583_10250416 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 781 | Open in IMG/M |
| 3300027911|Ga0209698_10001109 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 30937 | Open in IMG/M |
| 3300027911|Ga0209698_10174970 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1748 | Open in IMG/M |
| 3300028047|Ga0209526_10023610 | All Organisms → cellular organisms → Bacteria | 4305 | Open in IMG/M |
| 3300028047|Ga0209526_10611193 | Not Available | 697 | Open in IMG/M |
| 3300028047|Ga0209526_10698029 | Not Available | 639 | Open in IMG/M |
| 3300028792|Ga0307504_10050327 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1187 | Open in IMG/M |
| 3300028792|Ga0307504_10341066 | Not Available | 575 | Open in IMG/M |
| 3300030730|Ga0307482_1313237 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 508 | Open in IMG/M |
| 3300030730|Ga0307482_1325957 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 500 | Open in IMG/M |
| 3300030991|Ga0073994_11289617 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter modestus | 657 | Open in IMG/M |
| 3300031023|Ga0073998_10054222 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1522 | Open in IMG/M |
| 3300031545|Ga0318541_10068269 | All Organisms → cellular organisms → Bacteria | 1859 | Open in IMG/M |
| 3300031545|Ga0318541_10316336 | Not Available | 871 | Open in IMG/M |
| 3300031680|Ga0318574_10702361 | Not Available | 593 | Open in IMG/M |
| 3300031718|Ga0307474_10137618 | All Organisms → cellular organisms → Bacteria | 1838 | Open in IMG/M |
| 3300031718|Ga0307474_10186081 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1577 | Open in IMG/M |
| 3300031718|Ga0307474_10384009 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1091 | Open in IMG/M |
| 3300031720|Ga0307469_10050479 | All Organisms → cellular organisms → Bacteria | 2609 | Open in IMG/M |
| 3300031720|Ga0307469_10060083 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2451 | Open in IMG/M |
| 3300031720|Ga0307469_10194938 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1575 | Open in IMG/M |
| 3300031720|Ga0307469_10508768 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1057 | Open in IMG/M |
| 3300031740|Ga0307468_100227891 | Not Available | 1288 | Open in IMG/M |
| 3300031740|Ga0307468_101146401 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 696 | Open in IMG/M |
| 3300031753|Ga0307477_10371119 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 982 | Open in IMG/M |
| 3300031754|Ga0307475_10004875 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 8349 | Open in IMG/M |
| 3300031754|Ga0307475_10112011 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2140 | Open in IMG/M |
| 3300031754|Ga0307475_10138517 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1926 | Open in IMG/M |
| 3300031754|Ga0307475_10512079 | Not Available | 963 | Open in IMG/M |
| 3300031754|Ga0307475_10562664 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 914 | Open in IMG/M |
| 3300031768|Ga0318509_10607722 | Not Available | 609 | Open in IMG/M |
| 3300031798|Ga0318523_10552954 | Not Available | 568 | Open in IMG/M |
| 3300031823|Ga0307478_10017418 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 5026 | Open in IMG/M |
| 3300031823|Ga0307478_10671740 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 867 | Open in IMG/M |
| 3300031823|Ga0307478_10904722 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
| 3300031890|Ga0306925_10767837 | All Organisms → cellular organisms → Bacteria | 1003 | Open in IMG/M |
| 3300031910|Ga0306923_10404771 | Not Available | 1552 | Open in IMG/M |
| 3300031912|Ga0306921_10498112 | Not Available | 1417 | Open in IMG/M |
| 3300031941|Ga0310912_11118513 | Not Available | 601 | Open in IMG/M |
| 3300031947|Ga0310909_10018283 | All Organisms → cellular organisms → Bacteria | 4998 | Open in IMG/M |
| 3300031954|Ga0306926_10356200 | Not Available | 1809 | Open in IMG/M |
| 3300031962|Ga0307479_10007429 | All Organisms → cellular organisms → Bacteria | 10102 | Open in IMG/M |
| 3300031962|Ga0307479_10247979 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1758 | Open in IMG/M |
| 3300032001|Ga0306922_10703936 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1063 | Open in IMG/M |
| 3300032076|Ga0306924_12260942 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 553 | Open in IMG/M |
| 3300032174|Ga0307470_10121991 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1541 | Open in IMG/M |
| 3300032174|Ga0307470_10301890 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1086 | Open in IMG/M |
| 3300032180|Ga0307471_100010326 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 6241 | Open in IMG/M |
| 3300032180|Ga0307471_100014413 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5494 | Open in IMG/M |
| 3300032180|Ga0307471_100331465 | Not Available | 1624 | Open in IMG/M |
| 3300032180|Ga0307471_100579197 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1279 | Open in IMG/M |
| 3300032180|Ga0307471_101154868 | All Organisms → cellular organisms → Bacteria | 939 | Open in IMG/M |
| 3300032205|Ga0307472_102082129 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 570 | Open in IMG/M |
| 3300032261|Ga0306920_100000644 | All Organisms → cellular organisms → Bacteria | 41085 | Open in IMG/M |
| 3300032261|Ga0306920_100197156 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3005 | Open in IMG/M |
| 3300032261|Ga0306920_100985438 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1228 | Open in IMG/M |
| 3300032770|Ga0335085_10006820 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 17929 | Open in IMG/M |
| 3300032770|Ga0335085_10913941 | Not Available | 956 | Open in IMG/M |
| 3300032770|Ga0335085_11999135 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 588 | Open in IMG/M |
| 3300032783|Ga0335079_10008324 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 11829 | Open in IMG/M |
| 3300032783|Ga0335079_10120582 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2960 | Open in IMG/M |
| 3300032828|Ga0335080_10050769 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4584 | Open in IMG/M |
| 3300032828|Ga0335080_10224079 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 2062 | Open in IMG/M |
| 3300032829|Ga0335070_10012073 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum | 10093 | Open in IMG/M |
| 3300032829|Ga0335070_10015623 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 8828 | Open in IMG/M |
| 3300032829|Ga0335070_10190592 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2049 | Open in IMG/M |
| 3300032892|Ga0335081_10008133 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 16819 | Open in IMG/M |
| 3300032892|Ga0335081_10565764 | All Organisms → cellular organisms → Bacteria | 1411 | Open in IMG/M |
| 3300032892|Ga0335081_11272360 | All Organisms → cellular organisms → Bacteria | 832 | Open in IMG/M |
| 3300033004|Ga0335084_10446290 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1331 | Open in IMG/M |
| 3300033158|Ga0335077_10140138 | All Organisms → cellular organisms → Bacteria | 2787 | Open in IMG/M |
| 3300033433|Ga0326726_11297150 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 708 | Open in IMG/M |
| 3300034090|Ga0326723_0367316 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 651 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 18.74% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 11.06% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 9.71% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 8.80% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 6.77% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.64% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.51% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.51% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.39% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.39% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.39% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.93% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.93% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.71% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.71% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.58% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.35% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.13% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.68% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.68% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.45% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.45% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.45% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.45% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.23% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.23% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.23% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.23% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.23% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.23% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.23% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001137 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300002557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm | Environmental | Open in IMG/M |
| 3300002560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm | Environmental | Open in IMG/M |
| 3300002561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002910 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm | Environmental | Open in IMG/M |
| 3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300004631 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF234 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005881 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_202 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012377 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015193 | Arctic soil microbial communities from a glacier forefield, Rabots glacier, Tarfala, Sweden (Sample Rb6, proglacial stream) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
| 3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300017993 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3 | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018029 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP06_20_MG | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019866 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1m1 | Environmental | Open in IMG/M |
| 3300019882 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2 | Environmental | Open in IMG/M |
| 3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
| 3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
| 3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
| 3300020015 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m1 | Environmental | Open in IMG/M |
| 3300020062 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a1 | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Host-Associated | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300026322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300026329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes) | Environmental | Open in IMG/M |
| 3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300026496 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-A | Environmental | Open in IMG/M |
| 3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027073 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027371 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027535 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027562 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027591 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027669 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027674 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027706 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027738 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300030730 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030991 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031023 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil TCEFA (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300034090 | Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00N | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPhiseqgaiiFebDRAFT_1015802192 | 3300000364 | Soil | MAQVIEFYIPSRFRKKVKWVPTTERGKVIEFPAEIKKSA* |
| INPhiseqgaiiFebDRAFT_1019099672 | 3300000364 | Soil | MSQVIEFYVPERFRKKVKWVPTEQRGKVIAFPVSVKKTA* |
| INPhiseqgaiiFebDRAFT_1019108622 | 3300000364 | Soil | MAQVIEFYIPSRFKKKVKWVPTERRGKVIEFPVEEKKSA* |
| JGI1027J11758_126019322 | 3300000789 | Soil | MAQXIEFYIPSRFKKKVKWVPTERRGKVIEFPVEEKKSA* |
| JGI12637J13337_10107392 | 3300001137 | Forest Soil | MARIIEFYIPARFHKAMKWNPPTERGKVLEFPAEVRKSA* |
| JGI12635J15846_100814644 | 3300001593 | Forest Soil | MARIIEFYIPARFHKAMKWIPPTERGKVLEFPXEVRKSA* |
| JGI12053J15887_100519242 | 3300001661 | Forest Soil | MARIIEFYIPARLHKPVKWITPAERGKVLEFPAEVRKSA* |
| JGI12627J18819_103245782 | 3300001867 | Forest Soil | KAAQRFMAKVINFYVPDRFRRKAGWVSPQRRGKLIEFRVQIKKSA* |
| JGI12627J18819_104810732 | 3300001867 | Forest Soil | MAQVIPFYVPDRFRRKVRWVPAEQRGKVIEFPAEIKKSA* |
| JGI25381J37097_10108903 | 3300002557 | Grasslands Soil | MAQVIEFYIPARFHKKVKWLPPEQRGKVIEFPAAIRKSA* |
| JGI25383J37093_100492543 | 3300002560 | Grasslands Soil | ILRRMAMAPVIKFYIPPSFHKLVKWIPPARRGKVLEFPAEIRKSA* |
| JGI25384J37096_100836382 | 3300002561 | Grasslands Soil | MAQVIEFYIPARFHKKVKWVPPEERGKVIEFPAEVRKSA* |
| JGI25384J37096_102104942 | 3300002561 | Grasslands Soil | MAQVIEFYIPARFHKRVKWLPPEQRGKVIEFPAAIRKSA* |
| JGI25382J43887_100980212 | 3300002908 | Grasslands Soil | MAPVIEFYIPTGFHKRVKWIPLAQRGKVVEFPVETRKMA* |
| JGI25615J43890_10404312 | 3300002910 | Grasslands Soil | MATVIEFYIPTRFHRRVKLIPAAQRGKVLEFPAELRKSA* |
| JGI25617J43924_101153411 | 3300002914 | Grasslands Soil | MARIIEFYIPTRFQKAMKWIPPTERGKVLEFPTEVRKSA* |
| JGIcombinedJ51221_100062372 | 3300003505 | Forest Soil | MAKVIEFYIPSRFQKRVKWIPTEQRGRVIEFPVEIKKSA* |
| Ga0058899_122940691 | 3300004631 | Forest Soil | MAQVIQFYIPDRFRKKVRWVPSEQRGKVIEFPAEVKKSA* |
| Ga0066395_101211923 | 3300004633 | Tropical Forest Soil | MAKVIEFYVPDRYKRKVKWIPAELRGKVIEFPVPIRKSA* |
| Ga0066395_103779502 | 3300004633 | Tropical Forest Soil | MAQVIEFYIPSRYHKESKWVPKEGRGKVLEFPMAVKKTA* |
| Ga0066395_104630221 | 3300004633 | Tropical Forest Soil | MAQVIEFYVPDRFHKKVKWVPPEKRGKVLEFPAEVKKTA* |
| Ga0066395_107165761 | 3300004633 | Tropical Forest Soil | MAKVIEFYVPDRHKRKVKWIPADLRGQVIEFPAPVRKTA* |
| Ga0066683_100254322 | 3300005172 | Soil | MAQVIEFYVPARFHRKVKWVPSEQRGKVIEFPSRIRKSA* |
| Ga0066680_100197172 | 3300005174 | Soil | MAQVIEFYIPARFHKKVKWIPPEQRGKVIDFPVEIRKSA* |
| Ga0066673_101636651 | 3300005175 | Soil | MAQVIEFYIPARFHKKVKWIPPEQRGKVIDFPAEIRKSA* |
| Ga0066673_107395021 | 3300005175 | Soil | MAQVIEFYIPASFHKKVKWLPPEQRGKVIDFPAEIRKSA* |
| Ga0066679_102504632 | 3300005176 | Soil | MAQVIEFYIPAQFQNKRAKWIPPAQRGKVLEFPAEIGKSA* |
| Ga0066679_106559792 | 3300005176 | Soil | MEDVMAPVIEFYIPSGFRKRVVWIPSVQRGKVLEFPAESRKSA* |
| Ga0066688_102996452 | 3300005178 | Soil | MAQVIEFYIPASFHKKVKWIPPEQRGKVIDFPAEIRKSA* |
| Ga0066676_101587313 | 3300005186 | Soil | MAQVIEFYTPARFQKKVKWVPPTQRGKVIEFPADMKKSA* |
| Ga0066676_106819301 | 3300005186 | Soil | RAAVSDRRGDMAQVIEFYIPARFHKKVKWIPPEQRGKVIDFPVEIRKSA* |
| Ga0066388_1000539533 | 3300005332 | Tropical Forest Soil | MAQVIEFYIPSRFKKKVKWIPTEWRGKVIEFPVEVKKSA* |
| Ga0066388_1004034503 | 3300005332 | Tropical Forest Soil | MAQVIEFYVPDRFHKKVKWVPPQQRGKVLEFPAAVKKTA* |
| Ga0066388_1011570222 | 3300005332 | Tropical Forest Soil | MAQVIEFYVPDRFRKKVKWVPPERRGKVLEFPPSVKKSA* |
| Ga0066388_1017105752 | 3300005332 | Tropical Forest Soil | MAKVIEFYTPARFRKTVKWVSPTLRGKVIEFPAALKKSA* |
| Ga0066388_1018779202 | 3300005332 | Tropical Forest Soil | MAQVIEFYVPDRFRKKVKWVPPEKRGKVLEFPPSVKKTA* |
| Ga0070709_101589171 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MAQVIEFYIPSRFKSKVKWIPAELRGKVLTFPANLKKSA* |
| Ga0070709_107341031 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MAQVIEFYIPNRFRKKVRWVPPEQRGKVLEFPVEIKKSA* |
| Ga0070709_115785241 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MAKVIEFYVPVRFRKKVKWTPPDERGRVIDFHPETRKSA* |
| Ga0070714_1006387092 | 3300005435 | Agricultural Soil | MAKVIAFYVPDRFRKKVHWVPPAQRGKLIEFPVDVKKSA* |
| Ga0070713_1001065703 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | AMAQVIQFYIPDRFRKKVRWVPSEQRGKVIEFPAEVKKSA* |
| Ga0070713_1004235111 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MAQVIQFYIPDRFRKKVRWVPSEQRGKVIEFPVEVKKSA* |
| Ga0070713_1024612921 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | LDRRMAMAKVIGFYIPERFRRKVRWVPPEQRGKMLEFPVEVKKSA* |
| Ga0070710_100842162 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MAKVIEFYVPDRFRKKMKWVPLEQRGKVLAFPEPVKKTA* |
| Ga0070711_1000169573 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MAKVIEFYVPDRFRKKMKWVPPEQRGKVLAFPEPVKKTA* |
| Ga0070708_1000331683 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MAQVIEFYIPARFHKKLKWVPPEERGKVIEFPAEVRKSA* |
| Ga0070708_1001734093 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MAMASLIKFYIPPSFHKLVKWIPPAGRGKVLEFPAEIRKSA* |
| Ga0070708_1010987501 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MAQVIEFYIPARFHRKVKWLPPEQRGKVIEFPAAIRKSA* |
| Ga0070708_1017056521 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MAQVIEFYVPAKFHKKVKWVPPEQRGRMIEFPAEIKKSA* |
| Ga0066686_104813112 | 3300005446 | Soil | MAQVIEFYIPASFHKKVKWIPPEQRGKVIYFPAEIRKSA* |
| Ga0070706_1000295162 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MATVIEFYIPVRFRRRVKLIPAAQRGKVLEFPAELRKSA* |
| Ga0070707_1001034423 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MAKVIEFHIPARFHKQMKWIPQAQRGKVLEFPAEVRKSA* |
| Ga0070707_1003645182 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MARVIEFYIPVSFHKKVKWVPPEQRGKVIEFPAEERKSA* |
| Ga0070707_1003947153 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | LLDRRRAMAQVIEFYIPARFHKKLKWVPPEERGKVIEFPAEVRKSA* |
| Ga0070707_1004033401 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MGALLLDRRRAMAQVIEFYIPARFHKKLKWVPPEERGKVIEFP |
| Ga0070707_1020999691 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MAQVIEFYVPTKFHKKVKWVPPEQRGRMIEFPAEIKKSA* |
| Ga0070698_1000304168 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | AAVSDRRGDMAQVIEFYIPARFHKKVKWIPPEQRGKVIDFPVEIRKSA* |
| Ga0070698_1002092363 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MAPVIKFYIPPSFHKLVKWIPPARRGKVLEFPAEIRKSA* |
| Ga0070698_1003247371 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MAQVIEFYIPARFHKPVKWIPPAERGKVLEFPAAVRKSA* |
| Ga0070699_1000413001 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MGALLLDRRRAMAQVIEFYIPARFHKKLKWVPPEERGKVIEF |
| Ga0070699_1000805563 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MAQVIEFYIPPRFRKPLKWIPSDQRGKVLEFPAEIRKSA* |
| Ga0070699_1007174862 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MAQVIEFYIPARFHKKVKWIPPEQRGKVIDFPTEIRKSA* |
| Ga0070699_1016150461 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MSEDVMTPVIEFYIPTGFHNRVKWIPPTQRGKVVEFPAETRKTA* |
| Ga0070741_1000716617 | 3300005529 | Surface Soil | MALVIEFYVPDRFRKKVRWTPPTQRGKVIKFPAAQKNTA* |
| Ga0070741_100180425 | 3300005529 | Surface Soil | MAKVISFYIPDRFRSKAKWIPPQQRGKVLEFPVERKKSA* |
| Ga0070697_1000014405 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | VTLGNVGRAAVSDRRADMAQVIEFYIPARFHKKVKWIPPEQRGKVIDFPAEIRKSA* |
| Ga0070697_1003685803 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MASVIKFYIPPSFHKLVKWIPPAGRGKVLEFPAEIRKSA* |
| Ga0070697_1005132062 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MTPVIEFYIPTGFHNRVKWIPPTQRGKVVEFPAETRKTA* |
| Ga0070697_1008677592 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MAPVIEFYIPRGFHKRVKWIPSDQRGKVLEFPAETRKSA* |
| Ga0070697_1009527622 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MAQVIEFYIPSRFKSKMKWIPQEQRGKVIEFPAAMRKSA* |
| Ga0070697_1013118511 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MAQVIEFYIPARFHKKVKWLPPEQRGKIIEFPTAIRKSA* |
| Ga0070731_100127943 | 3300005538 | Surface Soil | MAQVIEFYVPDRFRKKVKWVPASLRGKVIEFPATPVKKTA* |
| Ga0070731_101226032 | 3300005538 | Surface Soil | MAKVIEFYVPSRFRKKVKWTPPEERGRIIDFQPETRKSA* |
| Ga0070731_103992732 | 3300005538 | Surface Soil | MAQVIEFYVPDRYKRKTKWTPAELRGKVIEFPTPVRKSA* |
| Ga0070731_108524541 | 3300005538 | Surface Soil | MAKMIEFYVPDPFPRKVKWVPSEQRGQVIEFPKSVKKSA* |
| Ga0070731_109005642 | 3300005538 | Surface Soil | MAQVIEFYVPVRFQKRMSKWVPQEQRGKVLEFPAAIKKTA* |
| Ga0070732_100154416 | 3300005542 | Surface Soil | MAQVIEFYVPARFRKKVRWVPPTQRGKVIELPVAVKKTA* |
| Ga0070732_109355442 | 3300005542 | Surface Soil | MAMAQVIEFYIPNRFRKKVRWVPPEQRGKVLEFPVEIKKSA* |
| Ga0066701_106913532 | 3300005552 | Soil | ILRRMAMAPVIKFYIPPSFHKLVKWIPPAGRGKVLEFPAEIRKSA* |
| Ga0066661_101234271 | 3300005554 | Soil | QVIQFYIPDRFRKKVRWVPSEQRGKVIEFPAEVKKSA* |
| Ga0066692_102954901 | 3300005555 | Soil | EFYIPARFHKKVKWLPPEQRGKVIEFPAAIRKSA* |
| Ga0066707_100761323 | 3300005556 | Soil | LAPVIEFYIPTGFHKRVKWIPLAQRGKVVEFPVETRKMA* |
| Ga0066698_104403882 | 3300005558 | Soil | MAEVIEFYTPARFQKKVKWVPPTQRGKVIEFPADMKKSA* |
| Ga0066700_100653814 | 3300005559 | Soil | MAKVIEFHIPMRFHKQVKWIPPAQRGKVLEFPAEVRKSA* |
| Ga0066670_109586742 | 3300005560 | Soil | IEFYIPARFHKRVKWLPPEQRGKVIEFPAAIRKSA* |
| Ga0066693_104091301 | 3300005566 | Soil | LDRRMAMAKVIDFYIPERFRRKVRWVPPEQRGKMLDFPVEVKKSA* |
| Ga0066705_100146463 | 3300005569 | Soil | MAKVIDFYIPERFRRKVRWVPPEQRGKMLDFPVEVKKSA* |
| Ga0066654_102872221 | 3300005587 | Soil | MAMAKVIDFYIPERFRRKVRWVPPEQRGKMLDFPVEVKKSA* |
| Ga0070761_105312991 | 3300005591 | Soil | MAKIIEFYVPDPFPRKVKWVPSEQRGQVIEFPKSVKKSA* |
| Ga0066706_115118821 | 3300005598 | Soil | SEDVMAPVIEFYIPTGFHKRVKWIPLAQRGKVVEFPVETRKMA* |
| Ga0070762_108588241 | 3300005602 | Soil | MAPVIEFYIPSRFHERVKWMPQDQRGKLLAFSAEIRKSA* |
| Ga0066903_1017082333 | 3300005764 | Tropical Forest Soil | MEKVIEFYVPDRYKRKVKWIPAELRGKVIEFPVPIRKSA* |
| Ga0066903_1045198932 | 3300005764 | Tropical Forest Soil | MAQIIEFYIPARFHKKVKWLPPEQRGKVIEFPAPIRKSA* |
| Ga0066903_1081667862 | 3300005764 | Tropical Forest Soil | MAQVIEFYIPDSFRKKVKWVPPEQRGKVINFPMEVKKSA* |
| Ga0075294_10349902 | 3300005881 | Rice Paddy Soil | MAKVIEFYVPARFHKKVKWVPQELRGKVIEFPPEIRKSA* |
| Ga0070766_102760072 | 3300005921 | Soil | MAKVIEFYIPSRFQKRVKWIPTELRGQVIEFPVEIKKSA* |
| Ga0070766_110193112 | 3300005921 | Soil | MARIIEFYIPARFHKAMKWIPPTERGKVLEFPAEVRKSA* |
| Ga0070717_101224333 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MAPVIKFYIPPSFHKLVKWIPPAGRGKVLEFPAEVRKSA* |
| Ga0070717_107357071 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | EDVMATVIEFYIPVRFRRRVKLIPAAQRGKVLEFPAELRKSA* |
| Ga0070717_108404811 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MAKVIEFYIPSRFQKRVKWIPTELRGRVIEFPVEIKKSA* |
| Ga0070717_110279321 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MAQVIQFYIPGRFRKKVRWVPSEQRGKVIEFPVEVKKSA* |
| Ga0075023_1002046882 | 3300006041 | Watersheds | MAQVIEFYVPSRFRKKVKWVPETQRGKLIEFPADIKKSA* |
| Ga0075028_1005569931 | 3300006050 | Watersheds | MAQVIEFYVPNRFRKKVKWVPETQRGKVIAFPVDVKKSA* |
| Ga0075029_1004979843 | 3300006052 | Watersheds | MAKVIEFYVPNRFRKKAKWVPETLRGKVIAFPADVKKSA* |
| Ga0075029_1007290232 | 3300006052 | Watersheds | MAKLIEFYVPSRFHKKVKWVPPADRGKVIEFFVPGRKTA* |
| Ga0075017_1011239342 | 3300006059 | Watersheds | GIGSEDAMAQVIEFYVPNRFRKKVKWLPATERGKVIEFPADIKKSA* |
| Ga0075017_1013190232 | 3300006059 | Watersheds | MAQVIEFYVPNRFRKKVKWVPETQRGKVIAFPADVKKSA* |
| Ga0075015_1000702312 | 3300006102 | Watersheds | MAQVIEFYVPNRFRKKVKWLPATERGKVIEFPADIKKSA* |
| Ga0075030_1000522623 | 3300006162 | Watersheds | MAQVIEFYVPNRFRKKVKWVPETQRGKVIAFPADIKKSA* |
| Ga0075018_103018411 | 3300006172 | Watersheds | MAQVIEFYVPDRFRKKKVRWVPPEQRGKIIAFPIEVKKSA* |
| Ga0070716_1016032841 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MAMAQVIEFYIPARFHKKVKWLPPEQRGKVIEFPAAIRKSA* |
| Ga0075014_1000178631 | 3300006174 | Watersheds | MAQVIEFYVPSRFRKKVKWVPETQRGKLIEFPADIKKS |
| Ga0075014_1001925851 | 3300006174 | Watersheds | MAKVIEFYVPPGFQKRVKWVPTELRGKVIEFPAEIKKSA* |
| Ga0070712_1000035888 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MAMAKVIEFYVPDRFRKKMKWVPPEQRGKVLAFPEPVKKTA* |
| Ga0070765_1000389242 | 3300006176 | Soil | MAQVIEFYVPARFRKKVRWVPQTQRGKVIELPVAVKKTA* |
| Ga0079222_107915693 | 3300006755 | Agricultural Soil | MAQVIEFCIPARFHKKVKWLPPEQRGKVIEFPAAIRK |
| Ga0066653_102397102 | 3300006791 | Soil | MAQVIEFYTPARFQKKVKWVPPTQRGKVIEIPADMKKSA* |
| Ga0066658_100948742 | 3300006794 | Soil | MAPVIKFYIPPSFHKLVKWIPPARRGKVLEFPAEI |
| Ga0066658_101803022 | 3300006794 | Soil | MAQVIEFYIPARFHKKVKWIPPEQRGKVIDFPVEIRKSG* |
| Ga0066659_105967612 | 3300006797 | Soil | DAMAQVIQFYIPDRFRKKVRWVPSEQRGKVIEFPAEVKKSA* |
| Ga0066660_100851731 | 3300006800 | Soil | DAMAKVIEFHIPMRFHKQVKWIPPAQRGKVLEFPAEVRKSA* |
| Ga0066660_101701024 | 3300006800 | Soil | LRRMAMAPVIKFYIPPSFHKLVKWIPPAGRGKVLEFPAEIRKSA* |
| Ga0075433_100091752 | 3300006852 | Populus Rhizosphere | MAQVIEFYVPARFHRKVKWVPSEQRGKVIEFPSQIRKSA* |
| Ga0075425_1014594192 | 3300006854 | Populus Rhizosphere | MAQVIEFYVPSRFKKKVKWIPPERRGQVIDFPAEVKKSA* |
| Ga0073928_1000072930 | 3300006893 | Iron-Sulfur Acid Spring | MARIIEFYIPARFHKAMKWIPTTERGKVLEFPPEVRKSA* |
| Ga0073928_101811642 | 3300006893 | Iron-Sulfur Acid Spring | MAKVIEFYIPARFRKQVKWTPPAERGKVLEFVVEMRKSA* |
| Ga0073928_101814872 | 3300006893 | Iron-Sulfur Acid Spring | MAKVIEFYIPARFHKPVKWTPPAERGKVLEFVVEMRKSA* |
| Ga0079219_109951081 | 3300006954 | Agricultural Soil | RAGSEGKSMANVIEFYIPTRYRKPVKWVAPENRGKVLSFPVETRKSA* |
| Ga0099791_100188931 | 3300007255 | Vadose Zone Soil | MAPVIEFYIPTGFHKRVKWIPLAQRGKLVEFPVETRKMA* |
| Ga0099793_100005867 | 3300007258 | Vadose Zone Soil | MAQVIEFYIPSRFRKKVKWVPETQRGKVIEFPADIKKSA* |
| Ga0099794_103205422 | 3300007265 | Vadose Zone Soil | MAQVIELYIPARFHKQVKWVPPAERGKVLEFPAAVRKSA* |
| Ga0099829_100184433 | 3300009038 | Vadose Zone Soil | MAQVIEFYIPARFHKPVKWIPAAERGKVLEFPAAVRKSA* |
| Ga0099829_100836092 | 3300009038 | Vadose Zone Soil | MAMAQVIEFYIPARFHKRVKWLPPEQRGKVIEFPAAIRKSA* |
| Ga0099829_101984122 | 3300009038 | Vadose Zone Soil | MAQVIEFYIPARFHKQVKWAPPAERGKVLEFPAAVRKSA* |
| Ga0099829_107455251 | 3300009038 | Vadose Zone Soil | MAMAKVIEFYTPARFQKKVKWVPATQRGKVIEFPVDMKKSA* |
| Ga0099829_113701752 | 3300009038 | Vadose Zone Soil | MARIIEFYIPARFHKPVKWMPPAELGKVLEFSAEVRKSA* |
| Ga0099829_115791951 | 3300009038 | Vadose Zone Soil | TSEDAMARIIKFYIPARFHKAMKWIPPTERGKVLEFPAEVRKSA* |
| Ga0099830_100299812 | 3300009088 | Vadose Zone Soil | MAQVIEFYIPARFHKRVKWVPPEQRGKVIEFPSEVRKSA* |
| Ga0099830_100823802 | 3300009088 | Vadose Zone Soil | MGALLLDRRRAMAQVIEFYIPARFHKKLKWVPPEERGKVIEFPAEVRKSA* |
| Ga0099830_102359761 | 3300009088 | Vadose Zone Soil | MVMARVIEFYIPVSFHKKVKWVPPEQRGKVIEFPAEERKSA* |
| Ga0099828_100236966 | 3300009089 | Vadose Zone Soil | MAQVIEFYVPARFHKKVKWVPPEQRGKMIEFRAEIKKSA* |
| Ga0099827_102001903 | 3300009090 | Vadose Zone Soil | MAQIIEFYIPPRFRKPMKWIPSDQRGKVLEFPAEIRKSA* |
| Ga0099827_109907601 | 3300009090 | Vadose Zone Soil | RMAMAQVIEFYIPARFHKKVKWLPPEQRGKVIEFPAAIRKSA* |
| Ga0066709_1010338041 | 3300009137 | Grasslands Soil | MAQVIEFYIPASFHERGKWVPPEQRGKVVDFPAEIRK |
| Ga0066709_1015331121 | 3300009137 | Grasslands Soil | IEFYTPARFQKKVKWVPPTQRGRVIEFPADMKKSA* |
| Ga0099792_100173954 | 3300009143 | Vadose Zone Soil | MAQVIEFYIPPRFRKPVKWVPSAQRGKVLEFPAEIQKSA* |
| Ga0099792_100972142 | 3300009143 | Vadose Zone Soil | MAQVIEFYIPARFHKQMKWVPPAERCKVLEFPAAVRKSA* |
| Ga0075423_101168025 | 3300009162 | Populus Rhizosphere | MAMAQVIEFYIPSRFKKKVKWVPTERRGKVIEFPVEEKKSA* |
| Ga0126384_107076331 | 3300010046 | Tropical Forest Soil | MAQVIEFYVPDRFHKKVKWVPPEQRGKVLEFPAAVKKTA* |
| Ga0126382_100505912 | 3300010047 | Tropical Forest Soil | MAQVIEFYIPSRFKKKVKWIPTERRGQVIEFPAEVKKSA* |
| Ga0126373_102790983 | 3300010048 | Tropical Forest Soil | MAMAQVIEFYIPARFQKKVKWTPASLRGKVIEFPVPVKKTA* |
| Ga0126373_112005622 | 3300010048 | Tropical Forest Soil | MAMAQVIEFYVPDRFRKKVKWIPASKRGKLIEFPVPVKKTA* |
| Ga0126373_123251781 | 3300010048 | Tropical Forest Soil | MAQVIEFYIPSSYHKNSKWVPKESRGKVLEFPVAVKKTA* |
| Ga0126370_107071101 | 3300010358 | Tropical Forest Soil | MAMAKVIEFYIPEKYRQKVKWIPVEQRGKVLEFPAVITKKSA* |
| Ga0126370_110035832 | 3300010358 | Tropical Forest Soil | LDRRMAMAQVIEFYIPERFKKRVKWVPAENRGKVLSFPVDIKKTA* |
| Ga0126376_107192531 | 3300010359 | Tropical Forest Soil | MAMAQVIEFYIPERFKKRVKWVPAENRGKVLSFPVDIKKTA* |
| Ga0126372_107256172 | 3300010360 | Tropical Forest Soil | MAQVIQFYVPDRFRKKVRFVPPEQRGKLVVFPVEAKKSA* |
| Ga0126372_116354392 | 3300010360 | Tropical Forest Soil | AQVIEFYVPDRFRKKVRWVPPEKRGKVIEFPVEVKKSA* |
| Ga0126372_125950311 | 3300010360 | Tropical Forest Soil | MAMAQVIEFYIPERFKKKVKWVPAENRGKVLSFPVDIKKTA* |
| Ga0126378_100035435 | 3300010361 | Tropical Forest Soil | MAMAKVIEFYVPDRYKRKVKWIPADLRGQVIEFPAPVRKTA* |
| Ga0126378_107207692 | 3300010361 | Tropical Forest Soil | QVIEFYIPARFHKKVKWLPPEQRGKVIEFPAPIRKSA* |
| Ga0126378_114146102 | 3300010361 | Tropical Forest Soil | MAKVIEFYVPERFRKKVKWVPATQRGKVIQFPVDVKKSA* |
| Ga0126378_134205551 | 3300010361 | Tropical Forest Soil | MAQVIEFYIPSRYHKESKWVPKEGRGKVLEFPAAVKKTA* |
| Ga0126381_1005199302 | 3300010376 | Tropical Forest Soil | MAQVIEFYIPSSYQKQSKWVPKEGRGKVLEFPVAVKKTA* |
| Ga0126381_1039803421 | 3300010376 | Tropical Forest Soil | MAKVIEFYVPERFRKKVKWVPATQRGKVIRFPVDVKKSA* |
| Ga0126383_116358432 | 3300010398 | Tropical Forest Soil | MAKVIEFYVPDRFRKKVKWVPATQRGKVIAFPVEVKKTA* |
| Ga0126383_118553922 | 3300010398 | Tropical Forest Soil | MAQVIEFYVPDRFRKKVRWVPPEKRGKVIEFPVEVKKSA* |
| Ga0126383_123236172 | 3300010398 | Tropical Forest Soil | MAKVIEFHIPVKFLKKVKWVPSAERGRLIEFPIGIKKSA* |
| Ga0137391_104375882 | 3300011270 | Vadose Zone Soil | MAQVIEFYVPAKFHKKVKWVPPEQRGKMIEFPAEIKKSA* |
| Ga0137393_102558621 | 3300011271 | Vadose Zone Soil | NSKSEMATAQMIAFYIPARFHKNVKWIPPEQRGKVIEFPAEVKKSA* |
| Ga0137393_105535031 | 3300011271 | Vadose Zone Soil | RIIEFYIPARFHKPVKWMPPAELGKVLEFSAEVRKSA* |
| Ga0137393_107451122 | 3300011271 | Vadose Zone Soil | MATVIEFYIPVRFRRRVKLIPAAQRGKVLEFPAELRKSA |
| Ga0137389_100322936 | 3300012096 | Vadose Zone Soil | MAQLIEFYIPPRFRKPEKWIPLVPRGKVLESPSEARKSA* |
| Ga0137389_103820591 | 3300012096 | Vadose Zone Soil | MAPVIKFYIPPSFHKLVKWIPPAGRGKVLEFPAEIRKSA* |
| Ga0137388_1000513910 | 3300012189 | Vadose Zone Soil | MARIIEFYIPARFHKPVKWMPPAERGKVLEFPAEVRKSA* |
| Ga0137388_103566052 | 3300012189 | Vadose Zone Soil | MAQVIEFYIPARFHKQVKWVPPAERGKVLEFPAAVRKSA* |
| Ga0137383_100157261 | 3300012199 | Vadose Zone Soil | FFGGSMAPVIKFYIPPSFHKLVKWIPPAGRGKVLEFPAEIRKSA* |
| Ga0137383_109601221 | 3300012199 | Vadose Zone Soil | QVIEFYVPASFHKKVKWLPPEQRGKVIDFPAEIRKSA* |
| Ga0137382_100064344 | 3300012200 | Vadose Zone Soil | MAQVIEFYIPSRFQKKVKWVPVTQRGKVIEFPAEIKKSA* |
| Ga0137382_100516024 | 3300012200 | Vadose Zone Soil | MARVIEFYIPAGFHKPVKWIPSAKRGKVLEFPVAVQKSA* |
| Ga0137382_101948652 | 3300012200 | Vadose Zone Soil | MAQVIEFYIPSRFQKKVKWVPKAERGKVIEFPAEIKKSA* |
| Ga0137382_113082761 | 3300012200 | Vadose Zone Soil | MAQVIEFYIPSRFRKKVKWVPKADRGKVLEFPVEIKKSA* |
| Ga0137382_113431121 | 3300012200 | Vadose Zone Soil | KEDIMEDVIAPVIEFYIPTGFRKRVKWIPSVRRGKVLEFPPEARKSA* |
| Ga0137399_101309461 | 3300012203 | Vadose Zone Soil | SKSEDVMAPVIEFYIPTGFHKRVKWIPLAQRGKVVEFPVETRKMA* |
| Ga0137399_101928381 | 3300012203 | Vadose Zone Soil | MAPVIEFYIPPRFHRLVKWIPAGQRGKVLEFPAEI |
| Ga0137399_107779351 | 3300012203 | Vadose Zone Soil | MAQVIEFYIPARFHKQMKWVPPAERCKVLEFPAAV |
| Ga0137362_101153574 | 3300012205 | Vadose Zone Soil | MAQVIELYIPARFHKQVKWVPPAERGKVLEFPAAMRKSA* |
| Ga0137362_103717172 | 3300012205 | Vadose Zone Soil | MAPVIEFYIPTGFHQRVKWIPLAQRGKVVEFPVETRKMA* |
| Ga0137381_102323992 | 3300012207 | Vadose Zone Soil | MAQVIEFYVPDRFRKKKTRWVPPEQRGKVIEFPLPEKKSA* |
| Ga0137376_102706552 | 3300012208 | Vadose Zone Soil | MAQVIEFYIPSLFQKKVKWVPVTQRGKVIEFPAEIKKSA* |
| Ga0137376_110312511 | 3300012208 | Vadose Zone Soil | DVMAPVIEFYIPSGFRKRVKWIPSVQRGKVLEFPAETRKSA* |
| Ga0137376_117733841 | 3300012208 | Vadose Zone Soil | MAKVIEFHVPDRFRKKMKWVPPEQRGKVLAFPEPVKKTA* |
| Ga0137379_116210372 | 3300012209 | Vadose Zone Soil | GVMAQVIEFYIPASFHKKVKWVPPEQRGKVIDFPAEIRKSA* |
| Ga0137387_103603073 | 3300012349 | Vadose Zone Soil | AQVIEFYIPASFHKKVKWVPPEQRGKVIDFPAEIRKSA* |
| Ga0137360_101618503 | 3300012361 | Vadose Zone Soil | MAHVIEFYIPSRFQKKVKWVPKADRGKVIEFPAEI |
| Ga0137360_107943091 | 3300012361 | Vadose Zone Soil | MAQVIEFYIPNGFRKKVKWVPETQRGKLIEFPADIKKSA* |
| Ga0137361_108159581 | 3300012362 | Vadose Zone Soil | MAQVIEFYIPSRFRKKVKWVPKADRGKVIEFPVEIKKSA* |
| Ga0137361_117043662 | 3300012362 | Vadose Zone Soil | YELPFSKLSREDIMEDVMAPVSEFYIPTGFRKRVKWIPSAQRGKMLEFPPETRKSA* |
| Ga0134029_10846412 | 3300012377 | Grasslands Soil | DRRMAMAQVIEFYIPARFHKRVKWLPPEQRGKVIEFPAAIRKSA* |
| Ga0150984_1119263632 | 3300012469 | Avena Fatua Rhizosphere | MAQVIEFYIPARFQKKVKWVPEKVAGKVIEFPVNIKKSA* |
| Ga0137358_100566142 | 3300012582 | Vadose Zone Soil | MAQVIEFYIPARFHKPVKWTPLAQRGKVLEFPAEMRKSA* |
| Ga0137358_101161403 | 3300012582 | Vadose Zone Soil | MAQVIEFYIPSQFRKPMKWIPSDQRGKVLEFPAEIRKSA* |
| Ga0137397_100538433 | 3300012685 | Vadose Zone Soil | MAQVIEFYIPPRFRKPMKWIPSAQRGKVLEFPAEIRKSA* |
| Ga0137397_102233742 | 3300012685 | Vadose Zone Soil | MAQVIEFYIPNRFRKKVKWVPTTQRGKVLEFPAEVKKSA* |
| Ga0137359_100884533 | 3300012923 | Vadose Zone Soil | MARVIEFYIPSQFRKPMKWIPSDQRGKVLEFPAEIRKSA* |
| Ga0137359_102424002 | 3300012923 | Vadose Zone Soil | MAMAQVIEFYIPARFHKRVKWHPPEQRGKVIEFPAAIRKSA* |
| Ga0137419_111036581 | 3300012925 | Vadose Zone Soil | MAMAKVIEFHVPDRFRKKMKWVPPEQRGKVLAFPEPVKKTA* |
| Ga0137419_118999051 | 3300012925 | Vadose Zone Soil | QVIEFYIPNRFRKKVKWVPTTQRGKVLEFPAEVKKSA* |
| Ga0137416_104334892 | 3300012927 | Vadose Zone Soil | MAQVIEFYIPNGFRKKVKWVPTTQRGKVIEFPAEVKKSA* |
| Ga0137404_114411971 | 3300012929 | Vadose Zone Soil | MAPVIEFYIPSGFRKRVKWIPSVQRGKVLEFPAETRKSA* |
| Ga0137404_116299122 | 3300012929 | Vadose Zone Soil | SEDVMAPVIEFYIPRGFHKRVKWVPSDQRGKVLEFPAETRKSA* |
| Ga0137407_102254881 | 3300012930 | Vadose Zone Soil | MAQVIEFYIPARFHKKVKWIPPEQRGKVIDFPIEIRKSA |
| Ga0137410_117760371 | 3300012944 | Vadose Zone Soil | KIIEFYIPGKFRKNVKWVPAEQRGKVIEFPAPIEKSA* |
| Ga0164303_101149262 | 3300012957 | Soil | MAKVIEFYVPDRFPKKMKWVPPEQRGKVLAFPEPVKKTA* |
| Ga0126369_100606915 | 3300012971 | Tropical Forest Soil | MAMAQVIEFYVPDRFHKKVKWVPPEKRGKVLEFPAEVKKTA* |
| Ga0126369_100717765 | 3300012971 | Tropical Forest Soil | MAMAKVIEFYVPDRYKRKVKWIPAELRGKVIEFPVPIRKSA* |
| Ga0164304_118771132 | 3300012986 | Soil | MAQVIEFYVPDRFRKKVKWVPTEQRGKVIAFPVAVKKTA* |
| Ga0137420_14865415 | 3300015054 | Vadose Zone Soil | MAHVIEFYIPSRFQKKVKWVPKSGPGKVIEFPAEIKKSA* |
| Ga0167668_10038884 | 3300015193 | Glacier Forefield Soil | MARIIEFYIPARFHKAMKWIPPTERGKVLDFPAEVRKSA* |
| Ga0137418_101167352 | 3300015241 | Vadose Zone Soil | MARIIEFYIPARFHNPVKWMPPAARGKVLEFPAEVRKSA* |
| Ga0137418_102254011 | 3300015241 | Vadose Zone Soil | MAQIIEFYIPPRFRKPMKWFPLVQRGKVLEFPAEIRKSA* |
| Ga0137418_113134442 | 3300015241 | Vadose Zone Soil | MARLIEFYIPARFHKKVKWIPLEQRGKVIDFPAEIRK |
| Ga0137403_101253323 | 3300015264 | Vadose Zone Soil | MAQVIEFYIPPRFRKPMKWIPSDQRGKVLEFPAEIRKSA* |
| Ga0137403_115062121 | 3300015264 | Vadose Zone Soil | MEDVMAPVIEFYIPSGFRKRVKWIPSVQRGKVLEFPAETRKSA |
| Ga0134085_105313332 | 3300015359 | Grasslands Soil | WRVDRRMAMAQVIEFYIPARFHKKVKWLPPEQRGKVIEFPAAIRKSA* |
| Ga0132258_103975034 | 3300015371 | Arabidopsis Rhizosphere | MVMAQVIEFYVPDRFRKKVKWVPTEQRGKVIAFPVAVKKTA* |
| Ga0132258_108929453 | 3300015371 | Arabidopsis Rhizosphere | MAQVIEFYIPSRFRKKVRWIPTERRGQVIEFPAEVKKSA* |
| Ga0132258_112679243 | 3300015371 | Arabidopsis Rhizosphere | MAMAQVIEFYVPERFRKKVKWVPTEQRGKVIAFPVSVKKTA* |
| Ga0132256_1020492282 | 3300015372 | Arabidopsis Rhizosphere | MAQVIEFYVPERFRKKVKWVPTEQRGKVIAFPVSVK |
| Ga0182035_110919711 | 3300016341 | Soil | DAMAQVIEFYIPSSYQKKSKWVPKEARGKVLEFPVAVKKTA |
| Ga0182037_109820622 | 3300016404 | Soil | MAKVIEFYVPDRYKRKVKWIPADLRGQVIEFPAPV |
| Ga0182037_109966162 | 3300016404 | Soil | MAQVIEFYVPARFQKKVKWIPASLRGKVIEFPVPVKKTA |
| Ga0187824_100007324 | 3300017927 | Freshwater Sediment | MAKVIAFYVPDRFRKKVHWVPPAQRGKLIEFPVDVKKSA |
| Ga0187824_100380663 | 3300017927 | Freshwater Sediment | MAMAQVIEFYIPNRFRKKVRWVPPEQRGKVLEFPVEIKKSA |
| Ga0187825_100195412 | 3300017930 | Freshwater Sediment | MAKVIAFYVPDRFRKRVRWVPPAQRGKLIEFPVDVKKSA |
| Ga0187825_100863272 | 3300017930 | Freshwater Sediment | MAKVIEFYVPNRFRKKAKWVPETQRGKVIAFPAEVKKSA |
| Ga0187825_103772832 | 3300017930 | Freshwater Sediment | MAMAKVIAFYVPDRFRKRVRWIPPAQRGKLIEFPVDVKKSA |
| Ga0187801_102016772 | 3300017933 | Freshwater Sediment | MAKVIEFYIPAGFQRKSKWLPEEQRGKVIEFPAEIKKSA |
| Ga0187821_100500102 | 3300017936 | Freshwater Sediment | MAQVIEFYVPDRFRKKVKWVPTEQRGKVIAFPVAVKKTA |
| Ga0187821_103009212 | 3300017936 | Freshwater Sediment | MAQVIEFYIPNRFRKKVRWVPPEQRGKVLEFPVEIKKSA |
| Ga0187808_103036092 | 3300017942 | Freshwater Sediment | DRRAAMAKVIQFYIPARFHKKAKWLPLELRGKVIEFPSEIKKSA |
| Ga0187819_101077312 | 3300017943 | Freshwater Sediment | MAQVIEFYVPNRFRKKVKWVPSAQRGKVIEFPAEVKKSA |
| Ga0187779_1000002830 | 3300017959 | Tropical Peatland | MARVIEFYVPDRFRKKVKWMPPAQRGKVIEFPTEVKKSA |
| Ga0187776_100953072 | 3300017966 | Tropical Peatland | MAKVIEFYIPARFHKKVKWVPQELRGKVIEFPAEIRKSA |
| Ga0187776_104510072 | 3300017966 | Tropical Peatland | MAKVIEFYIPASFQRKSKWLPLEQRGKVIAFPTEIKKSA |
| Ga0187776_112173652 | 3300017966 | Tropical Peatland | LDRRMVMAKVIEFYIPARFHKKVKWVPQELRGKVIEFPAEIRKSA |
| Ga0187777_113993701 | 3300017974 | Tropical Peatland | MAKVIEFYVPPGFHRKSKWLPVELRGKVIEFPSPIKKSA |
| Ga0187823_100196591 | 3300017993 | Freshwater Sediment | MVMAKVIAFYVPDRFRKKVHWVPPAQRGKLIEFPVDVKKSA |
| Ga0187804_102088671 | 3300018006 | Freshwater Sediment | MAQVIEFYVPNRFRKKVKWVPPAQRGKVIEFPAEVKKSA |
| Ga0187787_101405172 | 3300018029 | Tropical Peatland | MAKVIAFYVPDRYRKKVRWVPPAQRGRVIEFPVEVKKSA |
| Ga0187766_111446171 | 3300018058 | Tropical Peatland | MAQVIEFYVPANFRKKVKWVPKEGKVLEFPVPAKKTA |
| Ga0066655_104231211 | 3300018431 | Grasslands Soil | MAMAQVIEFYIPARFHKKVKWLPPEQRGKVIEFPAAIRKSA |
| Ga0066667_100623181 | 3300018433 | Grasslands Soil | MAQVIEFYTPARFQKKVKWVPPTQRGKVIEFPADMKKSA |
| Ga0066662_100794391 | 3300018468 | Grasslands Soil | MAPVIEFYIPTGFHKRVKWIPLAQRGKVVEFPVETRKMA |
| Ga0066662_119380721 | 3300018468 | Grasslands Soil | MAQVIEFYIPARFHKKVKWLPPEQRGKVIEFPAAIRKSA |
| Ga0066669_100150012 | 3300018482 | Grasslands Soil | MAPVIKFYIPPSFHKLVKWIPPARRGKVLEFPAEIRKSA |
| Ga0066669_100641091 | 3300018482 | Grasslands Soil | MDRRASMAQVIEFYVPTRFHRKVKWVPVEQRGKVIEFPSRIRKSA |
| Ga0137408_11469581 | 3300019789 | Vadose Zone Soil | MAPVIEFYIPTGFHQRVKWIPLAQRGKVVEFPVETRKMA |
| Ga0193756_10273181 | 3300019866 | Soil | MLDRRMAMAKVIEFYVPDRFRKKMKWVPLEQRGKVLAFPEPVKKTA |
| Ga0193713_10281591 | 3300019882 | Soil | MARVIEFYIPAGFHKPVKWIPSAKRGKVLEFPVAVQKSA |
| Ga0193729_10141324 | 3300019887 | Soil | MARIIEFYIPARFHKAMKWIPPTERGKVLEFPAEVRKSA |
| Ga0193751_100026447 | 3300019888 | Soil | MARIIEFYIPARFHKLVKWMPPAERGKVLEFPAEIRKSA |
| Ga0193751_10049434 | 3300019888 | Soil | MARIIEFYIPARFHNPVKWMPPAKRGKVLEFPAEVRKSA |
| Ga0193751_10105224 | 3300019888 | Soil | MAQVIEFYIPASFHKKVKWLPPEQRGKVIDFPAEIRKSA |
| Ga0193755_10041265 | 3300020004 | Soil | MAPVIEFYIPTGFPKRVKWIAPAQRGKVLEFPPETRKSA |
| Ga0193734_10223284 | 3300020015 | Soil | MAQVIEFYIPDRFRKKVRWVPPDRRGKVIEFPAEVK |
| Ga0193724_10681532 | 3300020062 | Soil | MLGVAMARVIEFYIPAGFHKPVKWIPSAKRGKVLEFPAAVQKSA |
| Ga0179594_101054201 | 3300020170 | Vadose Zone Soil | MAQVIEFYIPNRFRKKVKWVPTTQRGKVLEFPAEVKKSA |
| Ga0179594_103631671 | 3300020170 | Vadose Zone Soil | MLDRRMAMAKVIEFHVPDRFRKKMKWVPPEQRGKVLAFPEPVKKTA |
| Ga0179594_104152251 | 3300020170 | Vadose Zone Soil | MAHVIEFYIPSRFQKKVKWVPKADRGKVIEFPAEIKKSA |
| Ga0179592_102521752 | 3300020199 | Vadose Zone Soil | MAQVIEFYIPSRFRKKVKWVPKADRGKVIEFPVEIKKSA |
| Ga0210407_1000150618 | 3300020579 | Soil | MARIIEFYIPARFHKAMKWIPPTDRGKVLEFPAEVRKSA |
| Ga0210407_100329632 | 3300020579 | Soil | MATVIEFYIPARFHKHAKWIPPALRGKVVEFPGQIRKSA |
| Ga0210407_100659184 | 3300020579 | Soil | MAQVIQFYIPDRFRKKVRWVPSEQRGKVIEFPAEVKKSA |
| Ga0210407_102699393 | 3300020579 | Soil | MAKVIEFYVPDRFRKKVKWVPLEQRGKVLAFPEPVKKTA |
| Ga0210407_112432502 | 3300020579 | Soil | MAQVIEFYVPNRFRKKVKWVPETQRGKVIAFPADVKKSA |
| Ga0210403_114148641 | 3300020580 | Soil | MAKLIEFYVPSRFHKKVKWVPPADRGKVIEFFVPARKTA |
| Ga0210399_100204823 | 3300020581 | Soil | MARIIEFYIPAQFHKAMKWIPPTERGKVLEFPAEVRKSA |
| Ga0210399_100655322 | 3300020581 | Soil | MAKIIDFYVPARFHKKVKWVPPADRGKVIEFCVPIRKTA |
| Ga0210399_103630951 | 3300020581 | Soil | MAQVIEFYVPDRFRKKVRWVPPEQRGKVIEFPTEIKKSA |
| Ga0210401_1000190020 | 3300020583 | Soil | MAQVIKFYVPDRFRKKIKWVPASLRGKLIEFPAAPVKKTA |
| Ga0210401_100074069 | 3300020583 | Soil | VIGSEDGMAQVIEFYVPARFRKKVRWVPQTQRGKVIELPVAVKKTA |
| Ga0210401_100289251 | 3300020583 | Soil | MAQVIEFYVPDRFKRRVKWTPAAQRGRVIEFPAAIRKSA |
| Ga0210401_100807834 | 3300020583 | Soil | MAQVIEFYVPDRYKRKTKWTPAELRGKVIEFPTPVRKSA |
| Ga0210401_100849981 | 3300020583 | Soil | MARIIEFYIPPRFHKAMKWIPPTERGKVLEFPAEVRKSA |
| Ga0210401_101000873 | 3300020583 | Soil | MTPVIELYIPSRFHNRVKWIPQDQRGKLLMFSAEIRKSA |
| Ga0210401_103168522 | 3300020583 | Soil | MAQVIEFYVPARFQKKMSKWVPQEQRGKVLEFPAAIKKTA |
| Ga0210401_106955021 | 3300020583 | Soil | MAQVIEFYVPARFRKKVRWVPPTQRGKVIELPVAVKKTA |
| Ga0210401_108370982 | 3300020583 | Soil | MVMAKVIEFYIPSRFQKRVKWIPTELRGRVIEFPVEIKKSA |
| Ga0179596_105546541 | 3300021086 | Vadose Zone Soil | MAQVIELYIPARFHKQVKWVPPAERGKVLEFPAAVRKSA |
| Ga0210404_100049176 | 3300021088 | Soil | MAQVIEFYVPARFRKKVRWVPQTQRGKVIELPVAVKKTA |
| Ga0210404_102376652 | 3300021088 | Soil | MVMAKVIEFYIPSRFQKRVKWIPTELRGQVIEFPVEIKKSA |
| Ga0210406_1000024744 | 3300021168 | Soil | MATMIGFYIPARFHKHAKWIPPALRGKVVEFPGQIRKSA |
| Ga0210400_103031312 | 3300021170 | Soil | MAKVIEFYIPSRFQKRVKWIPTELRGRVIEFPVEIKKSA |
| Ga0210400_114060641 | 3300021170 | Soil | TSEDAMARIIEFYIPERFHKPVKWMPPAERGKVLEFPAEVRKSA |
| Ga0210405_103487273 | 3300021171 | Soil | RKAAQRVMAKVINFYVPNRFQSKVKWIPPQRRGKLIEFPVQVKKSA |
| Ga0210405_107491541 | 3300021171 | Soil | MAKVINFYVPNRFQSKVKWIPPQRRGKLIEFPVQVKKS |
| Ga0213874_101230832 | 3300021377 | Plant Roots | MAKVIAFYVPDRFRKKVRWVPPAQRGKLIEFPVDEKKSA |
| Ga0210389_114935141 | 3300021404 | Soil | KVIEFYIPSRFQKRVKWIPTELRGRVIEFPVEIKKSA |
| Ga0210387_116748522 | 3300021405 | Soil | IEFYVPERFRKTQPWIPPEQRGKVIEFPSAEKKSA |
| Ga0210386_107937141 | 3300021406 | Soil | HVGSEDDMAQVIEFYVPDRFKRRVKWTPAAQRGRVIEFPAAIRKSA |
| Ga0210384_1000081138 | 3300021432 | Soil | MAKVIEFYIPSRFQKRVKWIPTELRGQVIEFPVEIKKSA |
| Ga0210384_114674192 | 3300021432 | Soil | IGSEDAMAQVIEFYVPNRFRKKVKWVPETQRGKVIAFPADVKKSA |
| Ga0210390_102526222 | 3300021474 | Soil | MAMAQVIKFYVPDRFRKKIKWVPASLRGKLIEFPAAPVKKTA |
| Ga0210390_111422891 | 3300021474 | Soil | IEFYVPEPFPRKVKWVPSEQRGRVIEFPKSVKKSA |
| Ga0210402_111073101 | 3300021478 | Soil | GIGSEDAMAQVIEFYVPNRFRKKVKWVPETQRGKVIAFPADVKKSA |
| Ga0210409_101281243 | 3300021559 | Soil | MAQVIEYYIPSRFRKKVKWVPETQRGKVIEFPADIKKSA |
| Ga0210409_102579722 | 3300021559 | Soil | MAPVIEFYIPSRFHERVKWMPQDQRGKLLAFSAEIRKSA |
| Ga0210409_102681441 | 3300021559 | Soil | MVVVIEFYIPQRFQKHVKWIPPTERGKVLEFPAQIQKSA |
| Ga0126371_1000086612 | 3300021560 | Tropical Forest Soil | MAKVIEFYVPDRYKRKVKWIPAELRGKVIEFPVPIRKSA |
| Ga0126371_100953453 | 3300021560 | Tropical Forest Soil | MAQVIEFYIPSRYHKESKWVPKEGRGKVLEFPMAVKKTA |
| Ga0126371_119201551 | 3300021560 | Tropical Forest Soil | MAKVIEFYVPERFRKKVKWVPATQRGKVIRFPVDVKKSA |
| Ga0212123_10000194134 | 3300022557 | Iron-Sulfur Acid Spring | MARIIEFYIPARFHKAMKWIPTTERGKVLEFPPEVRKSA |
| Ga0212123_100089629 | 3300022557 | Iron-Sulfur Acid Spring | MAKVIEFYIPARFRKQVKWTPPAERGKVLEFVVEMRKSA |
| Ga0212123_100567604 | 3300022557 | Iron-Sulfur Acid Spring | MAKVIEFYIPARFHKPVKWTPPAERGKVLEFVVEMRKSA |
| Ga0242654_100384273 | 3300022726 | Soil | DAMARIIEFYIPARFHKAMKWIPPTDRGKVLEFPAEVRKSA |
| Ga0242654_103937742 | 3300022726 | Soil | LDRRMAMAKVIEFYVPDRFRKKVKWVPLEQRGKVLAFPEPVKKTA |
| Ga0222622_104574261 | 3300022756 | Groundwater Sediment | DMAQVIEFYIPSRFHKKVKWIPPEQRGKVIDFPAEIRKSA |
| Ga0179589_104688711 | 3300024288 | Vadose Zone Soil | MAQVIEFYIPPRFRKPVKWIPLTERGKVLEFPAEIRKTA |
| Ga0207684_100135363 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MAQVIEFYIPARFHKKVKWIPPEQRGKVIDFPVEIRKSA |
| Ga0207646_1000370214 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MASLIKFYIPPSFHKLVKWIPPAGRGKVLEFPAEIRKSA |
| Ga0207646_100282742 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MAQVIEFYVPAKFHKKVKWVPPEQRGRMIEFPAKIKKSA |
| Ga0207646_100876873 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MAQVIEFYIPARFHKKLKWVPPEERGKVIEFPAEVRKSA |
| Ga0207646_104958622 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MVMARVIEFYIPVSFHKKVKWVPPEQRGKVIEFPAEERKSA |
| Ga0207700_101560122 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MAQVIQFYIPDRFRKKVRWVPSEQRGKVIEFPVEVKKSA |
| Ga0209235_10605761 | 3300026296 | Grasslands Soil | MAQVIEFYIPARFHKKVKWVPPEERGKVIEFPAEVRKSA |
| Ga0209237_10135863 | 3300026297 | Grasslands Soil | MAMAQVIEFYIPARFHKRVKWLPPEQRGKVIEFPAAIRKSA |
| Ga0209236_10150154 | 3300026298 | Grasslands Soil | MAQVIEFYIPARFHKKVKWVPPEERGKVIEFPAEVR |
| Ga0209236_13108451 | 3300026298 | Grasslands Soil | MAQVIEFYVPAKFHKKVKWVPPEQRGRMIEFPAEIKKSA |
| Ga0209055_10367793 | 3300026309 | Soil | MAQVIEFYIPASFHKKVKWIPPEQRGKVIDFPAEIRKSA |
| Ga0209471_10103466 | 3300026318 | Soil | MAQVIEFYIPARFHKKVKWKVKWIPPEQRGKVIDFPVEIRKSA |
| Ga0209687_12541111 | 3300026322 | Soil | MAMAPVIKFYIPPSFHKLVKWIPPAGRGKVLEFPAEIRKSA |
| Ga0209152_100136186 | 3300026325 | Soil | MAPVIKFYIPPSFHKLVKWIPPAGRGKVLEFPAEIRKSA |
| Ga0209375_12631851 | 3300026329 | Soil | IEFYIPARFHKKVKWLPPEQRGKVIEFPAAIRKSA |
| Ga0209803_10266293 | 3300026332 | Soil | MAQVIEFYVPARFHRKVKWVPSEQRGKVIEFPSRIRKSA |
| Ga0257157_10524112 | 3300026496 | Soil | MARIIEFYIPARFHKPVKWMPLDERGKVLEFPAEVRKSA |
| Ga0257157_10606142 | 3300026496 | Soil | MARIIEFYIPARFHKPVKWMPLAERGKMLEFPAEVRKSA |
| Ga0209808_12657652 | 3300026523 | Soil | MAQVIEFYIPARFHKRVKWLPPEQRGKVIEFPAAIRKSA |
| Ga0209161_100493751 | 3300026548 | Soil | PVIKFYIPPSFHKLVKWIPPAGRGKVLEFPAEIRKSA |
| Ga0209161_105858981 | 3300026548 | Soil | ESKSEDVMAPVIEFYIPTGFHKRVKWIPLAQRGKVVEFPVETRKMA |
| Ga0209648_100508732 | 3300026551 | Grasslands Soil | MARIIEFYIPTRFQKAMKWIPPTERGKVLEFPAEVRKSA |
| Ga0209577_103002431 | 3300026552 | Soil | TLEDAMAKVIEFHIPMRFHKQVKWIPPAQRGKVLEFPAEVRKSA |
| Ga0179587_104982551 | 3300026557 | Vadose Zone Soil | QVIEFYIPSRFRKKVKWVPKADRGKVIEFPVEIKKSA |
| Ga0208366_10131692 | 3300027073 | Forest Soil | MVMAKVIEFYIPSRFQKRVKWIPTEQRGRVIEFPVEIKKSA |
| Ga0209418_10569612 | 3300027371 | Forest Soil | MAKVIEFYVPDRYKRKVKWIPADLRGKVIEFPAPIRKSA |
| Ga0209734_10401912 | 3300027535 | Forest Soil | MARIIEFYIPARFHKAMKWNPPTERGKVLEFPAEVRKSA |
| Ga0209735_10031303 | 3300027562 | Forest Soil | MARIIEFYIPARFHKAMKWIPPTERGKVLDFPAEVRKSA |
| Ga0209735_10244082 | 3300027562 | Forest Soil | MARIIEFYIPARFHKPVKWMPPAERGKVLEFPAEVRKSA |
| Ga0209733_10050773 | 3300027591 | Forest Soil | MARIIEFYIPRFHKPVKWMPPAERGKVLEFPAEVRKSA |
| Ga0209076_10575702 | 3300027643 | Vadose Zone Soil | MAQVIEFYIPSRFRKKVKWVPETQRGKVIEFPADIKKSA |
| Ga0209117_10680541 | 3300027645 | Forest Soil | MAQVIEFYIPARFHKQVKWVPPAERGKVLEFVVEMRKSA |
| Ga0208981_11500202 | 3300027669 | Forest Soil | MARIIEFYIPARFHKPVKWITPAERGKVLEFPAEVRKSA |
| Ga0209118_10303002 | 3300027674 | Forest Soil | MAKVIEFYIPARFHKSVKWTPPAERGKVLEFVVEMRKSA |
| Ga0209581_1000100181 | 3300027706 | Surface Soil | MALVIEFYVPDRFRKKVRWTPPTQRGKVIKFPAAQKNTA |
| Ga0208989_100494882 | 3300027738 | Forest Soil | MARIIEFYIPARFHKPVKWITPAERGKVLEFPAEIRKSA |
| Ga0209580_103448202 | 3300027842 | Surface Soil | AMAQVIQFYIPDRFRKKVRWVPSEQRGKVIEFPAEVKKSA |
| Ga0209580_104050491 | 3300027842 | Surface Soil | MAMAQVIEFYVPDRFRKKVKWVPASLRGKVIEFPATPVKKTA |
| Ga0209180_107679141 | 3300027846 | Vadose Zone Soil | MGALLLDRRRAMAQVIEFYIPARFHKKVKWVPPEERGKVIEFPAEVRKSA |
| Ga0209701_100429052 | 3300027862 | Vadose Zone Soil | MAQVIEFYIPARFHKRVKWVPPEQRGKVIEFPSEVRKSA |
| Ga0209579_100340453 | 3300027869 | Surface Soil | MAQVIEFYVPDRFRKKVKWVPASLRGKVIEFPATPVKKTA |
| Ga0209579_100606061 | 3300027869 | Surface Soil | MAKVIEFYVPSRFRKKVKWTPPEERGRIIDFQPETRKSA |
| Ga0209579_103598022 | 3300027869 | Surface Soil | MAQVIEFYVPVRFQKRMSKWVPQEQRGKVLEFPAAIKKTA |
| Ga0209465_103451812 | 3300027874 | Tropical Forest Soil | MAQVIEFYVPDRFHKKVKWVPPEKRGKVLEFPAEVKKTA |
| Ga0209283_100017376 | 3300027875 | Vadose Zone Soil | MAQVIEFYVPARFHKKVKWVPPEQRGKMIEFRAEIKKSA |
| Ga0209283_100856942 | 3300027875 | Vadose Zone Soil | MAQVIEFYIPARFHKPVKWIPAAERGKVLEFPAAVRKSA |
| Ga0209590_106643912 | 3300027882 | Vadose Zone Soil | MARIIEFYIPARFHKLVKWMAPAERGKVLEFPAEI |
| Ga0209068_103359582 | 3300027894 | Watersheds | MAQVIEFYVPNRFRKKVKWLPATERGKVIEFPADIKKSA |
| Ga0209488_100150803 | 3300027903 | Vadose Zone Soil | MAQVIEFYIPPRFRKPVKWVPSAQRGKVLEFPAEIQKSA |
| Ga0209488_100259052 | 3300027903 | Vadose Zone Soil | MAQVIEFYIPARFHKQMKWVPPAERCKVLEFPAAVRKSA |
| Ga0209488_100734733 | 3300027903 | Vadose Zone Soil | MANVIEFYIPTRFHRREKLIPLAQRGKVLEFPAELRKSA |
| Ga0209583_102504162 | 3300027910 | Watersheds | MAQVIEFYVPSRFRKKVKWVPETQRGKLIEFPADIKKSA |
| Ga0209698_1000110929 | 3300027911 | Watersheds | MAKVIEFYVPNRFRKKAKWVPETLRGKVIAFPADVKKSA |
| Ga0209698_101749702 | 3300027911 | Watersheds | MAQVIEFYVPNRFRKKVKWVPETQRGKVIAFPADIKKSA |
| Ga0209526_100236101 | 3300028047 | Forest Soil | DTSEDAMARIIEFYIPARFHKAMKWNPPTERGKVLEFPAEVRKSA |
| Ga0209526_106111932 | 3300028047 | Forest Soil | MAQVIEFYIPARFHRQVKWVPPAERGKVIEFPAAVRKSA |
| Ga0209526_106980292 | 3300028047 | Forest Soil | MARIIEFYIPARFHNPVKWMPPAEPGKVLEFPAEVRKSA |
| Ga0307504_100503271 | 3300028792 | Soil | MAQVIEFYVPDRFRKKKTRWVPLEQRGKVIEFPLPEKKTA |
| Ga0307504_103410662 | 3300028792 | Soil | LDRRMVMAQVIEFYIPARFKKKVKWVPSELRGKIVEFPVEVRKSA |
| Ga0307482_13132372 | 3300030730 | Hardwood Forest Soil | SDDVLRRMVMAKVIEFYIPARFHKPVKWTPPAERGKVLEFLVEIRKSA |
| Ga0307482_13259571 | 3300030730 | Hardwood Forest Soil | SDDVLRRMVMAKVIEFYIPARFHKPVKWTPPAERGKVLEFLLEIRKSA |
| Ga0073994_112896172 | 3300030991 | Soil | MTPVIEFYIPARFRKHAKWIPPAQRGKVIEFPAEIRKSA |
| Ga0073998_100542223 | 3300031023 | Soil | RIIEFYIPARFHKAMKWIPPTERGKVLEFPAEVRKSA |
| Ga0318541_100682692 | 3300031545 | Soil | MVMAKVIEFYVPDRFKKKVHWVPSAQRGKVIEFPVEVKKTA |
| Ga0318541_103163361 | 3300031545 | Soil | MAKIIEFYVPARFHKKVKWVAPADRGKVIEFFVPIRKTA |
| Ga0318574_107023611 | 3300031680 | Soil | MVMAKVIEFYVPDRFKKKVHWVPREQRGKVIEFPVEVKKTA |
| Ga0307474_101376183 | 3300031718 | Hardwood Forest Soil | MTPVIEFYIPARFHKHAKWIPPAQRGKVIEFPAKIRKSA |
| Ga0307474_101860812 | 3300031718 | Hardwood Forest Soil | MAKVIEFYIPARFHKPVKWTPPAERGKVLEFLVEVRKSA |
| Ga0307474_103840092 | 3300031718 | Hardwood Forest Soil | MAQVIEFYVPDRFRKKVRWVPPEQRGKVIEFPTEIK |
| Ga0307469_100504794 | 3300031720 | Hardwood Forest Soil | MAQVIEFYIPDRFRKKKVRWVPPEQRGKVIEFPSEIKRSA |
| Ga0307469_100600832 | 3300031720 | Hardwood Forest Soil | MAQVIEFYVPDRYKRKVKWTPAGLRGKVIEFPAPIRKSA |
| Ga0307469_101949381 | 3300031720 | Hardwood Forest Soil | MEDVMAPVIEFYIPSGFRKRVKWIPSVQRGRVLEFPAETRKSA |
| Ga0307469_105087681 | 3300031720 | Hardwood Forest Soil | SGSEDAMAQVIEFYIPSRFRKKVKWVPTTERGKVIEFPAEIKKSA |
| Ga0307468_1002278911 | 3300031740 | Hardwood Forest Soil | RVIEFYVPDRFRKKKVRWVPPEQRGKVIEFPSEIKRSA |
| Ga0307468_1011464011 | 3300031740 | Hardwood Forest Soil | MAQVIEFYIPDRFRKKKVRWVPPEQRGKVIEFPSEI |
| Ga0307477_103711192 | 3300031753 | Hardwood Forest Soil | MAKVIEFYVPNRFRKKAKWVPETQRGKVIAFPAEIKKSA |
| Ga0307475_100048758 | 3300031754 | Hardwood Forest Soil | MARVIEFYIPDRFRKKVRWVPPEQRGKVLEFPAEIKKSA |
| Ga0307475_101120112 | 3300031754 | Hardwood Forest Soil | MVMAKVIEFYIPARFHKPVKWTPPAERGKVLEFLVEIRKSA |
| Ga0307475_101385172 | 3300031754 | Hardwood Forest Soil | MAKVIEFYIPARFHKPVKWTPPAERGKVLEFLLEIRKSA |
| Ga0307475_105120792 | 3300031754 | Hardwood Forest Soil | MAKVIEFYVPNRFRKKAKWVPETLRGKVIAFPAEIKKSA |
| Ga0307475_105626642 | 3300031754 | Hardwood Forest Soil | MAQVIEFYVPDRFRKKIKWIPASLRGKLIEFPAAPVKKTA |
| Ga0318509_106077221 | 3300031768 | Soil | VIEFYVPDRFKKKVHWVPSAQRGKVIEFPVEVKKTA |
| Ga0318523_105529541 | 3300031798 | Soil | RMVMAKVIEFYVPDRFKKKVHWVPSAQRGKVIEFPVEVKKTA |
| Ga0307478_100174185 | 3300031823 | Hardwood Forest Soil | MAQVIKFYVPDRFRKKIKWIPASLRGKLIEFPAAPVKKTA |
| Ga0307478_106717402 | 3300031823 | Hardwood Forest Soil | MVMAKVIEFYIPARFHKPVKWTPPAERGKVLEFLLEIRKSA |
| Ga0307478_109047221 | 3300031823 | Hardwood Forest Soil | MAMAQVIEFYVPDRFRKKVKWVPASLRGKLIEFPAAPVKKTA |
| Ga0306925_107678371 | 3300031890 | Soil | MANVVEFYIPGRFRKTVKWTPPENRGKVIDFPVESKKPA |
| Ga0306923_104047712 | 3300031910 | Soil | MAKVIEFHIPVKFQKKVKWVPSEERGRLIEFPIVIKKSA |
| Ga0306921_104981121 | 3300031912 | Soil | MATVIEFYIPTRFRKKVKWVPVTERGKLIEFPTEIKKSA |
| Ga0310912_111185131 | 3300031941 | Soil | MATVIEFYIPTRFRKKVKWVPVTERGKLIEFPTEIKK |
| Ga0310909_100182834 | 3300031947 | Soil | MVMAKVIEFHIPVKFQKKVKWVPSEERGRLIEFPIVIKKSA |
| Ga0306926_103562002 | 3300031954 | Soil | MAQVIEFYIPSSYQKKSKWVPKEARGKVLEFPVAVKKTA |
| Ga0307479_1000742911 | 3300031962 | Hardwood Forest Soil | MAKVIEFYVPNRFRKKAKWVPETQRGKVITFPAEVKKSA |
| Ga0307479_102479793 | 3300031962 | Hardwood Forest Soil | MAKVIEFHIPARFHKQMKWIPQAQRGKVLEFPAEVRKSA |
| Ga0306922_107039361 | 3300032001 | Soil | MATVIEFYIPTRFRKKVKWVPRTERGKLIEFPAEI |
| Ga0306924_122609422 | 3300032076 | Soil | EDAMATVIEFYIPTRFRKKVKWVPLTERGKLIEFPTEIKKSA |
| Ga0307470_101219912 | 3300032174 | Hardwood Forest Soil | MAQVIEFYIPSRFRKKVKWVPTTERGKVIEFPAEIKKSA |
| Ga0307470_103018901 | 3300032174 | Hardwood Forest Soil | MAQVIEFYVPDRYKRKVKWTPAELRGKVIEFPAPIRKSA |
| Ga0307471_1000103268 | 3300032180 | Hardwood Forest Soil | MAQVIEFYIPSRFRKKLKWVPATERGKVIEFPADIKKSA |
| Ga0307471_1000144131 | 3300032180 | Hardwood Forest Soil | MARVIEFYIPDRFRKKVRWVPLEQRGKVLEFPAEIKKSA |
| Ga0307471_1003314652 | 3300032180 | Hardwood Forest Soil | MAVVIEFYIPQRFQKPVKWIPPTGRSKVLEFPAQIQKSA |
| Ga0307471_1005791974 | 3300032180 | Hardwood Forest Soil | MAKVIEFHIPARFHKQMKWIPQAQRGKVLEFPAEVR |
| Ga0307471_1011548682 | 3300032180 | Hardwood Forest Soil | SDRRADMAQVIEFYIPARFHKKVKWIPPEQRGKVIDFPTEIRKSA |
| Ga0307472_1020821291 | 3300032205 | Hardwood Forest Soil | MAQVIEFYIPARFHKKVKWLPPEQRGKIIEFPTAIRKS |
| Ga0306920_10000064426 | 3300032261 | Soil | MAKVIEFYVPDRFKKKVHWVPSAQRGKVIEFPVEVKKTA |
| Ga0306920_1001971561 | 3300032261 | Soil | MATVIEFYIPTRFRKKVKWVPRTERGKLIEFPAEIKKSA |
| Ga0306920_1009854382 | 3300032261 | Soil | MAKVIEFYVPTRFHKKVKWTPPEDRGRVLIFHGETRKSA |
| Ga0335085_100068207 | 3300032770 | Soil | MAQVIEFYIPARFHKNSKWVPQEQRGKVLDFPAPEKKTA |
| Ga0335085_109139412 | 3300032770 | Soil | QVIEFYIPERYKKKVKWVPSENRGKVLSFPIDIKKTA |
| Ga0335085_119991351 | 3300032770 | Soil | MAKVIEFYVPDRFRKTGPWVPPEQRGKVIEFPSLQKKSA |
| Ga0335079_100083243 | 3300032783 | Soil | MAKVIEFYVPDRFRKKVRWVPQEYRGKVIEFPAEVRKSA |
| Ga0335079_101205823 | 3300032783 | Soil | MAKVIAFYIPAGFQRKSKWLPLDQRGKVIEFPAEIKKSA |
| Ga0335080_100507692 | 3300032828 | Soil | MAKVIAFYIPTRFQRKMKWLPLEQRGKVIEFPAEIKKSA |
| Ga0335080_102240792 | 3300032828 | Soil | MAQVIEFYIPERHKKKVKWVPAENRGKVLSFPIDIKKTA |
| Ga0335070_100120739 | 3300032829 | Soil | MAKVIEFYIPSRFHKKVKWVPQDLRGKVIEFPAEVRKSA |
| Ga0335070_100156235 | 3300032829 | Soil | MAKVIEFYIPARFHKKVKWVPQDLRGKVIEFPAEIRKSA |
| Ga0335070_101905922 | 3300032829 | Soil | MARVIEFYIPERYKKNTKWVPSENRGKLIEFRIDFKKSA |
| Ga0335081_1000813313 | 3300032892 | Soil | MAKVIEFYVPARFHRKVRWLPSEQRGKVIEFPAETRKSA |
| Ga0335081_105657643 | 3300032892 | Soil | IAFYIPAGFQRKSKWLPLDQRGKVIEFPAEIKKSA |
| Ga0335081_112723602 | 3300032892 | Soil | PALGSEGGMAKVIEFYVPARFHPKVRWLPSELRGKVIEFPAENRKSA |
| Ga0335084_104462901 | 3300033004 | Soil | MAKVIEFYVPDRFRKTGPWVPPEQRGKVIEFPSPQKKSA |
| Ga0335077_101401385 | 3300033158 | Soil | EGGMAKVIEFYVPARFHRKVRWLPSEQRGKVIEFPAETRKSA |
| Ga0326726_112971502 | 3300033433 | Peat Soil | MAKVIEFYVPDRFRKKVKWVPPQLRGKVIELPVQTRKS |
| Ga0326723_0367316_11_130 | 3300034090 | Peat Soil | MAKVIEFYVPDRFRKKVKWVPPQLRGKVIELPVQTRKSA |
| ⦗Top⦘ |