


| Basic Information | |
|---|---|
| Family ID | F004297 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 445 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MLRKLLWTGLYAGLGAGATLAARRAASRIWRLATGEEPPTKK |
| Number of Associated Samples | 272 |
| Number of Associated Scaffolds | 445 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 55.33 % |
| % of genes near scaffold ends (potentially truncated) | 33.71 % |
| % of genes from short scaffolds (< 2000 bps) | 85.84 % |
| Associated GOLD sequencing projects | 249 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.58 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (89.888 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (13.258 % of family members) |
| Environment Ontology (ENVO) | Unclassified (22.247 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (48.764 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 47.14% β-sheet: 0.00% Coil/Unstructured: 52.86% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.58 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 445 Family Scaffolds |
|---|---|---|
| PF07332 | Phage_holin_3_6 | 28.54 |
| PF01425 | Amidase | 11.91 |
| PF01316 | Arg_repressor | 10.56 |
| PF02863 | Arg_repressor_C | 9.21 |
| PF11950 | DUF3467 | 3.60 |
| PF12277 | DUF3618 | 3.37 |
| PF09939 | DUF2171 | 2.92 |
| PF03631 | Virul_fac_BrkB | 2.25 |
| PF05239 | PRC | 1.57 |
| PF05532 | CsbD | 0.90 |
| PF10944 | DUF2630 | 0.45 |
| PF02817 | E3_binding | 0.45 |
| PF12847 | Methyltransf_18 | 0.22 |
| PF13561 | adh_short_C2 | 0.22 |
| PF06224 | HTH_42 | 0.22 |
| PF00583 | Acetyltransf_1 | 0.22 |
| PF00571 | CBS | 0.22 |
| PF03473 | MOSC | 0.22 |
| PF13280 | WYL | 0.22 |
| PF14490 | HHH_4 | 0.22 |
| PF00589 | Phage_integrase | 0.22 |
| PF01643 | Acyl-ACP_TE | 0.22 |
| PF03861 | ANTAR | 0.22 |
| PF03147 | FDX-ACB | 0.22 |
| PF02779 | Transket_pyr | 0.22 |
| PF02645 | DegV | 0.22 |
| PF05957 | DUF883 | 0.22 |
| PF12911 | OppC_N | 0.22 |
| PF05157 | T2SSE_N | 0.22 |
| PF02912 | Phe_tRNA-synt_N | 0.22 |
| PF06772 | LtrA | 0.22 |
| PF06835 | LptC | 0.22 |
| COG ID | Name | Functional Category | % Frequency in 445 Family Scaffolds |
|---|---|---|---|
| COG1438 | Arginine repressor | Transcription [K] | 19.78 |
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 11.91 |
| COG1295 | Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase) | Function unknown [S] | 2.25 |
| COG3237 | Uncharacterized conserved protein YjbJ, UPF0337 family | Function unknown [S] | 0.90 |
| COG0508 | Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component | Energy production and conversion [C] | 0.45 |
| COG0016 | Phenylalanyl-tRNA synthetase alpha subunit | Translation, ribosomal structure and biogenesis [J] | 0.22 |
| COG0072 | Phenylalanyl-tRNA synthetase beta subunit | Translation, ribosomal structure and biogenesis [J] | 0.22 |
| COG3214 | DNA glycosylase YcaQ, repair of DNA interstrand crosslinks | Replication, recombination and repair [L] | 0.22 |
| COG3707 | Two-component response regulator, AmiR/NasT family, consists of REC and RNA-binding antiterminator (ANTAR) domains | Transcription [K] | 0.22 |
| COG3884 | Acyl-ACP thioesterase | Lipid transport and metabolism [I] | 0.22 |
| COG4292 | Low temperature requirement protein LtrA (function unknown) | Function unknown [S] | 0.22 |
| COG4575 | Membrane-anchored ribosome-binding protein ElaB, inhibits growth in stationary phase, YqjD/DUF883 family | Translation, ribosomal structure and biogenesis [J] | 0.22 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 89.89 % |
| Unclassified | root | N/A | 10.11 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2065487018|GPINP_F5MS3JC02IKP8I | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 516 | Open in IMG/M |
| 2067725004|GPKC_F5OHE3B02FKINU | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 529 | Open in IMG/M |
| 2070309009|GPKNP_GG3DY5402H7DSX | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 518 | Open in IMG/M |
| 2119805009|FNTS007_GKN1E7E02INH56 | Not Available | 525 | Open in IMG/M |
| 2170459019|G14TP7Y02HLK47 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 696 | Open in IMG/M |
| 3300000033|ICChiseqgaiiDRAFT_c0517392 | Not Available | 574 | Open in IMG/M |
| 3300000363|ICChiseqgaiiFebDRAFT_14232090 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 890 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_104207836 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 505 | Open in IMG/M |
| 3300000858|JGI10213J12805_10135075 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 690 | Open in IMG/M |
| 3300000956|JGI10216J12902_100102376 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 845 | Open in IMG/M |
| 3300000956|JGI10216J12902_101412899 | All Organisms → cellular organisms → Bacteria | 1629 | Open in IMG/M |
| 3300000956|JGI10216J12902_102843444 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 664 | Open in IMG/M |
| 3300000956|JGI10216J12902_103673482 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1577 | Open in IMG/M |
| 3300000956|JGI10216J12902_105885890 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1031 | Open in IMG/M |
| 3300001431|F14TB_103889022 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 512 | Open in IMG/M |
| 3300001535|A3PFW1_10583869 | All Organisms → cellular organisms → Bacteria | 2562 | Open in IMG/M |
| 3300002568|C688J35102_118114895 | Not Available | 531 | Open in IMG/M |
| 3300002568|C688J35102_118507061 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 566 | Open in IMG/M |
| 3300002568|C688J35102_118841933 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 603 | Open in IMG/M |
| 3300002568|C688J35102_120037471 | All Organisms → cellular organisms → Bacteria | 855 | Open in IMG/M |
| 3300002568|C688J35102_120100005 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 879 | Open in IMG/M |
| 3300002568|C688J35102_120985440 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 6180 | Open in IMG/M |
| 3300003321|soilH1_10138931 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2836 | Open in IMG/M |
| 3300003321|soilH1_10254406 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1107 | Open in IMG/M |
| 3300003324|soilH2_10233994 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1113 | Open in IMG/M |
| 3300004081|Ga0063454_100023994 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2001 | Open in IMG/M |
| 3300004081|Ga0063454_100731076 | All Organisms → cellular organisms → Bacteria | 752 | Open in IMG/M |
| 3300004081|Ga0063454_100767180 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
| 3300004081|Ga0063454_101149705 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 638 | Open in IMG/M |
| 3300004081|Ga0063454_101159087 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 636 | Open in IMG/M |
| 3300004081|Ga0063454_101188446 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300004081|Ga0063454_101547801 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300004114|Ga0062593_100617099 | All Organisms → cellular organisms → Bacteria | 1038 | Open in IMG/M |
| 3300004114|Ga0062593_101215396 | All Organisms → cellular organisms → Bacteria | 792 | Open in IMG/M |
| 3300004114|Ga0062593_102641566 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 571 | Open in IMG/M |
| 3300004153|Ga0063455_100359338 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 835 | Open in IMG/M |
| 3300004157|Ga0062590_101424187 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 691 | Open in IMG/M |
| 3300004463|Ga0063356_101680478 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 948 | Open in IMG/M |
| 3300004479|Ga0062595_100007887 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3286 | Open in IMG/M |
| 3300004479|Ga0062595_100411563 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 974 | Open in IMG/M |
| 3300004479|Ga0062595_100545603 | All Organisms → cellular organisms → Bacteria | 886 | Open in IMG/M |
| 3300004479|Ga0062595_101640583 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 602 | Open in IMG/M |
| 3300004480|Ga0062592_100712445 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 875 | Open in IMG/M |
| 3300004643|Ga0062591_100056451 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2280 | Open in IMG/M |
| 3300005093|Ga0062594_100033314 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales | 2403 | Open in IMG/M |
| 3300005093|Ga0062594_100742819 | All Organisms → cellular organisms → Bacteria | 895 | Open in IMG/M |
| 3300005093|Ga0062594_101889654 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300005093|Ga0062594_102436606 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300005166|Ga0066674_10375921 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
| 3300005166|Ga0066674_10567132 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300005171|Ga0066677_10205461 | All Organisms → cellular organisms → Bacteria | 1104 | Open in IMG/M |
| 3300005176|Ga0066679_10042461 | All Organisms → cellular organisms → Bacteria | 2577 | Open in IMG/M |
| 3300005179|Ga0066684_10040566 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2609 | Open in IMG/M |
| 3300005179|Ga0066684_10335532 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1009 | Open in IMG/M |
| 3300005180|Ga0066685_10243289 | All Organisms → cellular organisms → Bacteria | 1240 | Open in IMG/M |
| 3300005181|Ga0066678_10703060 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300005184|Ga0066671_10431573 | All Organisms → cellular organisms → Bacteria | 845 | Open in IMG/M |
| 3300005187|Ga0066675_10305213 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1153 | Open in IMG/M |
| 3300005327|Ga0070658_10037672 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 3899 | Open in IMG/M |
| 3300005327|Ga0070658_10249874 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1504 | Open in IMG/M |
| 3300005327|Ga0070658_10928000 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 757 | Open in IMG/M |
| 3300005327|Ga0070658_11459001 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 593 | Open in IMG/M |
| 3300005329|Ga0070683_100197242 | All Organisms → cellular organisms → Bacteria | 1912 | Open in IMG/M |
| 3300005329|Ga0070683_101869921 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300005332|Ga0066388_100819696 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1520 | Open in IMG/M |
| 3300005332|Ga0066388_101762654 | All Organisms → cellular organisms → Bacteria | 1099 | Open in IMG/M |
| 3300005332|Ga0066388_102206247 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 994 | Open in IMG/M |
| 3300005336|Ga0070680_100264087 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1457 | Open in IMG/M |
| 3300005338|Ga0068868_101414394 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300005339|Ga0070660_100459750 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1057 | Open in IMG/M |
| 3300005339|Ga0070660_101276736 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300005339|Ga0070660_101647263 | Not Available | 546 | Open in IMG/M |
| 3300005341|Ga0070691_10087602 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1531 | Open in IMG/M |
| 3300005344|Ga0070661_100051932 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3001 | Open in IMG/M |
| 3300005345|Ga0070692_11031180 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 577 | Open in IMG/M |
| 3300005355|Ga0070671_100069272 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2942 | Open in IMG/M |
| 3300005355|Ga0070671_100450834 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1104 | Open in IMG/M |
| 3300005435|Ga0070714_100057537 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 3329 | Open in IMG/M |
| 3300005435|Ga0070714_102292141 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300005436|Ga0070713_100460202 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1196 | Open in IMG/M |
| 3300005439|Ga0070711_100223110 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1466 | Open in IMG/M |
| 3300005439|Ga0070711_100978878 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 725 | Open in IMG/M |
| 3300005441|Ga0070700_100846976 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 740 | Open in IMG/M |
| 3300005444|Ga0070694_100855013 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
| 3300005444|Ga0070694_100896092 | All Organisms → cellular organisms → Bacteria | 732 | Open in IMG/M |
| 3300005446|Ga0066686_10748698 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300005458|Ga0070681_10591179 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1024 | Open in IMG/M |
| 3300005466|Ga0070685_10539730 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 831 | Open in IMG/M |
| 3300005471|Ga0070698_100060447 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3824 | Open in IMG/M |
| 3300005529|Ga0070741_10747266 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 858 | Open in IMG/M |
| 3300005532|Ga0070739_10000035 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 307957 | Open in IMG/M |
| 3300005546|Ga0070696_100132308 | All Organisms → cellular organisms → Bacteria | 1816 | Open in IMG/M |
| 3300005547|Ga0070693_100589334 | All Organisms → cellular organisms → Bacteria | 801 | Open in IMG/M |
| 3300005549|Ga0070704_100627378 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 947 | Open in IMG/M |
| 3300005556|Ga0066707_10693603 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 639 | Open in IMG/M |
| 3300005558|Ga0066698_10844194 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 590 | Open in IMG/M |
| 3300005561|Ga0066699_10329794 | All Organisms → cellular organisms → Bacteria | 1089 | Open in IMG/M |
| 3300005563|Ga0068855_101035710 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 861 | Open in IMG/M |
| 3300005564|Ga0070664_100139511 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2134 | Open in IMG/M |
| 3300005564|Ga0070664_100531780 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1086 | Open in IMG/M |
| 3300005566|Ga0066693_10058403 | All Organisms → cellular organisms → Bacteria | 1307 | Open in IMG/M |
| 3300005576|Ga0066708_10435724 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 841 | Open in IMG/M |
| 3300005576|Ga0066708_10864452 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300005587|Ga0066654_10163160 | All Organisms → cellular organisms → Bacteria | 1139 | Open in IMG/M |
| 3300005713|Ga0066905_100726848 | All Organisms → cellular organisms → Bacteria | 854 | Open in IMG/M |
| 3300005713|Ga0066905_102209017 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 513 | Open in IMG/M |
| 3300005841|Ga0068863_102202450 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 561 | Open in IMG/M |
| 3300005981|Ga0081538_10119154 | All Organisms → cellular organisms → Bacteria | 1273 | Open in IMG/M |
| 3300006028|Ga0070717_10130445 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2161 | Open in IMG/M |
| 3300006046|Ga0066652_100085471 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2502 | Open in IMG/M |
| 3300006046|Ga0066652_100251611 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1547 | Open in IMG/M |
| 3300006046|Ga0066652_100800283 | All Organisms → cellular organisms → Bacteria | 901 | Open in IMG/M |
| 3300006051|Ga0075364_10220200 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1288 | Open in IMG/M |
| 3300006058|Ga0075432_10082809 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1165 | Open in IMG/M |
| 3300006791|Ga0066653_10135109 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1178 | Open in IMG/M |
| 3300006800|Ga0066660_10311972 | All Organisms → cellular organisms → Bacteria | 1261 | Open in IMG/M |
| 3300006800|Ga0066660_10528964 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 990 | Open in IMG/M |
| 3300006800|Ga0066660_11246043 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300006800|Ga0066660_11569620 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300006844|Ga0075428_101218339 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 793 | Open in IMG/M |
| 3300006844|Ga0075428_102168612 | Not Available | 574 | Open in IMG/M |
| 3300006845|Ga0075421_100545543 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1371 | Open in IMG/M |
| 3300006854|Ga0075425_100005968 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 12709 | Open in IMG/M |
| 3300006854|Ga0075425_102248822 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300006876|Ga0079217_10003465 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4536 | Open in IMG/M |
| 3300006894|Ga0079215_11113240 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 593 | Open in IMG/M |
| 3300006914|Ga0075436_100806399 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
| 3300006954|Ga0079219_10305383 | All Organisms → cellular organisms → Bacteria | 989 | Open in IMG/M |
| 3300006954|Ga0079219_10492149 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 855 | Open in IMG/M |
| 3300006969|Ga0075419_11336591 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 533 | Open in IMG/M |
| 3300007004|Ga0079218_11719024 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 697 | Open in IMG/M |
| 3300007740|Ga0104326_130344 | All Organisms → cellular organisms → Bacteria | 2649 | Open in IMG/M |
| 3300009012|Ga0066710_100183178 | All Organisms → cellular organisms → Bacteria | 2961 | Open in IMG/M |
| 3300009012|Ga0066710_100647547 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1607 | Open in IMG/M |
| 3300009012|Ga0066710_103281965 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 619 | Open in IMG/M |
| 3300009093|Ga0105240_11077762 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 856 | Open in IMG/M |
| 3300009093|Ga0105240_11895272 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 620 | Open in IMG/M |
| 3300009094|Ga0111539_11060085 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 942 | Open in IMG/M |
| 3300009094|Ga0111539_11815831 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 707 | Open in IMG/M |
| 3300009137|Ga0066709_100436983 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1826 | Open in IMG/M |
| 3300009137|Ga0066709_100805429 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1361 | Open in IMG/M |
| 3300009137|Ga0066709_102491438 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 698 | Open in IMG/M |
| 3300009137|Ga0066709_103269711 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 590 | Open in IMG/M |
| 3300009147|Ga0114129_10423799 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1750 | Open in IMG/M |
| 3300009147|Ga0114129_10571505 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1468 | Open in IMG/M |
| 3300009147|Ga0114129_10883979 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1133 | Open in IMG/M |
| 3300009148|Ga0105243_10576295 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1080 | Open in IMG/M |
| 3300009162|Ga0075423_11054236 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 865 | Open in IMG/M |
| 3300009176|Ga0105242_12955573 | Not Available | 526 | Open in IMG/M |
| 3300009553|Ga0105249_12085536 | Not Available | 640 | Open in IMG/M |
| 3300009789|Ga0126307_10031723 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4066 | Open in IMG/M |
| 3300009789|Ga0126307_10360484 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1171 | Open in IMG/M |
| 3300009789|Ga0126307_10382380 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1135 | Open in IMG/M |
| 3300009836|Ga0105068_1075854 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 633 | Open in IMG/M |
| 3300009840|Ga0126313_10000181 | All Organisms → cellular organisms → Bacteria | 27310 | Open in IMG/M |
| 3300009840|Ga0126313_11743775 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 520 | Open in IMG/M |
| 3300010036|Ga0126305_10007506 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 5336 | Open in IMG/M |
| 3300010036|Ga0126305_10287553 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1065 | Open in IMG/M |
| 3300010036|Ga0126305_10931738 | Not Available | 594 | Open in IMG/M |
| 3300010037|Ga0126304_10056393 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2398 | Open in IMG/M |
| 3300010039|Ga0126309_10059037 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1863 | Open in IMG/M |
| 3300010039|Ga0126309_10086495 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1586 | Open in IMG/M |
| 3300010039|Ga0126309_10107763 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1445 | Open in IMG/M |
| 3300010039|Ga0126309_10450545 | Not Available | 781 | Open in IMG/M |
| 3300010039|Ga0126309_10579745 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 703 | Open in IMG/M |
| 3300010039|Ga0126309_10760834 | Not Available | 628 | Open in IMG/M |
| 3300010039|Ga0126309_11207979 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 520 | Open in IMG/M |
| 3300010040|Ga0126308_10019396 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3639 | Open in IMG/M |
| 3300010040|Ga0126308_10251498 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 1149 | Open in IMG/M |
| 3300010040|Ga0126308_10555516 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 780 | Open in IMG/M |
| 3300010041|Ga0126312_10187433 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1444 | Open in IMG/M |
| 3300010041|Ga0126312_10247279 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1252 | Open in IMG/M |
| 3300010042|Ga0126314_10116435 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1833 | Open in IMG/M |
| 3300010042|Ga0126314_10461924 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 919 | Open in IMG/M |
| 3300010043|Ga0126380_10700647 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 814 | Open in IMG/M |
| 3300010044|Ga0126310_10881280 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 695 | Open in IMG/M |
| 3300010044|Ga0126310_10993633 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 660 | Open in IMG/M |
| 3300010044|Ga0126310_11166141 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 616 | Open in IMG/M |
| 3300010045|Ga0126311_10403447 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1052 | Open in IMG/M |
| 3300010045|Ga0126311_11746300 | Not Available | 526 | Open in IMG/M |
| 3300010145|Ga0126321_1017244 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 530 | Open in IMG/M |
| 3300010145|Ga0126321_1240252 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 513 | Open in IMG/M |
| 3300010145|Ga0126321_1284774 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1186 | Open in IMG/M |
| 3300010145|Ga0126321_1349740 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1635 | Open in IMG/M |
| 3300010145|Ga0126321_1392815 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 908 | Open in IMG/M |
| 3300010152|Ga0126318_10053303 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 676 | Open in IMG/M |
| 3300010152|Ga0126318_10062929 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1038 | Open in IMG/M |
| 3300010152|Ga0126318_10181565 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 592 | Open in IMG/M |
| 3300010152|Ga0126318_10183973 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1113 | Open in IMG/M |
| 3300010152|Ga0126318_10185315 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 998 | Open in IMG/M |
| 3300010152|Ga0126318_10435264 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 617 | Open in IMG/M |
| 3300010152|Ga0126318_10481866 | Not Available | 505 | Open in IMG/M |
| 3300010152|Ga0126318_11077650 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 689 | Open in IMG/M |
| 3300010166|Ga0126306_10525573 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 938 | Open in IMG/M |
| 3300010321|Ga0134067_10307154 | Not Available | 613 | Open in IMG/M |
| 3300010322|Ga0134084_10408437 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300010325|Ga0134064_10375164 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 562 | Open in IMG/M |
| 3300010329|Ga0134111_10134545 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 970 | Open in IMG/M |
| 3300010337|Ga0134062_10511667 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 605 | Open in IMG/M |
| 3300010362|Ga0126377_10309817 | Not Available | 1560 | Open in IMG/M |
| 3300010364|Ga0134066_10315130 | Not Available | 567 | Open in IMG/M |
| 3300010373|Ga0134128_10997772 | Not Available | 925 | Open in IMG/M |
| 3300010396|Ga0134126_10410857 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1571 | Open in IMG/M |
| 3300010396|Ga0134126_12160640 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 607 | Open in IMG/M |
| 3300010397|Ga0134124_11038509 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 833 | Open in IMG/M |
| 3300010399|Ga0134127_10808024 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 987 | Open in IMG/M |
| 3300010399|Ga0134127_12476487 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 599 | Open in IMG/M |
| 3300010403|Ga0134123_11043470 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 837 | Open in IMG/M |
| 3300011119|Ga0105246_10606661 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 947 | Open in IMG/M |
| 3300011996|Ga0120156_1009726 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2016 | Open in IMG/M |
| 3300012043|Ga0136631_10395833 | Not Available | 560 | Open in IMG/M |
| 3300012091|Ga0136625_1194443 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 690 | Open in IMG/M |
| 3300012092|Ga0136621_1015257 | All Organisms → cellular organisms → Bacteria | 3162 | Open in IMG/M |
| 3300012093|Ga0136632_10039390 | All Organisms → cellular organisms → Bacteria | 2161 | Open in IMG/M |
| 3300012200|Ga0137382_11281544 | Not Available | 518 | Open in IMG/M |
| 3300012204|Ga0137374_10766878 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 718 | Open in IMG/M |
| 3300012204|Ga0137374_10773011 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 715 | Open in IMG/M |
| 3300012206|Ga0137380_11197266 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 645 | Open in IMG/M |
| 3300012208|Ga0137376_10398931 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1195 | Open in IMG/M |
| 3300012212|Ga0150985_103575142 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 713 | Open in IMG/M |
| 3300012212|Ga0150985_104667583 | Not Available | 617 | Open in IMG/M |
| 3300012212|Ga0150985_104694904 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 566 | Open in IMG/M |
| 3300012212|Ga0150985_107725342 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 994 | Open in IMG/M |
| 3300012212|Ga0150985_107733372 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 879 | Open in IMG/M |
| 3300012212|Ga0150985_110764771 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1133 | Open in IMG/M |
| 3300012212|Ga0150985_111961512 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 642 | Open in IMG/M |
| 3300012212|Ga0150985_113798616 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 542 | Open in IMG/M |
| 3300012212|Ga0150985_115335778 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 927 | Open in IMG/M |
| 3300012212|Ga0150985_115865244 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 646 | Open in IMG/M |
| 3300012212|Ga0150985_115912445 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2204 | Open in IMG/M |
| 3300012212|Ga0150985_118396031 | Not Available | 634 | Open in IMG/M |
| 3300012212|Ga0150985_119769659 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2323 | Open in IMG/M |
| 3300012354|Ga0137366_10138074 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1837 | Open in IMG/M |
| 3300012355|Ga0137369_10352359 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1075 | Open in IMG/M |
| 3300012356|Ga0137371_11021361 | Not Available | 626 | Open in IMG/M |
| 3300012356|Ga0137371_11351987 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 525 | Open in IMG/M |
| 3300012469|Ga0150984_102972696 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1320 | Open in IMG/M |
| 3300012469|Ga0150984_103401191 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 905 | Open in IMG/M |
| 3300012469|Ga0150984_104032063 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 579 | Open in IMG/M |
| 3300012469|Ga0150984_104644379 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 587 | Open in IMG/M |
| 3300012469|Ga0150984_107948194 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 894 | Open in IMG/M |
| 3300012469|Ga0150984_110659371 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 790 | Open in IMG/M |
| 3300012469|Ga0150984_110669780 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 519 | Open in IMG/M |
| 3300012469|Ga0150984_110687829 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1968 | Open in IMG/M |
| 3300012469|Ga0150984_111129854 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 728 | Open in IMG/M |
| 3300012469|Ga0150984_111179350 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2155 | Open in IMG/M |
| 3300012469|Ga0150984_112414084 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 779 | Open in IMG/M |
| 3300012469|Ga0150984_119222050 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1426 | Open in IMG/M |
| 3300012469|Ga0150984_120734646 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 922 | Open in IMG/M |
| 3300012469|Ga0150984_120871847 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1006 | Open in IMG/M |
| 3300012469|Ga0150984_121468753 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1305 | Open in IMG/M |
| 3300012469|Ga0150984_122660470 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 701 | Open in IMG/M |
| 3300012476|Ga0157344_1004294 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 842 | Open in IMG/M |
| 3300012529|Ga0136630_1201994 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 714 | Open in IMG/M |
| 3300012681|Ga0136613_10063797 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2109 | Open in IMG/M |
| 3300012684|Ga0136614_10005617 | All Organisms → cellular organisms → Bacteria | 8375 | Open in IMG/M |
| 3300012685|Ga0137397_10452281 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 957 | Open in IMG/M |
| 3300012900|Ga0157292_10275457 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 594 | Open in IMG/M |
| 3300012902|Ga0157291_10224527 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 609 | Open in IMG/M |
| 3300012908|Ga0157286_10254359 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 621 | Open in IMG/M |
| 3300012922|Ga0137394_10872352 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 752 | Open in IMG/M |
| 3300012958|Ga0164299_10418411 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 867 | Open in IMG/M |
| 3300012961|Ga0164302_10695075 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 752 | Open in IMG/M |
| 3300012975|Ga0134110_10283992 | Not Available | 711 | Open in IMG/M |
| 3300013045|Ga0154016_142845 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 639 | Open in IMG/M |
| 3300013100|Ga0157373_10963644 | Not Available | 635 | Open in IMG/M |
| 3300013306|Ga0163162_11096373 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 902 | Open in IMG/M |
| 3300013307|Ga0157372_12874396 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 552 | Open in IMG/M |
| 3300014488|Ga0182001_10446227 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 578 | Open in IMG/M |
| 3300014497|Ga0182008_10013002 | All Organisms → cellular organisms → Bacteria | 4380 | Open in IMG/M |
| 3300014497|Ga0182008_10072588 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1693 | Open in IMG/M |
| 3300014497|Ga0182008_10174011 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 1088 | Open in IMG/M |
| 3300014497|Ga0182008_10819318 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 542 | Open in IMG/M |
| 3300015077|Ga0173483_10079459 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides panacis | 1322 | Open in IMG/M |
| 3300015258|Ga0180093_1033912 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1103 | Open in IMG/M |
| 3300015265|Ga0182005_1267052 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 534 | Open in IMG/M |
| 3300015359|Ga0134085_10202708 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 854 | Open in IMG/M |
| 3300015371|Ga0132258_10017392 | All Organisms → cellular organisms → Bacteria | 15530 | Open in IMG/M |
| 3300015371|Ga0132258_10725882 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2502 | Open in IMG/M |
| 3300015374|Ga0132255_104466409 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 593 | Open in IMG/M |
| 3300017789|Ga0136617_10011073 | All Organisms → cellular organisms → Bacteria | 8044 | Open in IMG/M |
| 3300017792|Ga0163161_11739660 | Not Available | 553 | Open in IMG/M |
| 3300017927|Ga0187824_10259967 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 605 | Open in IMG/M |
| 3300017965|Ga0190266_10011642 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2277 | Open in IMG/M |
| 3300017965|Ga0190266_10657103 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 646 | Open in IMG/M |
| 3300017966|Ga0187776_10002730 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 9002 | Open in IMG/M |
| 3300018027|Ga0184605_10110783 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1217 | Open in IMG/M |
| 3300018029|Ga0187787_10066928 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1095 | Open in IMG/M |
| 3300018066|Ga0184617_1219360 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 568 | Open in IMG/M |
| 3300018071|Ga0184618_10007674 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 3133 | Open in IMG/M |
| 3300018071|Ga0184618_10275710 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
| 3300018071|Ga0184618_10447105 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 544 | Open in IMG/M |
| 3300018072|Ga0184635_10160843 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 897 | Open in IMG/M |
| 3300018075|Ga0184632_10433883 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 547 | Open in IMG/M |
| 3300018082|Ga0184639_10488608 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 623 | Open in IMG/M |
| 3300018083|Ga0184628_10246697 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 938 | Open in IMG/M |
| 3300018422|Ga0190265_12271299 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 644 | Open in IMG/M |
| 3300018429|Ga0190272_13276807 | Not Available | 505 | Open in IMG/M |
| 3300018431|Ga0066655_10306838 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1034 | Open in IMG/M |
| 3300018431|Ga0066655_10760095 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 658 | Open in IMG/M |
| 3300018433|Ga0066667_10431054 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1073 | Open in IMG/M |
| 3300018433|Ga0066667_10717443 | Not Available | 841 | Open in IMG/M |
| 3300018466|Ga0190268_10014429 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2361 | Open in IMG/M |
| 3300018466|Ga0190268_10169289 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1146 | Open in IMG/M |
| 3300018468|Ga0066662_10289554 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1368 | Open in IMG/M |
| 3300018469|Ga0190270_10009538 | All Organisms → cellular organisms → Bacteria | 5403 | Open in IMG/M |
| 3300018469|Ga0190270_10059557 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2711 | Open in IMG/M |
| 3300018482|Ga0066669_10690437 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 899 | Open in IMG/M |
| 3300018482|Ga0066669_11048532 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 736 | Open in IMG/M |
| 3300018482|Ga0066669_12375736 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 507 | Open in IMG/M |
| 3300019255|Ga0184643_1270199 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 682 | Open in IMG/M |
| 3300019255|Ga0184643_1457472 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 654 | Open in IMG/M |
| 3300019279|Ga0184642_1102997 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 965 | Open in IMG/M |
| 3300019361|Ga0173482_10539305 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 574 | Open in IMG/M |
| 3300019362|Ga0173479_10216490 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 819 | Open in IMG/M |
| 3300019767|Ga0190267_10036686 | All Organisms → cellular organisms → Bacteria | 1584 | Open in IMG/M |
| 3300019868|Ga0193720_1002795 | All Organisms → cellular organisms → Bacteria | 2354 | Open in IMG/M |
| 3300019884|Ga0193741_1060517 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 975 | Open in IMG/M |
| 3300019887|Ga0193729_1147525 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 853 | Open in IMG/M |
| 3300019890|Ga0193728_1056414 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1899 | Open in IMG/M |
| 3300020006|Ga0193735_1072273 | Not Available | 995 | Open in IMG/M |
| 3300020069|Ga0197907_10478301 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3698 | Open in IMG/M |
| 3300020069|Ga0197907_10820005 | All Organisms → cellular organisms → Bacteria | 5897 | Open in IMG/M |
| 3300020070|Ga0206356_10514806 | Not Available | 1088 | Open in IMG/M |
| 3300020070|Ga0206356_10590513 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 9780 | Open in IMG/M |
| 3300020070|Ga0206356_10859150 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 1176 | Open in IMG/M |
| 3300020077|Ga0206351_10069445 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 854 | Open in IMG/M |
| 3300020078|Ga0206352_11284839 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 640 | Open in IMG/M |
| 3300020082|Ga0206353_10807535 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 610 | Open in IMG/M |
| 3300020082|Ga0206353_11043321 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1445 | Open in IMG/M |
| 3300021445|Ga0182009_10347156 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 757 | Open in IMG/M |
| 3300021445|Ga0182009_10530882 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 623 | Open in IMG/M |
| 3300021951|Ga0222624_1169892 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 868 | Open in IMG/M |
| 3300021951|Ga0222624_1289419 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 538 | Open in IMG/M |
| 3300022195|Ga0222625_1814277 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 574 | Open in IMG/M |
| 3300022467|Ga0224712_10068529 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1434 | Open in IMG/M |
| 3300022467|Ga0224712_10105841 | Not Available | 1200 | Open in IMG/M |
| 3300022467|Ga0224712_10233787 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 845 | Open in IMG/M |
| 3300022756|Ga0222622_10961594 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 627 | Open in IMG/M |
| 3300024310|Ga0247681_1005267 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1634 | Open in IMG/M |
| 3300025898|Ga0207692_10862674 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 594 | Open in IMG/M |
| 3300025907|Ga0207645_10879738 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 609 | Open in IMG/M |
| 3300025909|Ga0207705_10055237 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2863 | Open in IMG/M |
| 3300025909|Ga0207705_10948646 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 666 | Open in IMG/M |
| 3300025909|Ga0207705_11186692 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 586 | Open in IMG/M |
| 3300025911|Ga0207654_10541477 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 826 | Open in IMG/M |
| 3300025912|Ga0207707_10581633 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 949 | Open in IMG/M |
| 3300025915|Ga0207693_10246465 | All Organisms → cellular organisms → Bacteria | 1402 | Open in IMG/M |
| 3300025915|Ga0207693_10494189 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 955 | Open in IMG/M |
| 3300025916|Ga0207663_10793729 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 754 | Open in IMG/M |
| 3300025916|Ga0207663_10872512 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 719 | Open in IMG/M |
| 3300025919|Ga0207657_10365520 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1137 | Open in IMG/M |
| 3300025919|Ga0207657_10419124 | All Organisms → cellular organisms → Bacteria | 1052 | Open in IMG/M |
| 3300025919|Ga0207657_11404994 | Not Available | 524 | Open in IMG/M |
| 3300025929|Ga0207664_10602260 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 987 | Open in IMG/M |
| 3300025929|Ga0207664_10821624 | Not Available | 836 | Open in IMG/M |
| 3300025931|Ga0207644_11065152 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 679 | Open in IMG/M |
| 3300025931|Ga0207644_11213353 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 634 | Open in IMG/M |
| 3300025931|Ga0207644_11521322 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 562 | Open in IMG/M |
| 3300025932|Ga0207690_11471033 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 570 | Open in IMG/M |
| 3300025935|Ga0207709_10194740 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1443 | Open in IMG/M |
| 3300025942|Ga0207689_10198515 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1656 | Open in IMG/M |
| 3300026078|Ga0207702_11757090 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 613 | Open in IMG/M |
| 3300026121|Ga0207683_11047044 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 757 | Open in IMG/M |
| 3300026312|Ga0209153_1012308 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2713 | Open in IMG/M |
| 3300026312|Ga0209153_1104292 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1067 | Open in IMG/M |
| 3300026330|Ga0209473_1028734 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2533 | Open in IMG/M |
| 3300026538|Ga0209056_10327457 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1030 | Open in IMG/M |
| 3300026540|Ga0209376_1231503 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 807 | Open in IMG/M |
| 3300026547|Ga0209156_10149329 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1134 | Open in IMG/M |
| 3300026550|Ga0209474_10169706 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1410 | Open in IMG/M |
| 3300026550|Ga0209474_10327083 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 879 | Open in IMG/M |
| 3300027637|Ga0209818_1061515 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 930 | Open in IMG/M |
| 3300027773|Ga0209810_1000015 | All Organisms → cellular organisms → Bacteria | 608252 | Open in IMG/M |
| 3300027775|Ga0209177_10508864 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 503 | Open in IMG/M |
| 3300027787|Ga0209074_10009348 | All Organisms → cellular organisms → Bacteria | 2379 | Open in IMG/M |
| 3300027880|Ga0209481_10603045 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 569 | Open in IMG/M |
| 3300027907|Ga0207428_10109935 | All Organisms → cellular organisms → Bacteria | 2123 | Open in IMG/M |
| 3300027907|Ga0207428_10432709 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 961 | Open in IMG/M |
| 3300027907|Ga0207428_10500787 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 882 | Open in IMG/M |
| 3300028104|Ga0247713_1025103 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1551 | Open in IMG/M |
| 3300028710|Ga0307322_10043341 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1086 | Open in IMG/M |
| 3300028715|Ga0307313_10184191 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 647 | Open in IMG/M |
| 3300028717|Ga0307298_10105916 | Not Available | 801 | Open in IMG/M |
| 3300028722|Ga0307319_10274138 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 557 | Open in IMG/M |
| 3300028755|Ga0307316_10107404 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 977 | Open in IMG/M |
| 3300028784|Ga0307282_10126121 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1202 | Open in IMG/M |
| 3300028784|Ga0307282_10285594 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 795 | Open in IMG/M |
| 3300028791|Ga0307290_10061921 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1355 | Open in IMG/M |
| 3300028799|Ga0307284_10257906 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 695 | Open in IMG/M |
| 3300028807|Ga0307305_10090710 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1412 | Open in IMG/M |
| 3300028807|Ga0307305_10151481 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1071 | Open in IMG/M |
| 3300028807|Ga0307305_10221555 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 867 | Open in IMG/M |
| 3300028811|Ga0307292_10232438 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 763 | Open in IMG/M |
| 3300028812|Ga0247825_11414063 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 510 | Open in IMG/M |
| 3300028814|Ga0307302_10223927 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 920 | Open in IMG/M |
| 3300028828|Ga0307312_10826164 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 614 | Open in IMG/M |
| 3300028876|Ga0307286_10141615 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 858 | Open in IMG/M |
| 3300028878|Ga0307278_10020118 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3088 | Open in IMG/M |
| 3300028881|Ga0307277_10019685 | All Organisms → cellular organisms → Bacteria | 2637 | Open in IMG/M |
| 3300028881|Ga0307277_10235606 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 806 | Open in IMG/M |
| 3300028881|Ga0307277_10411594 | Not Available | 605 | Open in IMG/M |
| 3300028884|Ga0307308_10582322 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 537 | Open in IMG/M |
| 3300030006|Ga0299907_10133346 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2049 | Open in IMG/M |
| 3300030336|Ga0247826_11335818 | Not Available | 578 | Open in IMG/M |
| 3300030783|Ga0102752_1555563 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 756 | Open in IMG/M |
| 3300030829|Ga0308203_1011753 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1026 | Open in IMG/M |
| 3300030902|Ga0308202_1029037 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 921 | Open in IMG/M |
| 3300031091|Ga0308201_10017856 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1439 | Open in IMG/M |
| 3300031091|Ga0308201_10071585 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 931 | Open in IMG/M |
| 3300031091|Ga0308201_10095032 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 849 | Open in IMG/M |
| 3300031091|Ga0308201_10219208 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 639 | Open in IMG/M |
| 3300031091|Ga0308201_10220210 | Not Available | 638 | Open in IMG/M |
| 3300031092|Ga0308204_10235242 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 587 | Open in IMG/M |
| 3300031093|Ga0308197_10050549 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1073 | Open in IMG/M |
| 3300031114|Ga0308187_10107958 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 874 | Open in IMG/M |
| 3300031366|Ga0307506_10187438 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 752 | Open in IMG/M |
| 3300031548|Ga0307408_100296654 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1352 | Open in IMG/M |
| 3300031548|Ga0307408_100315037 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1316 | Open in IMG/M |
| 3300031854|Ga0310904_10593260 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
| 3300031903|Ga0307407_11093839 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 619 | Open in IMG/M |
| 3300031938|Ga0308175_100117332 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2488 | Open in IMG/M |
| 3300031938|Ga0308175_100320690 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1589 | Open in IMG/M |
| 3300031938|Ga0308175_100610291 | Not Available | 1175 | Open in IMG/M |
| 3300031938|Ga0308175_100681994 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1114 | Open in IMG/M |
| 3300031996|Ga0308176_11100725 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 840 | Open in IMG/M |
| 3300031996|Ga0308176_11660793 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 681 | Open in IMG/M |
| 3300032013|Ga0310906_11165858 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 559 | Open in IMG/M |
| 3300032074|Ga0308173_10327960 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1325 | Open in IMG/M |
| 3300032074|Ga0308173_10984109 | Not Available | 783 | Open in IMG/M |
| 3300032075|Ga0310890_10601358 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 851 | Open in IMG/M |
| 3300032080|Ga0326721_10592665 | Not Available | 673 | Open in IMG/M |
| 3300032828|Ga0335080_10290833 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1776 | Open in IMG/M |
| 3300032828|Ga0335080_11407446 | Not Available | 693 | Open in IMG/M |
| 3300032828|Ga0335080_12384994 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 505 | Open in IMG/M |
| 3300033475|Ga0310811_11358060 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 555 | Open in IMG/M |
| 3300033551|Ga0247830_11366641 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 566 | Open in IMG/M |
| 3300034113|Ga0364937_056516 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 740 | Open in IMG/M |
| 3300034149|Ga0364929_0358835 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 506 | Open in IMG/M |
| 3300034268|Ga0372943_0081646 | Not Available | 1868 | Open in IMG/M |
| 3300034268|Ga0372943_1223871 | Not Available | 503 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 13.26% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 10.11% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 6.52% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.27% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.04% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 3.82% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 3.60% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 3.60% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.37% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.37% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 3.15% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 3.15% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 2.92% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 2.92% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.47% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.02% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 1.80% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.80% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.80% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.35% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.12% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.12% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.12% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.12% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.57% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.90% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.90% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.90% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.67% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.67% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.67% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.67% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.67% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.67% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.45% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.45% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.45% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.45% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.45% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.45% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.45% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.45% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.22% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.22% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.22% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.22% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.22% |
| Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 0.22% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.22% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.22% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.22% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.22% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.22% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.22% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.22% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.22% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.22% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2065487018 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 2067725004 | Soil microbial communities from Great Prairies - Kansas Corn soil | Environmental | Open in IMG/M |
| 2070309009 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 2119805009 | Soil microbial communities from sample at FACE Site NTS_007 Nevada Test Site | Environmental | Open in IMG/M |
| 2170459019 | Litter degradation MG4 | Engineered | Open in IMG/M |
| 3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000363 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000858 | Soil microbial communities from Great Prairies - Wisconsin Native Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
| 3300001535 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A3-PF-15A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300003321 | Sugarcane bulk soil Sample H1 | Environmental | Open in IMG/M |
| 3300003324 | Sugarcane bulk soil Sample H2 | Environmental | Open in IMG/M |
| 3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
| 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005532 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006051 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Host-Associated | Open in IMG/M |
| 3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
| 3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300007740 | Permafrost core soil microbial communities from Svalbard, Norway - sample 2-9-2 Soapdenovo | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300009836 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_10_20 | Environmental | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
| 3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
| 3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010145 | Soil microbial communities from Hawaii, USA to study soil gas exchange rates - KP-HI-INT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010152 | Soil microbial communities from Oklahoma, USA to study soil gas exchange rates - GP-OK-ARM metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300011996 | Permafrost microbial communities from Nunavut, Canada - A39_65cm_12M | Environmental | Open in IMG/M |
| 3300012043 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ601 (22.06) | Environmental | Open in IMG/M |
| 3300012091 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ483 (23.06) | Environmental | Open in IMG/M |
| 3300012092 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ445A (23.06) | Environmental | Open in IMG/M |
| 3300012093 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ611 (21.06) | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012476 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 | Host-Associated | Open in IMG/M |
| 3300012529 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ568 (21.06) | Environmental | Open in IMG/M |
| 3300012681 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ272 (21.06) | Environmental | Open in IMG/M |
| 3300012684 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ279 (21.06) | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012900 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S179-409R-1 | Environmental | Open in IMG/M |
| 3300012902 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S169-409C-1 | Environmental | Open in IMG/M |
| 3300012908 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1 | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300013045 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014488 | Bulk soil microbial communities from Mexico - San Felipe (SF) metaG | Environmental | Open in IMG/M |
| 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
| 3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
| 3300015258 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT45_16_1Da | Environmental | Open in IMG/M |
| 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Host-Associated | Open in IMG/M |
| 3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017789 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ322 (21.06) | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
| 3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018029 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP06_20_MG | Environmental | Open in IMG/M |
| 3300018066 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1 | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
| 3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
| 3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
| 3300018083 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1 | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019255 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019279 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
| 3300019767 | Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 T | Environmental | Open in IMG/M |
| 3300019868 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s1 | Environmental | Open in IMG/M |
| 3300019884 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2s2 | Environmental | Open in IMG/M |
| 3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
| 3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
| 3300020006 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m2 | Environmental | Open in IMG/M |
| 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300021951 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022195 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300024310 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK22 | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026312 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes) | Environmental | Open in IMG/M |
| 3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300027637 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027773 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028104 | Soil microbial communities from hillslope of Landscape Evolution Observatory, University of Arizona, Oracle, AZ, United States - 2-1-E_N | Environmental | Open in IMG/M |
| 3300028710 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_380 | Environmental | Open in IMG/M |
| 3300028715 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203 | Environmental | Open in IMG/M |
| 3300028717 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158 | Environmental | Open in IMG/M |
| 3300028722 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368 | Environmental | Open in IMG/M |
| 3300028755 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356 | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028791 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144 | Environmental | Open in IMG/M |
| 3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
| 3300028812 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48 | Environmental | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028876 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140 | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300030006 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 | Environmental | Open in IMG/M |
| 3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
| 3300030783 | Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PI 3C (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030829 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_357 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030902 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_356 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031091 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_355 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031092 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_367 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031093 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_198 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031114 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_182 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031366 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 25_S | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
| 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Host-Associated | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
| 3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300032080 | Soil microbial communities from Southern Great Plains, Lamont, Oklahoma, United States - SGP_1_2016 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| 3300034113 | Sediment microbial communities from East River floodplain, Colorado, United States - 7_s17 | Environmental | Open in IMG/M |
| 3300034149 | Sediment microbial communities from East River floodplain, Colorado, United States - 20_j17 | Environmental | Open in IMG/M |
| 3300034268 | Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPINP_02704230 | 2065487018 | Soil | MLRRLLWTGLYATVGALATLVARRVTTKIWNIVTGEDPPT |
| GPKC_06454810 | 2067725004 | Soil | MLRKLLWTGLYAGIAALATIVARKVASKIWAVATGEAP |
| GPKNP_02557870 | 2070309009 | Soil | NPTRMLRKAMWTGLYAGIGAAATIAARRVASKIWRIATGEEPPTKK |
| FNTS007_05989050 | 2119805009 | Soil | MLRKVLWTSLYAGLGAAATIGARRLASKIYRVVTGEAPPT |
| 4MG_03991470 | 2170459019 | Switchgrass, Maize And Mischanthus Litter | MLRKLLWTGLYAGFGAAATIVARKAASSVYRIATGEEPPVKR |
| ICChiseqgaiiDRAFT_05173922 | 3300000033 | Soil | MLLRKLLWTGLYAALAAAATMASRRAATRIWRIATGEAPPAKK* |
| ICChiseqgaiiFebDRAFT_142320903 | 3300000363 | Soil | MWTGLYAAIAAAATVAARTVASKIWRVTTGEAPPVKK* |
| INPhiseqgaiiFebDRAFT_1042078362 | 3300000364 | Soil | MLRKLLWTGLYGAIAALATIVARKIATKIWNVATG |
| JGI10213J12805_101350753 | 3300000858 | Soil | MLRKLLWTGLYGAIAALATIVARRVASKIWGVATGETPPAKT* |
| JGI10216J12902_1001023762 | 3300000956 | Soil | MLRRLIWTGLYASLAAAATLAARKTATKIWHVATGEEPPVKK* |
| JGI10216J12902_1014128991 | 3300000956 | Soil | MLRKMLWTALYAGLGALATLLARKTAVRIWRIGTGEEPPRAT* |
| JGI10216J12902_1028434441 | 3300000956 | Soil | GGKRAGMLLRKLLWTGLYAALAAAATMASRRAASRIWRIATGEAPPAKR* |
| JGI10216J12902_1036734822 | 3300000956 | Soil | MVRKILWSGLYAGLAAAATMSARRAATSVWRLATGEEPPAKR* |
| JGI10216J12902_1058858902 | 3300000956 | Soil | MLRRLIWTGLYASLAAAATLAARRTATKIWRIATGEEPPVKR* |
| F14TB_1038890222 | 3300001431 | Soil | MLRKLLWTGLYGAIAALATIVARKIATKIWGVATGE |
| A3PFW1_105838692 | 3300001535 | Permafrost | MLRKLLWSGLYAGIGAAATIGARRAASSIWRIATGEEPPTKK* |
| C688J35102_1181148952 | 3300002568 | Soil | MLRKALWSGLYAGVGAVMTMAAQRAASTVWRLSTGEAPPESR* |
| C688J35102_1185070611 | 3300002568 | Soil | MLRKVMWTGLYATLGALATLASRRLSSRIWRIATGEEPPVK |
| C688J35102_1188419332 | 3300002568 | Soil | MLRKILWSGLYAGAGAAATVASRRAATSIWRLATGEEPPAKR* |
| C688J35102_1200374712 | 3300002568 | Soil | MVRKVLWSGLYAGLGAAATIGARRVASSVWRLATGEEPPAKR* |
| C688J35102_1201000052 | 3300002568 | Soil | MVRKILWSALYAGLGAMATMGARRVASSVWRLATGEEPPAKR* |
| C688J35102_1209854404 | 3300002568 | Soil | MLRKVLWSGLYAGVGAVMTMAAQRAASTVWRLSTGETPPESR* |
| soilH1_101389317 | 3300003321 | Sugarcane Root And Bulk Soil | MLRKLLWTGLYAGLGAVATMGARRTASSIWRIATGEEPPVKK* |
| soilH1_102544064 | 3300003321 | Sugarcane Root And Bulk Soil | MLRKLLWTGLYAGLGAAATVGARRTASSIWRLATGEEPPAKR* |
| soilH2_102339942 | 3300003324 | Sugarcane Root And Bulk Soil | MLRKAMWTGLYAGFGAASTLVARRLATKVWQVATGEDPPTKR* |
| Ga0063454_1000239942 | 3300004081 | Soil | MLRKALWTGLYAGIGAAATVAARRVATKVWQVATGEDPPARK* |
| Ga0063454_1007310762 | 3300004081 | Soil | VPGNPNAMLRKAMWTGLYAGLAAVSTLITRRIAAKIWYVATGEAPPTRK* |
| Ga0063454_1007671801 | 3300004081 | Soil | MKRGNDPGMLRKLLWTSLYAGIAAVSTMVARRAASGIWRVAT |
| Ga0063454_1011497052 | 3300004081 | Soil | MSMLRKFMWTGLYAGLGAAATLISRRAATSIWRLATGEQPPTAK* |
| Ga0063454_1011590872 | 3300004081 | Soil | MLRKVMWTGLYATLGALATLASRRLSSRIWRIATGEEPPVRK* |
| Ga0063454_1011884461 | 3300004081 | Soil | MLRKILWSGLYAGVGAAATLGARRVASSVWRLATGEEPPAKR* |
| Ga0063454_1015478011 | 3300004081 | Soil | MLRKLLWTGLYAGFGAAATIVARRAAATVYRIATGEEPPTKR* |
| Ga0062593_1006170992 | 3300004114 | Soil | MRTFPTHEVGKIGDTMVRKILWSGLYAGLAAAATMSARRAATSVWRLATGEEPPAKR* |
| Ga0062593_1012153961 | 3300004114 | Soil | LAESPTGNDPGVLRKLLWLGLYAGLSAAATVVARKTATQVWRTATGEAPPVHK* |
| Ga0062593_1026415662 | 3300004114 | Soil | LAESPTGNHPGVLRKLLWLGLYAGLSAAATLVARKTASQVWRAATGEAPPVKKK* |
| Ga0063455_1003593382 | 3300004153 | Soil | MLRKGIWTVLYAGLGAAATLASRRLASRIWRIATGEEPPVKK* |
| Ga0062590_1014241872 | 3300004157 | Soil | MLLRKALWTGLYALLAAAATMASRRAASRIWRIATGEAPPAKK* |
| Ga0063356_1016804782 | 3300004463 | Arabidopsis Thaliana Rhizosphere | LAEIRSVMRGTMLRKLIWTGLYAALGAAAAVAARRLAASIWRIATGEEPPVKKA* |
| Ga0062595_1000078874 | 3300004479 | Soil | MLRKILWTGLYSGLGAVATIGARRAASSIWRIATGEEPPTKK* |
| Ga0062595_1004115631 | 3300004479 | Soil | MLRKAMWTGLYAGLGAASTMVTRRLAAKIWHVATGEEPPTKR* |
| Ga0062595_1005456033 | 3300004479 | Soil | MLRKLLWTALYAGFGAGATMVARKAASSVYRIATGEEPPVKR* |
| Ga0062595_1016405833 | 3300004479 | Soil | LRKLLWTGLYAGLGAAATVGARRTASSIWRLATGEEPPAKR* |
| Ga0062592_1007124451 | 3300004480 | Soil | VGKAGRMLRKLMWTGLYAAIAAAATVAARTVASKIWRVTTGEAPPVKK* |
| Ga0062591_1000564513 | 3300004643 | Soil | MLRKLLWTGLYGAIAALATIVARKIATKIWGVATGEAPPAKT* |
| Ga0062594_1000333146 | 3300005093 | Soil | MLRKLLWTGLYAAVGAAATVAARRVATKVWQIATGEEPPTKK* |
| Ga0062594_1007428193 | 3300005093 | Soil | GNEPGMLRKLLWTGLLAGLSAAATIAARRAATQLWRTATGEAPPVRK* |
| Ga0062594_1018896542 | 3300005093 | Soil | MLRKALWSGLYAAFGAIATLGARRTASSIWRLATGEEPPQKR* |
| Ga0062594_1024366062 | 3300005093 | Soil | GNEPGMLRKLLWTGLLAGLSAAATFAARRTAAQLWRTATGEAPPVKKK* |
| Ga0066674_103759211 | 3300005166 | Soil | MLLRKVLWSGLYAGLGAAATIAARRAASSLWRIATGEDPPAKR* |
| Ga0066674_105671322 | 3300005166 | Soil | MLRKLLWTGLYGGIAAGATVVARKTASKVWRLATGEEPPTTR* |
| Ga0066677_102054611 | 3300005171 | Soil | MLRKLLWTGLYAGFGAAATLVARRAASTVYRIATGEEPPVKR* |
| Ga0066679_100424616 | 3300005176 | Soil | MLRKLLWSALYAGLSAAATLGARRAASRIWRIATGEEPPTKK* |
| Ga0066684_100405664 | 3300005179 | Soil | MLRKLLWTALYAGFGAGATMVARKAASSVYRIATGEEPPTKR* |
| Ga0066684_103355322 | 3300005179 | Soil | MLRKLLWTGLYAGFGAAATIVARRAASTVYRIATGEEPPVKR* |
| Ga0066685_102432892 | 3300005180 | Soil | MLRKLLWTGLYAGFGAAATIVARRAASTVYRLATGEEPPVKR* |
| Ga0066678_107030602 | 3300005181 | Soil | VTGGQDPAMLRKLLWTALYAGFGAAATIVARKAASSVYRIATGEEPPTKK* |
| Ga0066671_104315732 | 3300005184 | Soil | MLRKLLWTALYAGFGAGATMVARKAASSVYRIAKGEEPPVKR* |
| Ga0066675_103052134 | 3300005187 | Soil | CRSAGAARAKEMLLRKVLWSGLYAGLGAAATIAARRAASSLWRIATGEDPPAKR* |
| Ga0070658_100376725 | 3300005327 | Corn Rhizosphere | MLRKILWSGLYAGLGAAATVGARRVATSMWRLATGEEPPARR* |
| Ga0070658_102498741 | 3300005327 | Corn Rhizosphere | MLRKILWSGLYAGLGAAATVGARRVASSVWRLATGEEPPAKR* |
| Ga0070658_109280003 | 3300005327 | Corn Rhizosphere | MEGMLRKLLWSGLYAGLGAAATIGARRAASSIWRIATGEEPPTKK* |
| Ga0070658_114590012 | 3300005327 | Corn Rhizosphere | MVRKVLWSGLYAAFGAAATLGARRTASSIWRRATGEEPPQKR* |
| Ga0070683_1001972423 | 3300005329 | Corn Rhizosphere | MLRKLLWTGLYAGLAAGATMVARRAASGIWHAATGEAPPVKK* |
| Ga0070683_1018699212 | 3300005329 | Corn Rhizosphere | VRKVLWSGLYAAFGAAATLGARRTASSIWRRATGEEPPQKR* |
| Ga0066388_1008196963 | 3300005332 | Tropical Forest Soil | VLRKLLWTGLYAGIAAGATIVARTLASRIWRLATGEEPPVKK* |
| Ga0066388_1017626543 | 3300005332 | Tropical Forest Soil | MLRKLMWTGLYAAVSAGAALVARRTAASIWRIATGEEPPVKK* |
| Ga0066388_1022062472 | 3300005332 | Tropical Forest Soil | MLRRLLWTGLYAAIGALATLVARRAATKIWNILTGEEPPTKR* |
| Ga0070680_1002640871 | 3300005336 | Corn Rhizosphere | MLRKAMWTGLYAGFGAASTMIARRLATKVWHVATGEDPPTKK* |
| Ga0068868_1014143942 | 3300005338 | Miscanthus Rhizosphere | LAESASGNEPGMLRKLLWTGLLAGLSAAATIAARRAATQLWRTATGEAPPVRK* |
| Ga0070660_1004597502 | 3300005339 | Corn Rhizosphere | MLRKALWSGLYAAFGAVATLGARRTASSIWRLATGEEPPQKR* |
| Ga0070660_1012767362 | 3300005339 | Corn Rhizosphere | MVRKILWSGLNAGFRAAASAGARRAATSVWRRAVGEEPPARR* |
| Ga0070660_1016472632 | 3300005339 | Corn Rhizosphere | MRSVLRKLLWSGLYAGIGAAATIGARRAASSIWRAATGEEPPTKR* |
| Ga0070691_100876021 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | AGLAESSSGNDPGMLRKLLWTGLYAGLAAGATMVARRAASGIWHAATGEAPPVKK* |
| Ga0070661_1000519322 | 3300005344 | Corn Rhizosphere | MLRKVLWSGLYAAFGAAATLGARRTASSIWRRATGEEPPQKR* |
| Ga0070692_110311801 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | MLRKLLWTGLYGAIAALATIVAKKIATKIWAVATGEAPPAKT* |
| Ga0070671_1000692725 | 3300005355 | Switchgrass Rhizosphere | LAESSSGNDPGMLRKLLWTGLYAGLAAGATMVARRAASGIWHAATGEAPPVKK* |
| Ga0070671_1004508342 | 3300005355 | Switchgrass Rhizosphere | LADSSSGNDPGMLRKLLWTGLYAGLVAGATMVARRAASGIWQAATGEEPPVKK* |
| Ga0070714_1000575376 | 3300005435 | Agricultural Soil | MPPSAKSEQMARKLLWSGLYAALGAVATLGARRTATSIWRLATGEEPPQKR* |
| Ga0070714_1022921411 | 3300005435 | Agricultural Soil | MLRKILWSGLYAGFGAAATIGARRVASSVWRLATGEEPPAKR* |
| Ga0070713_1004602023 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MTLPRKPLLRKALWTGLYAGLGALATLASRRLAARIWRTVTGEEPPTKK* |
| Ga0070711_1002231105 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | LAESASGNEPGMLRKLLWTGLLAGLSAAATFAARRTAAQLWRTATGEAPPVKKK* |
| Ga0070711_1009788783 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | PLLRKALWTGLYAGLGALATLASRRLAARIWRTVTGEEPPTKK* |
| Ga0070700_1008469763 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MLRKLLWTGLYGAIAALATIVAKKIATKIWNVATGEAPPAKT* |
| Ga0070694_1008550131 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | EPGMLRKLLWTGLLAGLSAAATFAARRTAAQLWRTATGEAPPVKKK* |
| Ga0070694_1008960922 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | VRGGQDRAMLRKLLWTALYAGFGAGATMVARKAASSVYRIATGEEPPVKR* |
| Ga0066686_107486982 | 3300005446 | Soil | MLRKLLWTGLYAGLGAGATLAARRAASRIWRLATGEEPPTKK* |
| Ga0070681_105911793 | 3300005458 | Corn Rhizosphere | MEAMLRKLLWSGLYAGIGAAATIGARRAASSIWRIATGEEPPTKK* |
| Ga0070685_105397303 | 3300005466 | Switchgrass Rhizosphere | LAESSSGNDPGMLRKLLWTGLYAGLAAGATMVARRAASGIWHAATGEAPPVRK* |
| Ga0070698_1000604474 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | LAKSASGKQTSVLRKLAWTGLSAGAVIAARRAAAKVWRIATGESPPTKA* |
| Ga0070741_107472662 | 3300005529 | Surface Soil | MLRKLLWSGLYAGLGAAATVGARRAATSIWRLATGEEPPAKR* |
| Ga0070739_10000035143 | 3300005532 | Surface Soil | MWTGLYAGLGAASTMVSRRLASKIWRVMTGEEPPTKK* |
| Ga0070696_1001323082 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MLRKLLWTGLLAGLSAAATFAARRTAAQLWRTATGEAPPVKKK* |
| Ga0070693_1005893342 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | MLRKAMWTGLYAGFGAASTMIARRLATKVWHVATGEEPPTKK* |
| Ga0070704_1006273781 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MIRKLLWTGLYAGLGAAATIGARTVASRIWRIATGEQPPAKK* |
| Ga0066707_106936031 | 3300005556 | Soil | GNEGQDLSMLRKLLWTALYAGFGAAATIVARRGASTVYRIATGEEPPVKK* |
| Ga0066698_108441941 | 3300005558 | Soil | ALWTGLYAGLGAVAAIGARAAASRIWRVTTGEEPPAKR* |
| Ga0066699_103297942 | 3300005561 | Soil | MLRKLLWSTLYAGLSAAATLGARRAASRIWRIATGEEPPTKK* |
| Ga0068855_1010357103 | 3300005563 | Corn Rhizosphere | GLAESSSGNDPGMLRKLLWTGLYAGLAAGATMVARRAASGIWHAATGEAPPVKK* |
| Ga0070664_1001395112 | 3300005564 | Corn Rhizosphere | MWTGLYAGLAAVSTLLTRRLASKIWRVATGEAPPTKR* |
| Ga0070664_1005317802 | 3300005564 | Corn Rhizosphere | MLRKAMWTGLYAGLGAASTIVARRLATKVWQVATGEEPPTKR* |
| Ga0066693_100584033 | 3300005566 | Soil | VLRKLLWTGLYSGLAAGATIAARRAASKIWTVATGEQPPTKR* |
| Ga0066708_104357243 | 3300005576 | Soil | MLRKLLWSGLYAGLSAAATMGARRAASRIWRIATGEEPPTKK* |
| Ga0066708_108644522 | 3300005576 | Soil | MLRKLMWTGLYAAIGAAATLVARRAATKIWNILTGEDPPTKK* |
| Ga0066654_101631603 | 3300005587 | Soil | MREFPVRATGKMGDAMVRKILWSGLYAGLGAAATLGARRAASSVWRLATGEEPPVKR* |
| Ga0066905_1007268482 | 3300005713 | Tropical Forest Soil | MLRRLLWTGLYASLAAAATLAARRTATKIWRIATGEEPPVKR* |
| Ga0066905_1022090171 | 3300005713 | Tropical Forest Soil | MWTGLYGALAAAATLAARRTATKIWHVATGEEPPVTKRR* |
| Ga0068863_1022024502 | 3300005841 | Switchgrass Rhizosphere | SGNDPGMLRKLLWTGLYAGLVAGATMVARRAASGIWQAATGEEPPVKK* |
| Ga0081538_101191542 | 3300005981 | Tabebuia Heterophylla Rhizosphere | VIRKLIWTGLYAGLGALATLAARTVATRIWRIATGEEPPIKKK* |
| Ga0070717_101304455 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MLRKAMWTGLYAGLAAVSAVVARRVATRVWWVATGEEPPSKK* |
| Ga0066652_1000854713 | 3300006046 | Soil | MLRKLLWTGLYAGFGAAATVVARRAASQVYRIATGEEPPTRK* |
| Ga0066652_1002516115 | 3300006046 | Soil | AARAEEMLLRKALWSALYAGFAAVAALGARRTASSIWRLATGEAPPPTR* |
| Ga0066652_1008002833 | 3300006046 | Soil | MLLRKALWSALYAGFGAAAALGARRTASSIWRLATGEDPPTTR* |
| Ga0075364_102202003 | 3300006051 | Populus Endosphere | MWTGLYAALAAAATAGARKVAAKIWRTVTGEHPPVKAR* |
| Ga0075432_100828093 | 3300006058 | Populus Rhizosphere | MLRKLLWTGLLAGLSAVAAIAARRTADQVWRVLTGEEPPAKK* |
| Ga0066653_101351091 | 3300006791 | Soil | MLLRKALWSALYAGFAAVAALGARRTASSIWRLATGEAPPPTR* |
| Ga0066660_103119723 | 3300006800 | Soil | MLRKLLWTGLYAGLSAGAAIAARRAAGRIWRIATGEEPPTKR* |
| Ga0066660_105289642 | 3300006800 | Soil | MLRKILWNGLYAGVGAAATVGARRVASSIWRIATGEEPPTKK* |
| Ga0066660_112460432 | 3300006800 | Soil | VLRKALWTGLYAGIGAASTIVARRVASKVWRIATGEEPPTKK* |
| Ga0066660_115696202 | 3300006800 | Soil | MLMRKAMWTGLYAGLGAVATMASRRLASRVWRATMHEEPPTKK* |
| Ga0075428_1012183392 | 3300006844 | Populus Rhizosphere | MLRKLLWTGLYAALGAAATIVARSVASRIWRIATGEAPPTKK* |
| Ga0075428_1021686122 | 3300006844 | Populus Rhizosphere | MLRKLLWTGLYGAIAALATIVARKIATKIWGVATGESPPAKT* |
| Ga0075421_1005455432 | 3300006845 | Populus Rhizosphere | LAESPTGNHPGVLRKVLWLGLYAGLSAAATLVARKTASQVWRAATGEQPPVHK* |
| Ga0075425_1000059684 | 3300006854 | Populus Rhizosphere | MLRKLMWTGLYAAVGAAATLVARRAATKIWHILTGEEPPTKK* |
| Ga0075425_1022488221 | 3300006854 | Populus Rhizosphere | PMLRKALWTGLYAGIGAAATIAARRVATKVWQVATGEDPPTKK* |
| Ga0079217_100034658 | 3300006876 | Agricultural Soil | MLLRKLLWTGLYAALAAAATMASRRAASRIWRIATGEAPPAKK* |
| Ga0079215_111132403 | 3300006894 | Agricultural Soil | GLYAGLAAGASIGARRLASKIWRVTTGEAPPAKK* |
| Ga0075436_1008063992 | 3300006914 | Populus Rhizosphere | MVRKILWSGLYAGLAAAATMSARRAATSVWRLATGEDPPA |
| Ga0079219_103053832 | 3300006954 | Agricultural Soil | MLRKLLWTGLYAAIGAVATLVARRSATKIWNILTGEDPPTKR* |
| Ga0079219_104921491 | 3300006954 | Agricultural Soil | SSGNDPGMLRKLLWTGLYAGLAAGATMVARRAASGIWHAATGEAPPVKK* |
| Ga0075419_113365912 | 3300006969 | Populus Rhizosphere | MLRKLLWKGLYGVIAALATIVAKKIATKIWNVATGEAPPAKT* |
| Ga0079218_117190242 | 3300007004 | Agricultural Soil | MLRKLLWTGLYAGLAAAATMGARRVASKVWRVVTGEAPPTKK* |
| Ga0104326_1303445 | 3300007740 | Soil | MLRKLLWTGLYAALSAAATIAARRAASQIWRIATGETPPTKK* |
| Ga0066710_1001831783 | 3300009012 | Grasslands Soil | MLRKLLWTGLYGGIAAGATVVARKTASTVWRIATGEQPPARQ |
| Ga0066710_1006475471 | 3300009012 | Grasslands Soil | LLWTGLYASLGAAATIGARTVASRLWRVMTGEQPPVKK |
| Ga0066710_1032819652 | 3300009012 | Grasslands Soil | VLRKALWSGLYAGFGAVATIAARRAASAVWRIGTGEEPPTKK |
| Ga0105240_110777623 | 3300009093 | Corn Rhizosphere | MLRKILWNGLYAGVGAVATLGARRAASSIWRIATGEEPPTRK* |
| Ga0105240_118952722 | 3300009093 | Corn Rhizosphere | MLRKAMWTGLYAGLGAASTMVARRLASKIWRVTTGEEPPTKK* |
| Ga0111539_110600853 | 3300009094 | Populus Rhizosphere | MIKRFLWTGLYAGIGAAATLGARKVATKIYRVLTGEPPPVKR* |
| Ga0111539_118158311 | 3300009094 | Populus Rhizosphere | MLRKLMWTGLYAALAAAATAGARKVAAKIWRTVTGEHPPVKAR* |
| Ga0066709_1004369834 | 3300009137 | Grasslands Soil | MLRKLLWTGLYAGLGAGATIAARRAASTIWRIATGEPPPTKR* |
| Ga0066709_1008054293 | 3300009137 | Grasslands Soil | MLRKLLWTGLYGGIAAGATVIARKTASTVWRIATGEQPPARQ* |
| Ga0066709_1024914382 | 3300009137 | Grasslands Soil | MLRKLMWTVLYGVIGAAATLVARRSATKIWNILTGEEPPTKR* |
| Ga0066709_1032697112 | 3300009137 | Grasslands Soil | VLRKALWSGLYAGFGAVATIAARRAASAVWRIGTGEEPPTKK* |
| Ga0114129_104237992 | 3300009147 | Populus Rhizosphere | MWTGLYTSLAAAATLVARRAARKIWVVATGEEPPEKK* |
| Ga0114129_105715052 | 3300009147 | Populus Rhizosphere | LAESPTGNHPGVLRKVLWLGLYAGLSAAATLVARKTASQLWRAATGEQPPVHK* |
| Ga0114129_108839793 | 3300009147 | Populus Rhizosphere | MLLRKALWTGLYALLAAIATMASRRAASRIWRIATGEAPPAKR* |
| Ga0105243_105762951 | 3300009148 | Miscanthus Rhizosphere | GLAESASGNEPGMLRKLLWTGLLAGLSAAATIAARRAATQLWRTATGEAPPVRK* |
| Ga0075423_110542362 | 3300009162 | Populus Rhizosphere | LAESSSGNDPGMLRKLLWTGLYAGLAAGATMVARRAASEIWHAATGEAPPVKK* |
| Ga0105242_129555732 | 3300009176 | Miscanthus Rhizosphere | MWTGLSAGLAAVSTLVTRRLASKIWRVATGEAPPIKK* |
| Ga0105249_120855362 | 3300009553 | Switchgrass Rhizosphere | MLRKLLWTGLYGAIAALATIIAKKIATKIWNVATGEAPPAKT* |
| Ga0126307_100317237 | 3300009789 | Serpentine Soil | MLRRVMWTGLYAGLGAAATLAARRVASRIWRIATGEEPPTKK* |
| Ga0126307_103604842 | 3300009789 | Serpentine Soil | MVRKAMWTGLYAALGAAATFAARTLASKIWRLTTGEPPPVKK* |
| Ga0126307_103823802 | 3300009789 | Serpentine Soil | MLRRLTWTGLYALFGAVATVAARRLSSRIWRIATGEEPPTKK* |
| Ga0105068_10758541 | 3300009836 | Groundwater Sand | GLYAGLGALATIAARTVASRVWRVATGETPPAKK* |
| Ga0126313_1000018131 | 3300009840 | Serpentine Soil | MLRKLLWTGLYAGVGALATMLSRRVASRIWHVATGETPPTKK* |
| Ga0126313_117437752 | 3300009840 | Serpentine Soil | LLWTGLYASLGAAATIAARRVASRIWRIATGEAPPTKK* |
| Ga0126305_100075067 | 3300010036 | Serpentine Soil | MWTGLYAGLGAAATLAARRVASRIWRIATGEEPPTKK* |
| Ga0126305_102875533 | 3300010036 | Serpentine Soil | MVRKAMWTGLYAALGAAATFAARTLASKIWRVTTGEPPPVKK* |
| Ga0126305_109317382 | 3300010036 | Serpentine Soil | MLRRLTWTGLYAILGAVATVASRRLSSRIWRIATGEEPPTKK* |
| Ga0126304_100563936 | 3300010037 | Serpentine Soil | MLRKLFWTGLYAGLAAVASLAARRVASKIWRITTGEAPPAKK* |
| Ga0126309_100590371 | 3300010039 | Serpentine Soil | TGLYAGLGAAATLAARRLASRIWRIATGEEPPTRK* |
| Ga0126309_100864953 | 3300010039 | Serpentine Soil | MLRKLTWSALYAALGAAAAVGARAIASKIWRVTTGEEPPAKK* |
| Ga0126309_101077632 | 3300010039 | Serpentine Soil | MLRKLLWSGLYAALGAAAAIGARAAASKIWRATTGEEPPVKK* |
| Ga0126309_104505453 | 3300010039 | Serpentine Soil | MIRKAMWTGLYAGLGAAATIGARTVATRIWRVLTGEQPPVRR* |
| Ga0126309_105797452 | 3300010039 | Serpentine Soil | MLRKVLWTGLYSALGAAATLAARRLASRIWRIATGEDPPARK* |
| Ga0126309_107608342 | 3300010039 | Serpentine Soil | MLRKVMWTGLYASLGAAATLVARRLASRIWRIATGEEPPTRK* |
| Ga0126309_112079792 | 3300010039 | Serpentine Soil | MLRKLLWSGLYASLGAAATLAARRVASKIWRITTGEAPPVKK* |
| Ga0126308_100193965 | 3300010040 | Serpentine Soil | MLRRLTWTGLYALFGAVATVAARRLSSRIWRIATGEEPPTKR* |
| Ga0126308_102514982 | 3300010040 | Serpentine Soil | MLRKAMWTGLYASLGAAATLAARRLASRIWRIATGEEPPIKK* |
| Ga0126308_105555162 | 3300010040 | Serpentine Soil | MLRKLTWSTLYAVLGAAAAVGARAIASKIWRVTTGEEPPAKK* |
| Ga0126312_101874333 | 3300010041 | Serpentine Soil | MLRKLLWTGLYAGIGALATMLSRRVASRIWHVATGETPPTKK* |
| Ga0126312_102472791 | 3300010041 | Serpentine Soil | QPPRGKSWGMLRKLLWSGLYAALGAAAAVGARAAASKIWRATTGEEPPVKK* |
| Ga0126314_101164352 | 3300010042 | Serpentine Soil | MLRRLTWTGLYAILGAVATLASRRLSSRIWRIATGEEPPTKK* |
| Ga0126314_104619242 | 3300010042 | Serpentine Soil | MLRKFMWTGLYAALGAAATLITRRAATSIWRLATGEQPPTKK* |
| Ga0126380_107006472 | 3300010043 | Tropical Forest Soil | MLRRLVWTGLYASLAAAATLVARKTATKIWHVATGEEPPVKR* |
| Ga0126310_108812803 | 3300010044 | Serpentine Soil | MLRKVMWTGLYAGLGAASTLASRRLASRIWRVLTGEEPPTRK* |
| Ga0126310_109936332 | 3300010044 | Serpentine Soil | MLRRVTWTALYAVIAAASTLVARRVASRIWRIATGEEPP |
| Ga0126310_111661412 | 3300010044 | Serpentine Soil | MLRKVTWTALYASLGAAATLAARRLASRIWRIATGEEPPTRK* |
| Ga0126311_104034473 | 3300010045 | Serpentine Soil | MLRRVMWTGLYAGLGAAATIAARRVASRIWRIATGEAPPTKK* |
| Ga0126311_117463001 | 3300010045 | Serpentine Soil | MLRKLLWTGLYASLGAAATIAARRVASRIWRIATGEAPPTKK* |
| Ga0126321_10172441 | 3300010145 | Soil | KLLWTGLYAALGAAATIAARTLASRIWRIATGERPPVKR* |
| Ga0126321_12402521 | 3300010145 | Soil | GLYAGLGAAATIGARVVASRIWRIATGEKPPVKK* |
| Ga0126321_12847744 | 3300010145 | Soil | KLLWTGLYAGLGAGATLAARRVASRIWRIATGEEPPTKK* |
| Ga0126321_13497401 | 3300010145 | Soil | GLYAGLGAAATIGARAVASRVWRVATGEQPPVKK* |
| Ga0126321_13928154 | 3300010145 | Soil | KLLWTGLYAGIAALATIVARTLASRIWRVATGEAPPVKK* |
| Ga0126318_100533033 | 3300010152 | Soil | GLYAGFGALSTMAARRLASKVWRVTTGEEPPTKR* |
| Ga0126318_100629291 | 3300010152 | Soil | GLYAGLGAAATIASRRLASKIWRVTTGEEPPTKK* |
| Ga0126318_101815653 | 3300010152 | Soil | GLYAGLGAASTMVTRRLAAKVWHVATGEEPPTRR* |
| Ga0126318_101839731 | 3300010152 | Soil | GIYAGVGAGATIAARTVASRIWRVAHGEEPPAKR* |
| Ga0126318_101853154 | 3300010152 | Soil | AMWTGLYAGLGAASTMVTRRLAAKIWHVATGEEPPTKR* |
| Ga0126318_104352641 | 3300010152 | Soil | GLYAGLGAASTMITRRLATKIWRIATGEEPPTGR* |
| Ga0126318_104818661 | 3300010152 | Soil | TGLAAGLGAAASLASRRLASEIWRVATGEEPPTKK* |
| Ga0126318_108824123 | 3300010152 | Soil | LWSGLYAGFGAASSLVAYKFASTIWRVATGDEPPGTQ* |
| Ga0126318_110776501 | 3300010152 | Soil | ALYAAIGAAATLTARKTASSIWRLATGEEPPAKR* |
| Ga0126306_105255732 | 3300010166 | Serpentine Soil | MWTGLYAGLGAAATLAARRVASRIWRIATGEEPPT |
| Ga0134067_103071542 | 3300010321 | Grasslands Soil | MLRKVLWSSLYAGLGAAATIGARRVASSVWRLATGEEPPAKR* |
| Ga0134084_104084371 | 3300010322 | Grasslands Soil | SLYAGLGAAATIGARRVASSVWRLATGEEPPAKR* |
| Ga0134064_103751641 | 3300010325 | Grasslands Soil | SISFLLAAAATLAARKTASTIWRVATGEEPPVRK* |
| Ga0134111_101345451 | 3300010329 | Grasslands Soil | LWTGLYGGIAAGATVVARKTASKVWRLATGEEPPTTR* |
| Ga0134062_105116671 | 3300010337 | Grasslands Soil | MLRKLLWTSLYGGIAAGATVVARKTASTVWRIATGEEPPARK* |
| Ga0126377_103098172 | 3300010362 | Tropical Forest Soil | MLRKLLWTGLFSALGAAAAMGAHRTAAGIWKLATGEEPPERK* |
| Ga0134066_103151301 | 3300010364 | Grasslands Soil | MLRKLMWTVLYGVIGAAATLVARRSATKIWNILTGEEPPTKK* |
| Ga0134128_109977723 | 3300010373 | Terrestrial Soil | MLRKVLWSGLYAAFGAAATLGARRTASSIWRRATGDEPPQKR* |
| Ga0134126_104108572 | 3300010396 | Terrestrial Soil | MLRKILWTGLYAGISAIASLGARRTASSIWRLTTGEEPPTNK* |
| Ga0134126_121606403 | 3300010396 | Terrestrial Soil | GLYAGIAAGATVAARTLASRIWRVATGEEPPVKK* |
| Ga0134124_110385093 | 3300010397 | Terrestrial Soil | MGLYAGIAAGATFVARTLASRIWRVATGEEPPVKK* |
| Ga0134127_108080243 | 3300010399 | Terrestrial Soil | MLRKVMWTGLYAAIGAVATVAARTLASRIWRVTTGEQPPVKK* |
| Ga0134127_124764871 | 3300010399 | Terrestrial Soil | MLRQLLWTGLYGAIAALAPIVARKIATKIWGVATGEAPPAKT* |
| Ga0134123_110434703 | 3300010403 | Terrestrial Soil | MLRKVMWTGLYAAIGAVATVAARTLASRIWRVTTGEQPPMKK* |
| Ga0105246_106066611 | 3300011119 | Miscanthus Rhizosphere | MWTGLYAGLGAASTIVARRLATKVWQVATGEEPPTKR* |
| Ga0120156_10097265 | 3300011996 | Permafrost | MLRKLLWTGLYAALSAAATIAARRAASQIWRIATGETPPTK |
| Ga0136631_103958332 | 3300012043 | Polar Desert Sand | MLRKLLWTGLYAGLGAAATIGARRVASKIWRVTTGEAPPVKK* |
| Ga0136625_11944432 | 3300012091 | Polar Desert Sand | MLRKLLWTGLYASLAAAATMASRRAASRIWRIATGEEPPAKK* |
| Ga0136621_10152576 | 3300012092 | Polar Desert Sand | MLRKLLWTGLYASLAAAATMASRRAASRIWRIATGEEPPAKT* |
| Ga0136632_100393905 | 3300012093 | Polar Desert Sand | MLRKFLWSALYGALGAGATMVARRVASRVWRIATGEAPPAKR* |
| Ga0137382_112815442 | 3300012200 | Vadose Zone Soil | MLRKALWTGLYASIGAASTIVARRLASKVWRVTTGEEPPTKK* |
| Ga0137374_107668782 | 3300012204 | Vadose Zone Soil | MLRKAMWTGLYAGLGAAATLAARRLASRIWRIATGEEPPTKK* |
| Ga0137374_107730113 | 3300012204 | Vadose Zone Soil | MVLRKILWSGLYAGLGAAATIAARRAASSLWRIATGEEPPAKR* |
| Ga0137380_111972662 | 3300012206 | Vadose Zone Soil | MLRKLLWTGLYAGLGAGATIAARRAASTIWRITTGEAPPTKR* |
| Ga0137376_103989314 | 3300012208 | Vadose Zone Soil | MWNGLYGALAAAATLVARRTASKIWRVTTGEEPPVKRK* |
| Ga0150985_1035751421 | 3300012212 | Avena Fatua Rhizosphere | GLYAAVGAGATLAARRVSSTIWRVATGEEPPTRK* |
| Ga0150985_1046675833 | 3300012212 | Avena Fatua Rhizosphere | LWSGLYAGLGAAATVGARRVASSVWRLATGEEPPAKR* |
| Ga0150985_1046949041 | 3300012212 | Avena Fatua Rhizosphere | ILWSSLYAGAGAAATVASRRAATSIWRLATGEEPPAKR* |
| Ga0150985_1077253421 | 3300012212 | Avena Fatua Rhizosphere | KLLWTGLYAAMGALATLAARRVSASIWRIATGEEPPTKR* |
| Ga0150985_1077333721 | 3300012212 | Avena Fatua Rhizosphere | KLLWTALYAGMRALATLAARRVSASLWRIMTGEEPPTKK* |
| Ga0150985_1107647714 | 3300012212 | Avena Fatua Rhizosphere | MLRKAMWTGLYAGFGAASTMVARRLAAKVWQVATGEAPPTKK* |
| Ga0150985_1119615122 | 3300012212 | Avena Fatua Rhizosphere | MLRKALWTGLYAAIGAATTILARRVASKVWRIVTGEEPPTKK* |
| Ga0150985_1137986162 | 3300012212 | Avena Fatua Rhizosphere | ILWSALYAGLGAAATIGARRVASSVWRLATGEEPPAKR* |
| Ga0150985_1153357781 | 3300012212 | Avena Fatua Rhizosphere | KALWTGLYAGIGAAATVAARRVATKVWQGATGEDPPARK* |
| Ga0150985_1158652441 | 3300012212 | Avena Fatua Rhizosphere | KILWSGLYAGFGAAATIGARRVASSVWRLATGEEPPAKR* |
| Ga0150985_1159124451 | 3300012212 | Avena Fatua Rhizosphere | RRPREVVPMLRKVLWSGLYAGVGAVMTMAAQRAASTVWRLSTGETPPESR* |
| Ga0150985_1183960311 | 3300012212 | Avena Fatua Rhizosphere | LWSALYAGLGAMATMGARRVASSVWRLATGEEPPAKR* |
| Ga0150985_1197696596 | 3300012212 | Avena Fatua Rhizosphere | GLYAGAGAAATVASRRTATSIWRLATGEAPPAKR* |
| Ga0137366_101380743 | 3300012354 | Vadose Zone Soil | LPARAGGKAEDMVLRKILWSGLYAGLGAAATIAARRAASSLSRIATG* |
| Ga0137369_103523593 | 3300012355 | Vadose Zone Soil | VLRKLLWTGLYAGLGAAATIAARRLASRIWRILTGEEPPTKK* |
| Ga0137371_110213612 | 3300012356 | Vadose Zone Soil | MLRKLLWTGLYAGLGAGATIAARRAASTIWRIATGEAPPTKR* |
| Ga0137371_113519872 | 3300012356 | Vadose Zone Soil | MLRKAMWTGLYAAIGAAATLVARRLASKIWRIATGEAPPTKK* |
| Ga0150984_1029726965 | 3300012469 | Avena Fatua Rhizosphere | QTCALPISGLYAGLAAASTLATRRLASKIWRVATGEAPPTKR* |
| Ga0150984_1034011911 | 3300012469 | Avena Fatua Rhizosphere | PMLRKVLWSGLYAGLGAAATVGARRVASSVWRLATGEEPPAKR* |
| Ga0150984_1040320633 | 3300012469 | Avena Fatua Rhizosphere | KVMWSGLSASLLAASRLVTRRLAARIWHVATGEAPPAKR* |
| Ga0150984_1046443791 | 3300012469 | Avena Fatua Rhizosphere | GLYAAVGAGATVVARLLATRIWRVATGEEPPSKR* |
| Ga0150984_1079481941 | 3300012469 | Avena Fatua Rhizosphere | AMWTGLYAGLAAVSTLITRRIAAKIWYVATGEAPPTKK* |
| Ga0150984_1106593713 | 3300012469 | Avena Fatua Rhizosphere | LWTGLYAAMGALATLAARRASASIWRIATGEDPPTKK* |
| Ga0150984_1106697802 | 3300012469 | Avena Fatua Rhizosphere | LWTGLYAAMGALATLAARRVSASIWRIATGEEPPTKR* |
| Ga0150984_1106878295 | 3300012469 | Avena Fatua Rhizosphere | LWTGLYAAMGALATLAARRVSASLWRVMTGEEPPTKK* |
| Ga0150984_1111298541 | 3300012469 | Avena Fatua Rhizosphere | ILWSSLYAGVGAAATLASRRAATSIWRLATGEEPPAKR* |
| Ga0150984_1111793506 | 3300012469 | Avena Fatua Rhizosphere | LWTGLYAGIGAAATVAARRVATKVWQGATGEDPPARK* |
| Ga0150984_1124140841 | 3300012469 | Avena Fatua Rhizosphere | VCSSDLTGLYATLGAVATLASRRLSSRIWRIATGEEPPIKK* |
| Ga0150984_1192220502 | 3300012469 | Avena Fatua Rhizosphere | MVRKILWSALYAGLGAMATMGARRVASSVWRLTTGEEPPAKR* |
| Ga0150984_1207346461 | 3300012469 | Avena Fatua Rhizosphere | ILWSGLYVGAGAAATLASRRAASSIWRLATGEEPPAKR* |
| Ga0150984_1208718474 | 3300012469 | Avena Fatua Rhizosphere | YTGGQMLRKGMWMGLYAGIGALATLVARRLASSIWRIATGEEPPTKK* |
| Ga0150984_1214687531 | 3300012469 | Avena Fatua Rhizosphere | NLRIGALAWTGLSGILVAVGTIAARRAAAGIWRIATGEHPPTKKT* |
| Ga0150984_1226604701 | 3300012469 | Avena Fatua Rhizosphere | AMWQGLRAGLAAASALVTRRLASRIWRVATGEPPPVKR* |
| Ga0157344_10042942 | 3300012476 | Arabidopsis Rhizosphere | MLRKLLWLGLYAGLSAAATLVARKTASQVWRAATGEAPPVHK* |
| Ga0136630_12019943 | 3300012529 | Polar Desert Sand | MLRKLLWTGLYASLAAAATIASRRAASRIWRIATGEEPPAKK* |
| Ga0136613_100637972 | 3300012681 | Polar Desert Sand | MLRKLLWAGLYASLAAAATMASRRAASRIWRIATGEEPPAKT* |
| Ga0136614_1000561710 | 3300012684 | Polar Desert Sand | MLRRTLWTALFGLLGAVSTILSRRLASVIWRIATGETPPAKK* |
| Ga0137397_104522812 | 3300012685 | Vadose Zone Soil | MLRKALWTGLYAGIGAAATVAARRVASRIWRLMTGEEPPTKK* |
| Ga0157292_102754571 | 3300012900 | Soil | RAGMLLRKALWTGLYALLAAAATMASRRAASRIWRIATGEAPPAKK* |
| Ga0157291_102245271 | 3300012902 | Soil | MLLRKALWTGLYALLAAVATMASRRAASRIWRIATGEAPPAKR* |
| Ga0157286_102543593 | 3300012908 | Soil | GKRAGMLLRKALWTGLYALLAAAATMASRRAASRIWRIATGEAPPAKK* |
| Ga0137394_108723521 | 3300012922 | Vadose Zone Soil | MLRKALWTGLYAGIGAAATVAARRVASRIWRLMTGE |
| Ga0164299_104184112 | 3300012958 | Soil | MLRKLLWTGLYAGLAAGATMVARRTASKIWLVATGEAPPTKK* |
| Ga0164302_106950752 | 3300012961 | Soil | MLRKLLWTGLYAAVGAAATVAARRVATKVWQIATGEEPPTKT* |
| Ga0134110_102839923 | 3300012975 | Grasslands Soil | TGLYAGFGAAATIVARRAASTVYRLATGEEPPVKR* |
| Ga0154016_1428453 | 3300013045 | Corn, Switchgrass And Miscanthus Rhizosphere | TGLYAGLGAASTMVARRLASKIWRVTTGEEPPTKK* |
| Ga0157373_109636442 | 3300013100 | Corn Rhizosphere | MLRKVLWSGLYAAFGAAATLGARRTASSRWRRATGE |
| Ga0163162_110963734 | 3300013306 | Switchgrass Rhizosphere | LLWTGLYAGIAAGATIVARTLASRIWRVATGEEPPVKK* |
| Ga0157372_128743962 | 3300013307 | Corn Rhizosphere | MSMLRKMLWSGLYAVVGAVATLASRRAARSIWRLATGEQPPTTK* |
| Ga0182001_104462272 | 3300014488 | Soil | MLRKLLWTGLYAGLGAGATLAARRVASRVWRIATGEDPPTKK* |
| Ga0182008_100130025 | 3300014497 | Rhizosphere | MLRKLLWTGLYAGLGAAATVGARRTASSIWRLATGEEPPTKK* |
| Ga0182008_100725883 | 3300014497 | Rhizosphere | MLRKILWTGLYSGLGAVATIGARRAASSIWRIATGEEP |
| Ga0182008_101740112 | 3300014497 | Rhizosphere | MLRKILWTGLYSGIGAVATLGARRAASSIWRLATGEEPPTKK* |
| Ga0182008_108193182 | 3300014497 | Rhizosphere | MLRKLMWTGLYAGLAAAATMVARRTASQIWRIATGEEPPTKK* |
| Ga0173483_100794593 | 3300015077 | Soil | VLRKLLWTGLYAGIAAGATIVARTLASRIWRVATGEE |
| Ga0180093_10339123 | 3300015258 | Soil | MLLRKALWAGLYAALAAVATMASRRAASRIWRIATGEAPPVKR* |
| Ga0182005_12670521 | 3300015265 | Rhizosphere | MLRKLLWTGLYAGLAAGATMVARRAASGIWQAATGEAPPVKK* |
| Ga0134085_102027082 | 3300015359 | Grasslands Soil | MLRKLLWTSLYGGIAAGATVVARKTASTVWRIATGEDPPARQ* |
| Ga0132258_100173926 | 3300015371 | Arabidopsis Rhizosphere | MVRKILWSGLYAGIGAAATLGARRAATSIWRLATGEEPPAKR* |
| Ga0132258_107258821 | 3300015371 | Arabidopsis Rhizosphere | MLRKLLWLGLYAGLSAAATLAAKKTATQLWQAATGEAPPVRK* |
| Ga0132255_1044664093 | 3300015374 | Arabidopsis Rhizosphere | WTGLYGAIAALATIVAKKIATKIWNVATGEAPPAKT* |
| Ga0136617_100110737 | 3300017789 | Polar Desert Sand | MLRKLLWTGLYASLAAAATMASRRAASRIWRIATGEEPPAKK |
| Ga0163161_117396601 | 3300017792 | Switchgrass Rhizosphere | LAESSSGNDPGMLRKLLWTGLYAGLAAGATMVARRAASGIWHAATGEAPPVKK |
| Ga0187824_102599672 | 3300017927 | Freshwater Sediment | MRGLVRKAMWTGLYAGLGALATMGSRRAASLIWRKTTGEEPPTKK |
| Ga0190266_100116423 | 3300017965 | Soil | MLLRKALWTGLYAALAAVATMASRRAASRIWRIATGEAPPAKR |
| Ga0190266_106571032 | 3300017965 | Soil | MLRKLLWTGLYAAIGAAATLAARRVASKIWRIATGEAPPAKR |
| Ga0187776_100027303 | 3300017966 | Tropical Peatland | VLRKLLWTGLYTGLAAGATLAARRAASKIWTLATGEAPPAKR |
| Ga0184605_101107832 | 3300018027 | Groundwater Sediment | MLRKLLWTGLYAGLSAAAAIAARRVASQIWRIATGETPPTKK |
| Ga0187787_100669282 | 3300018029 | Tropical Peatland | LAKSSSGKQPGLLQKLLWTGLAAGATLAAHRAASKIWTLATGEAPPKKR |
| Ga0184617_12193602 | 3300018066 | Groundwater Sediment | MLLRKALWTGLYALLAAAATMASRRAASRIWRIATGEEPPAKK |
| Ga0184618_100076744 | 3300018071 | Groundwater Sediment | MLRKLLWTGLYAGLSAAAAIVARRVASQIWRIASGETPPTKK |
| Ga0184618_102757103 | 3300018071 | Groundwater Sediment | MLRKALWTGLYAALAAAATMASRRAASRIWRIATGE |
| Ga0184618_104471052 | 3300018071 | Groundwater Sediment | MWNGLYGALAAAATLAARRAASKIWRVTTGEEPPVK |
| Ga0184635_101608432 | 3300018072 | Groundwater Sediment | MLRKLLWTGLLAGLSAAATVAARRAATQLWRTATGEAPPVKKK |
| Ga0184632_104338831 | 3300018075 | Groundwater Sediment | MWTGLYASLAAAATLAARKTATKIWQVTTGEDPPVKK |
| Ga0184639_104886081 | 3300018082 | Groundwater Sediment | TGLYAGIAAGATIVARTLASRIWRVATGEEPPVKK |
| Ga0184628_102466972 | 3300018083 | Groundwater Sediment | MLLRKALWAGLYAALAAVATMASRRAASRIWRIATGEAPPVKR |
| Ga0190265_122712991 | 3300018422 | Soil | MLLRKALWTGLYALLAAAATMASRRAASRIWRIATGEPPPAKK |
| Ga0190272_132768072 | 3300018429 | Soil | MLLRKALWTGLYELLTAAATMASRRAACRIWRIATGEAAPAKK |
| Ga0066655_103068383 | 3300018431 | Grasslands Soil | MLRKLLWTSLYGGIAAGATVVARKTASTVWRIATGEEP |
| Ga0066655_107600952 | 3300018431 | Grasslands Soil | MLRKLLWTGLYAGFGAAATIVARRAASTVYRIATGEEPPVKR |
| Ga0066667_104310541 | 3300018433 | Grasslands Soil | TGLYGGIAAGATVIARKTASTVWRIATGEQPPARQ |
| Ga0066667_107174432 | 3300018433 | Grasslands Soil | VVIRKLLWTGLYAGLGAAATIGARTVASRIWRIATGEQPPVKK |
| Ga0190268_100144296 | 3300018466 | Soil | MLRKLRWTGLYASLAAAATMASRRAASRIWRIATGEEPPAKK |
| Ga0190268_101692891 | 3300018466 | Soil | MLLRKLLWTGLYAALAAAATMASRRAASRIWRIATGEAPPAKR |
| Ga0066662_102895542 | 3300018468 | Grasslands Soil | VLRKALWTGLYAGIGAASTIVARRVASKVWRIATGEEPPTKK |
| Ga0190270_100095388 | 3300018469 | Soil | MASRYACTVVLRKLMWTGLYASLAAAATLAARKTATKIWQVTTGEEPPVKKK |
| Ga0190270_100595575 | 3300018469 | Soil | MLLRKLLWTGLYAALAAVATMASRRAASRIWRIATGEAPPAKK |
| Ga0066669_106904371 | 3300018482 | Grasslands Soil | DMREFPVRATGKMGDAMVRKILWSGLYAGLGAAATLGARRAASSVWRLATGEEPPVKR |
| Ga0066669_110485323 | 3300018482 | Grasslands Soil | WSGLYAGLSAAATMTARRAASRIWRIATGEEPPTKK |
| Ga0066669_123757362 | 3300018482 | Grasslands Soil | MLRKLLWTGLYGGIAAGATVVARKTASKVWRLATGEEPPTTR |
| Ga0184643_12701991 | 3300019255 | Groundwater Sediment | LLWTGLYAGLAAAATIGARTVASRIWRIATGEQPPAKK |
| Ga0184643_14574723 | 3300019255 | Groundwater Sediment | TGLYGGLAAAATLAARRAASKIWRVTTGEEPPVKK |
| Ga0184642_11029974 | 3300019279 | Groundwater Sediment | NHKSMIRKLLWTGLYAGLAAAATIGARTVASRIWRIATGEQPPAKK |
| Ga0173482_105393052 | 3300019361 | Soil | MWTGLYAGISAGAAIAARRAATKIWMVVTGEEPPTKKT |
| Ga0173479_102164902 | 3300019362 | Soil | MLLRKALWTGLYALLAAAATMVSRRAASRIWRIATGEAPPAKK |
| Ga0190267_100366863 | 3300019767 | Soil | MLLRKLLWTGLYALLAAAATMASRRAASRIWRIATGEAPPAKK |
| Ga0193720_10027952 | 3300019868 | Soil | MLRKLLWTGLYAGLSAGATIAARRAASQIWRIATGETPPTKK |
| Ga0193741_10605172 | 3300019884 | Soil | MWTGLYASLAAAATLVARRAATKIWTVATGEEPPVKK |
| Ga0193729_11475253 | 3300019887 | Soil | MLRKLLWTALYAGFGAAATIAARRAASTVYRIATGEEPPVKK |
| Ga0193728_10564142 | 3300019890 | Soil | MLRKLLWTALYAGFGAAATIAARRAASTVYRIATGEEPPIKK |
| Ga0193735_10722731 | 3300020006 | Soil | VGNLTSMLRKLLWTGLYAGLSAGATIAARRAASQIWRIATGETPPTKK |
| Ga0197907_104783011 | 3300020069 | Corn, Switchgrass And Miscanthus Rhizosphere | KAMWTGLYAGLGAASTMVTRRLAAKIWHVATGEEPPTKR |
| Ga0197907_108200057 | 3300020069 | Corn, Switchgrass And Miscanthus Rhizosphere | MLRKVLWSGLYAAFGAAATLGARRTASSIWRRATGEEPPQKR |
| Ga0206356_105148064 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | VLWSGLYAAFGAAATLGARRTASSIWRRATGEEPPQKR |
| Ga0206356_105905138 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | MVRKVLWSGLYAAFGAAATLGARRTASSIWRRATGEEPPQKR |
| Ga0206356_108591503 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | MLRKALWSGLYAAFGAIATLGARRTASSIWRLATGEEPPQKR |
| Ga0206351_100694451 | 3300020077 | Corn, Switchgrass And Miscanthus Rhizosphere | RKAMWTGLYAGLGAASTMVTRRLAAKIWHVATGEEPPTKR |
| Ga0206352_112848393 | 3300020078 | Corn, Switchgrass And Miscanthus Rhizosphere | WTGLYAGLGAASTMVARRLASKIWRVTTGEEPPTKK |
| Ga0206353_108075352 | 3300020082 | Corn, Switchgrass And Miscanthus Rhizosphere | MLRKILWSGLYAGLGAAATVGARRVATSMWRLATGEEPPARR |
| Ga0206353_110433212 | 3300020082 | Corn, Switchgrass And Miscanthus Rhizosphere | MLRKAMWTGLYAGLGAASTMVARRLASKIWRVTTGEEPPTKK |
| Ga0182009_103471562 | 3300021445 | Soil | MLRKLLWTGLYAGLAAGATMVARRAASGIWQAATGEAPPVKK |
| Ga0182009_105308822 | 3300021445 | Soil | MLRKLAWTALYGILGAAATLAARRAAAGIWRIATGEQPPTKTR |
| Ga0222624_11698923 | 3300021951 | Groundwater Sediment | SASGNEPGMLRKLLWTGLLAGLSAAATVAARRAATQLWRTATGEAPPVKKK |
| Ga0222624_12894191 | 3300021951 | Groundwater Sediment | NDPGMLRKLLWTGLYAGLAAGATMLARRAASQLWRLATGEAPPVKK |
| Ga0222625_18142771 | 3300022195 | Groundwater Sediment | NEPGMLRKLLWTGLLAGLSAAATVAARRAATQLWRTATGEAPPVRK |
| Ga0224712_100685291 | 3300022467 | Corn, Switchgrass And Miscanthus Rhizosphere | AMWTGLYAGLGAASTMVARRLASKIWRVTTGEEPPTKK |
| Ga0224712_101058411 | 3300022467 | Corn, Switchgrass And Miscanthus Rhizosphere | LWSGLYAAFGAAATLGARRTASSIWRRATGEEPPQKR |
| Ga0224712_102337873 | 3300022467 | Corn, Switchgrass And Miscanthus Rhizosphere | WTGLYAGLGAASTMMARRLASKIWRVTTGEEPPTKK |
| Ga0222622_109615942 | 3300022756 | Groundwater Sediment | MLRKLLWTGLYAGLAAGATMVARRAASQLWRIATGEAPPVKK |
| Ga0247681_10052674 | 3300024310 | Soil | MLRKLLWTGLYAGLVAGATMVARRAASGIWQAATGEEPPVKK |
| Ga0207692_108626741 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | GERVDMLRKAMWTGLYAGLAAVSAVVARRDATRVWWVATGEEPPSKK |
| Ga0207645_108797381 | 3300025907 | Miscanthus Rhizosphere | GNEPGMLRKLLWTGLLAGLSAAATIAARRAATQLWRTATGEAPPVRK |
| Ga0207705_100552374 | 3300025909 | Corn Rhizosphere | MLRKILWSGLYAGLGAAATVGARRVASSVWRLATGEEPPAKR |
| Ga0207705_109486462 | 3300025909 | Corn Rhizosphere | MWTGLYAGLAAVSTLLTRRLASKIWRVATGEAPPTKR |
| Ga0207705_111866921 | 3300025909 | Corn Rhizosphere | MEGMLRKLLWSGLYAGLGAAATIGARRAASSIWRIATGEEPPTKK |
| Ga0207654_105414772 | 3300025911 | Corn Rhizosphere | MLRKAMWTGLYAGFGAASTMIARRLATKVWHVATGEEPPTKK |
| Ga0207707_105816332 | 3300025912 | Corn Rhizosphere | MLRKAMWTGLYAGFGAASTMIARRLATKVWHVATGEDPPTKK |
| Ga0207693_102464652 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MLRKLLWTALYAGFGAAATIVARKAASSVYRIATGEEPPTKK |
| Ga0207693_104941891 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | TLPRKPLLRKALWTGLYAGLGALATLASRRLAARIWRTVTGEEPPTKK |
| Ga0207663_107937293 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MTLPRKPLLRKALWTGLYAGLGALATLASRRLAARIWRTVTGEEPPTKK |
| Ga0207663_108725121 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | KLLWTGLLAGLSAAATFAARRTAAQLWRTATGEAPPVKKK |
| Ga0207657_103655202 | 3300025919 | Corn Rhizosphere | MRSVLRKLLWSGLYAGIGAAATIGARRAASSIWRAATGEEPPTKR |
| Ga0207657_104191242 | 3300025919 | Corn Rhizosphere | MEAMLRKLLWSGLYAGLGAAATIGARRVASSIWRIATGEQPPTKK |
| Ga0207657_114049942 | 3300025919 | Corn Rhizosphere | MLRKILWSGLYAGLGAAATVGARRVATSMWRLATGEEP |
| Ga0207646_114350862 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MLRKLLWSALYAGLSAAAALGTRRAASRIWPIATGEEPPTKK |
| Ga0207664_106022603 | 3300025929 | Agricultural Soil | MLRKAMWTGLYAGLAAVSAVVARRVATRVWWVATGEEPPSKK |
| Ga0207664_108216241 | 3300025929 | Agricultural Soil | MLRKILWSGLYAGFGAAATIGARRVASSVWRLATGEEPPAKR |
| Ga0207644_110651522 | 3300025931 | Switchgrass Rhizosphere | MLRKLLWTGLYSAVGAAATVVARRVATKVWHIATGEEPPTKK |
| Ga0207644_112133532 | 3300025931 | Switchgrass Rhizosphere | MLRKLLWTGLYAAVGAAATVAARRVATKVWQIATGEEPPTKK |
| Ga0207644_115213221 | 3300025931 | Switchgrass Rhizosphere | ELSSGNDPGMLRKLLWTGLYAGLAAGATMVARRAASGIWHAATGEAPPVKK |
| Ga0207690_114710331 | 3300025932 | Corn Rhizosphere | RKAMWTGLYAGLGAASTIVARRLATKVWQVATGEEPPTKR |
| Ga0207709_101947405 | 3300025935 | Miscanthus Rhizosphere | SASGNEPGMLRKLLWTGLLAGLSAAATFAARRTAAQLWRTATGEAPPVKKK |
| Ga0207689_101985153 | 3300025942 | Miscanthus Rhizosphere | MLRKLLWTGLYAGLAAGATMVARRAASGIWHAATGEAPPVRK |
| Ga0207702_117570902 | 3300026078 | Corn Rhizosphere | MLRKAMWTGLYAGLGAASTMMARRLASKIWRVTTGEEPPTKK |
| Ga0207683_110470443 | 3300026121 | Miscanthus Rhizosphere | KALWTGLYALLAAAATMASRRAASRIWRIATGEAPPAKK |
| Ga0209153_10123082 | 3300026312 | Soil | MPGKGGVAVLRKALWSGLYAGFGAVATIVSRRAAAKVWEIGTGEEPPTKK |
| Ga0209153_11042921 | 3300026312 | Soil | VLRKLLWTGLYSGLAAGATIAARRAASKIWTVATGEQPP |
| Ga0209473_10287343 | 3300026330 | Soil | MLRKLLWTALYAGFGAGATMVARKAASSVYRIATGEEPPTKR |
| Ga0209056_103274572 | 3300026538 | Soil | MLRKLLWTGLYAGLGAGATVAARRAASRFWGLATGEEPPTKK |
| Ga0209376_12315032 | 3300026540 | Soil | MLRKLLWTGLYAGFGAAATIVARRAASTVYRLATGEEPPVKR |
| Ga0209156_101493291 | 3300026547 | Soil | ARAKEMLLRKVLWSGLYAGLGAAATIAARRAASSLWRIATGEDPPAKR |
| Ga0209474_101697062 | 3300026550 | Soil | VLRKALWTGLYASIGAASTIVARRIASKVWRIATGEEPPTKK |
| Ga0209474_103270832 | 3300026550 | Soil | MLRKALWTGLYAGVGAAATVAARRVSSKIWRLATGEEPPTKK |
| Ga0209818_10615153 | 3300027637 | Agricultural Soil | MLLRKLLWTGLYAALAAAATMASRRAASRIWRIATGEAPPAKK |
| Ga0209810_1000015349 | 3300027773 | Surface Soil | MWTGLYAGLGAASTMVSRRLASKIWRVMTGEEPPTKK |
| Ga0209177_105088642 | 3300027775 | Agricultural Soil | KIGSSMLRKILWAGLYAGLAAAATMTARRAATSIWRLATGEEPPQKR |
| Ga0209074_100093485 | 3300027787 | Agricultural Soil | MLRKLLWTGLYAGLAAGATMVARRAASGIWHAATGEAPPVKK |
| Ga0209481_106030452 | 3300027880 | Populus Rhizosphere | MWTGLYAALAAAATAGARKVAAKIWRTVTGEHPPVKAR |
| Ga0207428_101099353 | 3300027907 | Populus Rhizosphere | MLRKLLWTGLLAGLSAVAAIAARRTADQVWRVLTGEEPPAKK |
| Ga0207428_104327093 | 3300027907 | Populus Rhizosphere | MLRKLLWTGLYGAIAALATIVARKIATKIWGVATGESPPAKT |
| Ga0207428_105007872 | 3300027907 | Populus Rhizosphere | LAESPTGNHPGVLRKLLWLGLYAGLSAAATLVARKTASQVWRAATGEAPPVKKK |
| Ga0247713_10251033 | 3300028104 | Soil | MRRLLWKGLYAGIAAGATIIARSVAAKVWRTATGERPPEK |
| Ga0307322_100433414 | 3300028710 | Soil | IRKLLWTGLYAGLAAAATIGARTVASRIWRIATGEQPPAKK |
| Ga0307313_101841911 | 3300028715 | Soil | AGLLAGLSAAATFAARRTAAQLWRTATGEAPPVKKK |
| Ga0307298_101059162 | 3300028717 | Soil | MLRKLLWSGLYAGLSAAAAIAARRVASQIWRIATGETPPTKK |
| Ga0307319_102741382 | 3300028722 | Soil | MLLRKALWTGLYALLAAVATMASRRAASRIWRIATGEAPPAKK |
| Ga0307316_101074043 | 3300028755 | Soil | MLRKLLWAGLLAGLSAAATFAARRTAAQLWRTATGEAPPVKKK |
| Ga0307282_101261213 | 3300028784 | Soil | VLRKLLWTGLYAGLSAAATIAARRAASQIWRIATGETPPTKK |
| Ga0307282_102855942 | 3300028784 | Soil | MLRKLLWTGLYASLSAGAAIAARRVASQIWRIATGETPPTKK |
| Ga0307290_100619215 | 3300028791 | Soil | GLAESASGNEPGMLRKLLWTGLLAGLSAAATVAARRAATQLWRTATGEAPPVKKK |
| Ga0307284_102579063 | 3300028799 | Soil | HPVLRKLMWTGLYGGLAAAATLAARRAASKIWRVTTGEEPPVKK |
| Ga0307305_100907102 | 3300028807 | Soil | MIRKLLWTGLYAGLGAAATIGARTVASRIWRIATGEQPPVKK |
| Ga0307305_101514813 | 3300028807 | Soil | MLRKLLWTGLYAGLSAGAAIAARRAASQIWRIATGETPPTKK |
| Ga0307305_102215552 | 3300028807 | Soil | MWNGLYGALAAAATLAARRAASKIWRVTTGEEPPLKRK |
| Ga0307292_102324381 | 3300028811 | Soil | LMWSGLYGTLAAAASMAARKTASKIWRVTTGEEPPVKKK |
| Ga0247825_114140631 | 3300028812 | Soil | MLRKLLWTGLYGAIAALATIVAKKIATKIWNVATGEAPPAKT |
| Ga0307302_102239273 | 3300028814 | Soil | MWTGLYAGIGAAATIAARRIASRIWRIATGEEPPTKK |
| Ga0307312_108261642 | 3300028828 | Soil | VLRKLMWTGLYGGLAAAATIAARRAASKIWRVTTGEEPPVKK |
| Ga0307286_101416153 | 3300028876 | Soil | LAESASGNEPGMLRKLLWAGLLAGLSAAATFAARRTAAQLWRTATGEAPPVKKK |
| Ga0307278_100201188 | 3300028878 | Soil | VIRKLLWTGLYAGLGAAATIGARTVASRIWRIATGEQPPVKK |
| Ga0307277_100196853 | 3300028881 | Soil | MLRKLLWTGLYGALGAAATLAARRAASQIWRIATGEEPPTKR |
| Ga0307277_102356062 | 3300028881 | Soil | MLRKLLWTGLYAGLGAAATIGARTVASRIWRIATGEQPPVKK |
| Ga0307277_104115941 | 3300028881 | Soil | RKILWSGLYAGIGAAATIGARRAASSIWRLATGEEPPAKR |
| Ga0307308_105823222 | 3300028884 | Soil | MLRKLLWTGLYASLSAVAAIAARRVASQIWRIATGETPPTKK |
| Ga0299907_101333463 | 3300030006 | Soil | VLRKLLWTGLYAGLGAAATIGARKVASRIWRVTTGEEPPVKK |
| Ga0247826_113358182 | 3300030336 | Soil | VLRKLLWTGLLAGFTAAAALAAKKSAAQVWRLLTGEEPPAKK |
| Ga0102752_15555631 | 3300030783 | Soil | PGLYAGLGAAATIGVRRVASKVWRVATGEAPPTKK |
| Ga0308203_10117531 | 3300030829 | Soil | LLWTGLYAGIAAGATIVARTLASRIWRVATGEEPPVKK |
| Ga0308202_10290371 | 3300030902 | Soil | GLLAGLSAAATVAARRAATQLWRTATGEAPPVKKK |
| Ga0308201_100178561 | 3300031091 | Soil | KLLWTGLLAGLSAAATVAARRAATQLWRTATGEAPPVKKK |
| Ga0308201_100715851 | 3300031091 | Soil | LLWTGLYAGIAAGATVVARTLASRIWRVATGEEPPVKK |
| Ga0308201_100950323 | 3300031091 | Soil | SASGNEPGMLRKLLWTGLLAGLTAAATFAARRTAAQLWRTATGEAPPVKKK |
| Ga0308201_102192081 | 3300031091 | Soil | LLWTGLYAGLAAGATMVARRAASQLWRIATGEAPPVKK |
| Ga0308201_102202101 | 3300031091 | Soil | RASGLYAGLSAGATIAARRAASQIWRIATGETPPTKK |
| Ga0308204_102352423 | 3300031092 | Soil | DSASGNEPGMLRKLLWTGLLAGLTAAATFAARRTAAQLWRTATGEAPPVKKK |
| Ga0308197_100505491 | 3300031093 | Soil | MLLWTGLYAGIAAGATIVARTLASRIWRVATGEEPPVKK |
| Ga0308187_101079583 | 3300031114 | Soil | ASGNEPGMLRKLLWTGLLAGLSAAATVAARRAATQLWRTATGEAPPVRK |
| Ga0307506_101874381 | 3300031366 | Soil | MWTGLYAGLAAISTLATRRLASTIWRVATGEAPPIKK |
| Ga0307408_1002966542 | 3300031548 | Rhizosphere | MLRKAMWTGLYASLGAAATLAARRLASRIWRIATGEEPPIKK |
| Ga0307408_1003150374 | 3300031548 | Rhizosphere | MLRKAMWTGLYAALGAAATFAARTLASKIWRLTTGEPPPVKK |
| Ga0310904_105932603 | 3300031854 | Soil | MLLRKALWTGLYALLAAIATMASRRAASRIWRIATGEAPPAKR |
| Ga0307407_110938391 | 3300031903 | Rhizosphere | WTGLYASLGAAATLAARRLASRIWRIATGEEPPIKK |
| Ga0308175_1001173322 | 3300031938 | Soil | MLRKVLWSGLYAAFGAAATLGARRTASSIWRRATGGEPPQKR |
| Ga0308175_1003206903 | 3300031938 | Soil | MLRKLLWTGLYAGLAAGATMVARRAASGIWHAATGEAPPVKKK |
| Ga0308175_1006102913 | 3300031938 | Soil | MLRKILWSGLYAGVGAAATVGARRVASSVWRLATGEEPPAKR |
| Ga0308175_1006819942 | 3300031938 | Soil | MLRKILWNGLYAGMSAVASLGARRAASSVWRLATGEEPPTKK |
| Ga0308175_1022658661 | 3300031938 | Soil | MLRKALWSGLYAGVGAVSSLVAYRFASTVWRAATGDEPPGEQ |
| Ga0308176_111007251 | 3300031996 | Soil | LRKVLWSGLYAAFGAAATLGARRTASSIWRRATGGEPPQKR |
| Ga0308176_116607932 | 3300031996 | Soil | MLRKILWSGLYAGLGAAATIGARRVASSVWRLATGEEPPAKR |
| Ga0310906_111658581 | 3300032013 | Soil | VLRKLLWTGLYAGIAAGATIAARTLASRIWRVATG |
| Ga0308173_103279604 | 3300032074 | Soil | MVRKILWSALYAGLGAAATIGARRVASSVWRLATGEEPPAKR |
| Ga0308173_109841093 | 3300032074 | Soil | MVRKVLWSGLYAGLGAAATIGARRVATSVWRLATGEEPPAKR |
| Ga0310890_106013582 | 3300032075 | Soil | MLRKLMWTGLYAAIAAAATVAARTVASKIWRAATGEPPPVK |
| Ga0326721_105926652 | 3300032080 | Soil | MLRKLMWTGLYAALGAAATIAARTVASRIWRVVTGEQPPVKK |
| Ga0335080_102908333 | 3300032828 | Soil | VLRKLLWTGLYTGLAAGATLAAHRAASKIWTLATGEAPPRKR |
| Ga0335080_114074462 | 3300032828 | Soil | VLQKLLWTGLYSGLAAGATLAAHRTAAKIWTLATGEPPPKKKR |
| Ga0335080_123849942 | 3300032828 | Soil | ALYGIFGALATLVARRAAAGVWRIATGEQPPVKKR |
| Ga0335069_119284822 | 3300032893 | Soil | MHRKLVHKLAWTGLYAGVSALATVAARRVASRLWRAGTGEAPPAPR |
| Ga0310811_113580602 | 3300033475 | Soil | HMLRKAMWTGLYAGLGAASTMVTRRLAAKIWHVATGEEPPTKR |
| Ga0247830_113666413 | 3300033551 | Soil | KLMYTGLYAAIAAAATVAARTVASKIWRVTTGEPPPVKK |
| Ga0364937_056516_213_341 | 3300034113 | Sediment | MLRKLLWAGLYAAIGAAATIAARQVASRVWRILTGEEPPTKK |
| Ga0364929_0358835_82_213 | 3300034149 | Sediment | MLRKLLWTGLYGSLAAAASLVARRTATKIWRVTTGEEPPVKKK |
| Ga0372943_0081646_1670_1798 | 3300034268 | Soil | MLRKILWSGLYVGFGAVATIGARRVASSVWRLTTGEEPPAKR |
| Ga0372943_1223871_169_297 | 3300034268 | Soil | MLRKLLWTGLYAVFGALATLAARRAATGIWRMATGEEPPAKR |
| ⦗Top⦘ |