


| Basic Information | |
|---|---|
| Family ID | F004253 |
| Family Type | Metagenome |
| Number of Sequences | 446 |
| Average Sequence Length | 44 residues |
| Representative Sequence | PNKQLQRTVTRRRGDGASAPFHYALAPRITRQRAAAELRR |
| Number of Associated Samples | 223 |
| Number of Associated Scaffolds | 440 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 40.59 % |
| % of genes near scaffold ends (potentially truncated) | 68.61 % |
| % of genes from short scaffolds (< 2000 bps) | 83.86 % |
| Associated GOLD sequencing projects | 202 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.27 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (55.381 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (19.282 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.457 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (37.668 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 39.71% β-sheet: 0.00% Coil/Unstructured: 60.29% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.27 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 440 Family Scaffolds |
|---|---|---|
| PF02371 | Transposase_20 | 4.77 |
| PF14384 | BrnA_antitoxin | 2.95 |
| PF00903 | Glyoxalase | 2.27 |
| PF04365 | BrnT_toxin | 1.82 |
| PF07927 | HicA_toxin | 1.59 |
| PF13302 | Acetyltransf_3 | 1.59 |
| PF01230 | HIT | 1.36 |
| PF00583 | Acetyltransf_1 | 1.14 |
| PF14567 | SUKH_5 | 1.14 |
| PF14106 | DUF4279 | 1.14 |
| PF05973 | Gp49 | 0.91 |
| PF01661 | Macro | 0.68 |
| PF00005 | ABC_tran | 0.68 |
| PF13420 | Acetyltransf_4 | 0.68 |
| PF00293 | NUDIX | 0.68 |
| PF14552 | Tautomerase_2 | 0.68 |
| PF09313 | DUF1971 | 0.45 |
| PF05163 | DinB | 0.45 |
| PF14137 | DUF4304 | 0.45 |
| PF13673 | Acetyltransf_10 | 0.45 |
| PF03740 | PdxJ | 0.45 |
| PF12681 | Glyoxalase_2 | 0.45 |
| PF10675 | DUF2489 | 0.45 |
| PF06983 | 3-dmu-9_3-mt | 0.45 |
| PF03544 | TonB_C | 0.45 |
| PF07661 | MORN_2 | 0.45 |
| PF04828 | GFA | 0.45 |
| PF13936 | HTH_38 | 0.45 |
| PF13683 | rve_3 | 0.45 |
| PF12697 | Abhydrolase_6 | 0.45 |
| PF13432 | TPR_16 | 0.45 |
| PF01381 | HTH_3 | 0.45 |
| PF05598 | DUF772 | 0.45 |
| PF02661 | Fic | 0.45 |
| PF06271 | RDD | 0.45 |
| PF13751 | DDE_Tnp_1_6 | 0.45 |
| PF01925 | TauE | 0.23 |
| PF08238 | Sel1 | 0.23 |
| PF02627 | CMD | 0.23 |
| PF00873 | ACR_tran | 0.23 |
| PF14437 | MafB19-deam | 0.23 |
| PF16985 | DUF5086 | 0.23 |
| PF01548 | DEDD_Tnp_IS110 | 0.23 |
| PF12713 | DUF3806 | 0.23 |
| PF01527 | HTH_Tnp_1 | 0.23 |
| PF00756 | Esterase | 0.23 |
| PF14119 | DUF4288 | 0.23 |
| PF06094 | GGACT | 0.23 |
| PF15593 | Imm42 | 0.23 |
| PF02347 | GDC-P | 0.23 |
| PF12796 | Ank_2 | 0.23 |
| PF00150 | Cellulase | 0.23 |
| PF09609 | Cas_GSU0054 | 0.23 |
| PF09951 | DUF2185 | 0.23 |
| PF02594 | DUF167 | 0.23 |
| PF12305 | DUF3630 | 0.23 |
| PF16655 | PhoD_N | 0.23 |
| PF14206 | Cys_rich_CPCC | 0.23 |
| PF13924 | Lipocalin_5 | 0.23 |
| PF16804 | DUF5071 | 0.23 |
| PF05708 | Peptidase_C92 | 0.23 |
| PF04255 | DUF433 | 0.23 |
| PF04471 | Mrr_cat | 0.23 |
| PF09965 | DUF2199 | 0.23 |
| PF09346 | SMI1_KNR4 | 0.23 |
| PF03992 | ABM | 0.23 |
| PF07929 | PRiA4_ORF3 | 0.23 |
| PF09720 | Unstab_antitox | 0.23 |
| PF01965 | DJ-1_PfpI | 0.23 |
| PF00303 | Thymidylat_synt | 0.23 |
| PF07883 | Cupin_2 | 0.23 |
| PF08570 | DUF1761 | 0.23 |
| PF08334 | T2SSG | 0.23 |
| PF01297 | ZnuA | 0.23 |
| PF13527 | Acetyltransf_9 | 0.23 |
| PF15590 | Imm27 | 0.23 |
| PF15919 | HicB_lk_antitox | 0.23 |
| PF06966 | DUF1295 | 0.23 |
| PF04229 | GrpB | 0.23 |
| PF01609 | DDE_Tnp_1 | 0.23 |
| PF08482 | HrpB_C | 0.23 |
| PF04191 | PEMT | 0.23 |
| PF11042 | DUF2750 | 0.23 |
| PF01323 | DSBA | 0.23 |
| PF05656 | DUF805 | 0.23 |
| PF13419 | HAD_2 | 0.23 |
| PF02798 | GST_N | 0.23 |
| PF02694 | UPF0060 | 0.23 |
| PF13560 | HTH_31 | 0.23 |
| PF13508 | Acetyltransf_7 | 0.23 |
| PF12395 | DUF3658 | 0.23 |
| PF11225 | DUF3024 | 0.23 |
| PF03073 | TspO_MBR | 0.23 |
| COG ID | Name | Functional Category | % Frequency in 440 Family Scaffolds |
|---|---|---|---|
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 5.00 |
| COG2929 | Ribonuclease BrnT, toxin component of the BrnT-BrnA toxin-antitoxin system | Defense mechanisms [V] | 1.82 |
| COG1724 | Predicted RNA binding protein YcfA, dsRBD-like fold, HicA-like mRNA interferase family | General function prediction only [R] | 1.59 |
| COG3657 | Putative component of the toxin-antitoxin plasmid stabilization module | Defense mechanisms [V] | 0.91 |
| COG4679 | Phage-related protein gp49, toxin component of the Tad-Ata toxin-antitoxin system | Defense mechanisms [V] | 0.91 |
| COG2110 | O-acetyl-ADP-ribose deacetylase (regulator of RNase III), contains Macro domain | Translation, ribosomal structure and biogenesis [J] | 0.68 |
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 0.45 |
| COG0854 | Pyridoxine 5'-phosphate synthase PdxJ | Coenzyme transport and metabolism [H] | 0.45 |
| COG1714 | Uncharacterized membrane protein YckC, RDD family | Function unknown [S] | 0.45 |
| COG2318 | Bacillithiol/mycothiol S-transferase BstA/DinB, DinB/YfiT family (unrelated to E. coli DinB) | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.45 |
| COG2764 | Zn-dependent glyoxalase, PhnB family | Energy production and conversion [C] | 0.45 |
| COG2849 | Antitoxin component YwqK of the YwqJK toxin-antitoxin module | Defense mechanisms [V] | 0.45 |
| COG3615 | Tellurite resistance protein TehB, SAM-dependent methylase, cupin superfamily | Inorganic ion transport and metabolism [P] | 0.45 |
| COG3791 | Uncharacterized conserved protein | Function unknown [S] | 0.45 |
| COG3865 | Glyoxalase superfamily enzyme, possible 3-demethylubiquinone-9 3-methyltransferase | General function prediction only [R] | 0.45 |
| COG0207 | Thymidylate synthase | Nucleotide transport and metabolism [F] | 0.23 |
| COG0403 | Glycine cleavage system protein P (pyridoxal-binding), N-terminal domain | Amino acid transport and metabolism [E] | 0.23 |
| COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 0.23 |
| COG0730 | Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 family | Inorganic ion transport and metabolism [P] | 0.23 |
| COG1003 | Glycine cleavage system protein P (pyridoxal-binding), C-terminal domain | Amino acid transport and metabolism [E] | 0.23 |
| COG1643 | HrpA-like RNA helicase | Translation, ribosomal structure and biogenesis [J] | 0.23 |
| COG1742 | Uncharacterized inner membrane protein YnfA, drug/metabolite transporter superfamily | General function prediction only [R] | 0.23 |
| COG1872 | Uncharacterized conserved protein YggU, UPF0235/DUF167 family | Function unknown [S] | 0.23 |
| COG2020 | Protein-S-isoprenylcysteine O-methyltransferase Ste14 | Posttranslational modification, protein turnover, chaperones [O] | 0.23 |
| COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 0.23 |
| COG2320 | GrpB domain, predicted nucleotidyltransferase, UPF0157 family | General function prediction only [R] | 0.23 |
| COG2442 | Predicted antitoxin component of a toxin-antitoxin system, DUF433 family | Defense mechanisms [V] | 0.23 |
| COG2730 | Aryl-phospho-beta-D-glucosidase BglC, GH1 family | Carbohydrate transport and metabolism [G] | 0.23 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.23 |
| COG3152 | Uncharacterized membrane protein YhaH, DUF805 family | Function unknown [S] | 0.23 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.23 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.23 |
| COG3476 | Tryptophan-rich sensory protein TspO/CrtK (mitochondrial benzodiazepine receptor homolog) | Signal transduction mechanisms [T] | 0.23 |
| COG3752 | Steroid 5-alpha reductase family enzyme | General function prediction only [R] | 0.23 |
| COG3934 | Endo-1,4-beta-mannosidase | Carbohydrate transport and metabolism [G] | 0.23 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.23 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.23 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.23 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 55.38 % |
| Unclassified | root | N/A | 44.62 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459021|G14TP7Y01A1YWO | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300000208|NICFPass4AFXDRAFT_c009255 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 3606 | Open in IMG/M |
| 3300000890|JGI11643J12802_10151131 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter → unclassified Lysobacter → Lysobacter sp. | 501 | Open in IMG/M |
| 3300000890|JGI11643J12802_10654514 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas phragmitis | 517 | Open in IMG/M |
| 3300000891|JGI10214J12806_10591393 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1826 | Open in IMG/M |
| 3300000956|JGI10216J12902_109152985 | Not Available | 967 | Open in IMG/M |
| 3300003203|JGI25406J46586_10208887 | Not Available | 571 | Open in IMG/M |
| 3300003989|Ga0055473_10189566 | Not Available | 664 | Open in IMG/M |
| 3300004004|Ga0055451_10469648 | Not Available | 518 | Open in IMG/M |
| 3300004014|Ga0055456_10313585 | Not Available | 558 | Open in IMG/M |
| 3300004047|Ga0055499_10099429 | Not Available | 536 | Open in IMG/M |
| 3300004058|Ga0055498_10054339 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 716 | Open in IMG/M |
| 3300004066|Ga0055484_10022317 | All Organisms → cellular organisms → Bacteria | 1222 | Open in IMG/M |
| 3300004114|Ga0062593_100100664 | All Organisms → cellular organisms → Bacteria | 2036 | Open in IMG/M |
| 3300004156|Ga0062589_100205451 | All Organisms → cellular organisms → Bacteria | 1427 | Open in IMG/M |
| 3300004156|Ga0062589_101046843 | All Organisms → cellular organisms → Bacteria | 767 | Open in IMG/M |
| 3300004463|Ga0063356_100944286 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1224 | Open in IMG/M |
| 3300004463|Ga0063356_102916540 | Not Available | 737 | Open in IMG/M |
| 3300004463|Ga0063356_102949125 | Not Available | 733 | Open in IMG/M |
| 3300004463|Ga0063356_103449637 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 681 | Open in IMG/M |
| 3300004480|Ga0062592_100074649 | All Organisms → cellular organisms → Bacteria | 1979 | Open in IMG/M |
| 3300004480|Ga0062592_102566930 | Not Available | 513 | Open in IMG/M |
| 3300005093|Ga0062594_102062549 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae | 612 | Open in IMG/M |
| 3300005218|Ga0068996_10076120 | Not Available | 714 | Open in IMG/M |
| 3300005290|Ga0065712_10225726 | All Organisms → cellular organisms → Bacteria | 1027 | Open in IMG/M |
| 3300005330|Ga0070690_101442839 | Not Available | 555 | Open in IMG/M |
| 3300005331|Ga0070670_100862428 | Not Available | 820 | Open in IMG/M |
| 3300005331|Ga0070670_101401711 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
| 3300005332|Ga0066388_107307815 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 555 | Open in IMG/M |
| 3300005334|Ga0068869_100212945 | All Organisms → cellular organisms → Bacteria | 1528 | Open in IMG/M |
| 3300005336|Ga0070680_100032943 | All Organisms → cellular organisms → Bacteria | 4172 | Open in IMG/M |
| 3300005337|Ga0070682_100594486 | Not Available | 873 | Open in IMG/M |
| 3300005337|Ga0070682_100923997 | Not Available | 719 | Open in IMG/M |
| 3300005337|Ga0070682_101133167 | Not Available | 657 | Open in IMG/M |
| 3300005341|Ga0070691_10438106 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
| 3300005341|Ga0070691_11105565 | Not Available | 500 | Open in IMG/M |
| 3300005343|Ga0070687_100577384 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 769 | Open in IMG/M |
| 3300005343|Ga0070687_100713059 | Not Available | 702 | Open in IMG/M |
| 3300005343|Ga0070687_101382220 | Not Available | 526 | Open in IMG/M |
| 3300005345|Ga0070692_10192367 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1189 | Open in IMG/M |
| 3300005353|Ga0070669_100323662 | All Organisms → cellular organisms → Bacteria | 1246 | Open in IMG/M |
| 3300005354|Ga0070675_101880607 | Not Available | 552 | Open in IMG/M |
| 3300005365|Ga0070688_100517050 | Not Available | 903 | Open in IMG/M |
| 3300005365|Ga0070688_100677308 | Not Available | 797 | Open in IMG/M |
| 3300005438|Ga0070701_10003920 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5948 | Open in IMG/M |
| 3300005438|Ga0070701_10016071 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 3471 | Open in IMG/M |
| 3300005438|Ga0070701_10258444 | All Organisms → cellular organisms → Bacteria | 1054 | Open in IMG/M |
| 3300005438|Ga0070701_10457235 | All Organisms → cellular organisms → Bacteria | 821 | Open in IMG/M |
| 3300005438|Ga0070701_10618099 | Not Available | 720 | Open in IMG/M |
| 3300005438|Ga0070701_10939118 | Not Available | 599 | Open in IMG/M |
| 3300005438|Ga0070701_11316884 | Not Available | 517 | Open in IMG/M |
| 3300005441|Ga0070700_101450587 | All Organisms → cellular organisms → Bacteria → PVC group | 582 | Open in IMG/M |
| 3300005441|Ga0070700_101657024 | Not Available | 548 | Open in IMG/M |
| 3300005444|Ga0070694_100314435 | Not Available | 1203 | Open in IMG/M |
| 3300005444|Ga0070694_101707566 | Not Available | 536 | Open in IMG/M |
| 3300005444|Ga0070694_101859415 | Not Available | 514 | Open in IMG/M |
| 3300005458|Ga0070681_11315976 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
| 3300005459|Ga0068867_100861084 | All Organisms → cellular organisms → Bacteria | 813 | Open in IMG/M |
| 3300005459|Ga0068867_102238221 | Not Available | 519 | Open in IMG/M |
| 3300005543|Ga0070672_101542373 | Not Available | 596 | Open in IMG/M |
| 3300005543|Ga0070672_101767632 | Not Available | 556 | Open in IMG/M |
| 3300005546|Ga0070696_100084808 | All Organisms → cellular organisms → Bacteria | 2248 | Open in IMG/M |
| 3300005546|Ga0070696_101367629 | Not Available | 603 | Open in IMG/M |
| 3300005546|Ga0070696_101449145 | Not Available | 587 | Open in IMG/M |
| 3300005546|Ga0070696_101612877 | Not Available | 557 | Open in IMG/M |
| 3300005548|Ga0070665_100379153 | All Organisms → cellular organisms → Bacteria | 1421 | Open in IMG/M |
| 3300005549|Ga0070704_100329197 | Not Available | 1282 | Open in IMG/M |
| 3300005549|Ga0070704_100499153 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax | 1055 | Open in IMG/M |
| 3300005549|Ga0070704_100603931 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 965 | Open in IMG/M |
| 3300005549|Ga0070704_100749070 | All Organisms → cellular organisms → Bacteria | 870 | Open in IMG/M |
| 3300005549|Ga0070704_101922301 | Not Available | 549 | Open in IMG/M |
| 3300005577|Ga0068857_101180533 | Not Available | 741 | Open in IMG/M |
| 3300005616|Ga0068852_100390869 | All Organisms → cellular organisms → Bacteria | 1366 | Open in IMG/M |
| 3300005617|Ga0068859_101740169 | Not Available | 689 | Open in IMG/M |
| 3300005617|Ga0068859_102517083 | Not Available | 567 | Open in IMG/M |
| 3300005617|Ga0068859_102855736 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300005713|Ga0066905_100459497 | Not Available | 1049 | Open in IMG/M |
| 3300005719|Ga0068861_100089244 | All Organisms → cellular organisms → Bacteria | 2430 | Open in IMG/M |
| 3300005719|Ga0068861_100263002 | Not Available | 1478 | Open in IMG/M |
| 3300005836|Ga0074470_11267202 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1699 | Open in IMG/M |
| 3300005836|Ga0074470_11821527 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300005844|Ga0068862_100510399 | Not Available | 1142 | Open in IMG/M |
| 3300005844|Ga0068862_100777307 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Rhizobacter → unclassified Rhizobacter → Rhizobacter sp. J219 | 933 | Open in IMG/M |
| 3300005844|Ga0068862_101602951 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Sphaerotilaceae | 658 | Open in IMG/M |
| 3300005844|Ga0068862_101924409 | Not Available | 601 | Open in IMG/M |
| 3300005844|Ga0068862_102739489 | Not Available | 504 | Open in IMG/M |
| 3300005878|Ga0075297_1018002 | Not Available | 739 | Open in IMG/M |
| 3300006031|Ga0066651_10413465 | Not Available | 718 | Open in IMG/M |
| 3300006046|Ga0066652_100391904 | Not Available | 1263 | Open in IMG/M |
| 3300006804|Ga0079221_11472166 | Not Available | 545 | Open in IMG/M |
| 3300006845|Ga0075421_101447205 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 754 | Open in IMG/M |
| 3300006845|Ga0075421_101972607 | Not Available | 623 | Open in IMG/M |
| 3300006847|Ga0075431_100283344 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia | 1678 | Open in IMG/M |
| 3300006847|Ga0075431_100866800 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 874 | Open in IMG/M |
| 3300006852|Ga0075433_10041035 | All Organisms → cellular organisms → Bacteria | 4008 | Open in IMG/M |
| 3300006852|Ga0075433_10041035 | All Organisms → cellular organisms → Bacteria | 4008 | Open in IMG/M |
| 3300006853|Ga0075420_101523872 | Not Available | 573 | Open in IMG/M |
| 3300006854|Ga0075425_100051125 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4629 | Open in IMG/M |
| 3300006854|Ga0075425_102407237 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300006865|Ga0073934_10097543 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2252 | Open in IMG/M |
| 3300006865|Ga0073934_10106829 | All Organisms → cellular organisms → Bacteria | 2112 | Open in IMG/M |
| 3300006865|Ga0073934_10319883 | Not Available | 984 | Open in IMG/M |
| 3300006876|Ga0079217_11166706 | Not Available | 582 | Open in IMG/M |
| 3300006876|Ga0079217_11761079 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 500 | Open in IMG/M |
| 3300006880|Ga0075429_101074051 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 703 | Open in IMG/M |
| 3300006880|Ga0075429_101623256 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300006881|Ga0068865_101188915 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae | 675 | Open in IMG/M |
| 3300006894|Ga0079215_10357816 | Not Available | 839 | Open in IMG/M |
| 3300006903|Ga0075426_10025387 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4237 | Open in IMG/M |
| 3300006904|Ga0075424_102290993 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300006954|Ga0079219_12185925 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Tenericutes → Mollicutes → Mycoplasmatales → Mycoplasmataceae → unclassified Mycoplasmataceae → Mycoplasmataceae bacterium RV_VA103A | 532 | Open in IMG/M |
| 3300006969|Ga0075419_10623189 | Not Available | 759 | Open in IMG/M |
| 3300006969|Ga0075419_11052980 | Not Available | 594 | Open in IMG/M |
| 3300007004|Ga0079218_10318850 | All Organisms → cellular organisms → Bacteria | 1274 | Open in IMG/M |
| 3300007004|Ga0079218_10610041 | Not Available | 999 | Open in IMG/M |
| 3300007004|Ga0079218_10984650 | Not Available | 842 | Open in IMG/M |
| 3300007004|Ga0079218_11143767 | Not Available | 800 | Open in IMG/M |
| 3300007004|Ga0079218_11448644 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 738 | Open in IMG/M |
| 3300007004|Ga0079218_12068519 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division KSB1 → unclassified candidate division KSB1 → candidate division KSB1 bacterium | 654 | Open in IMG/M |
| 3300007004|Ga0079218_12383730 | Not Available | 621 | Open in IMG/M |
| 3300007004|Ga0079218_12663639 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300007004|Ga0079218_12860659 | Not Available | 579 | Open in IMG/M |
| 3300007004|Ga0079218_12913943 | Not Available | 575 | Open in IMG/M |
| 3300007004|Ga0079218_13078721 | Not Available | 562 | Open in IMG/M |
| 3300009078|Ga0105106_10145469 | Not Available | 1741 | Open in IMG/M |
| 3300009078|Ga0105106_11203354 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300009087|Ga0105107_10115687 | Not Available | 1889 | Open in IMG/M |
| 3300009087|Ga0105107_10544961 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 808 | Open in IMG/M |
| 3300009087|Ga0105107_10607295 | Not Available | 761 | Open in IMG/M |
| 3300009087|Ga0105107_10766946 | Not Available | 671 | Open in IMG/M |
| 3300009087|Ga0105107_11071336 | Not Available | 562 | Open in IMG/M |
| 3300009093|Ga0105240_11909765 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300009094|Ga0111539_10103164 | All Organisms → cellular organisms → Bacteria | 3347 | Open in IMG/M |
| 3300009094|Ga0111539_10376885 | All Organisms → cellular organisms → Bacteria | 1652 | Open in IMG/M |
| 3300009094|Ga0111539_10576603 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1310 | Open in IMG/M |
| 3300009094|Ga0111539_10596963 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira | 1286 | Open in IMG/M |
| 3300009094|Ga0111539_11235687 | Not Available | 867 | Open in IMG/M |
| 3300009094|Ga0111539_12592209 | Not Available | 588 | Open in IMG/M |
| 3300009094|Ga0111539_12687319 | Not Available | 577 | Open in IMG/M |
| 3300009094|Ga0111539_13209578 | Not Available | 527 | Open in IMG/M |
| 3300009095|Ga0079224_100285257 | Not Available | 2377 | Open in IMG/M |
| 3300009095|Ga0079224_100317859 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2240 | Open in IMG/M |
| 3300009095|Ga0079224_101097990 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1134 | Open in IMG/M |
| 3300009095|Ga0079224_101134493 | All Organisms → cellular organisms → Bacteria | 1114 | Open in IMG/M |
| 3300009095|Ga0079224_101255790 | All Organisms → cellular organisms → Bacteria | 1054 | Open in IMG/M |
| 3300009095|Ga0079224_101489779 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 961 | Open in IMG/M |
| 3300009095|Ga0079224_102003230 | Not Available | 822 | Open in IMG/M |
| 3300009095|Ga0079224_102289367 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Chiayiivirga → Chiayiivirga flava | 769 | Open in IMG/M |
| 3300009095|Ga0079224_102762486 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
| 3300009095|Ga0079224_103035129 | Not Available | 670 | Open in IMG/M |
| 3300009095|Ga0079224_104783014 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 527 | Open in IMG/M |
| 3300009095|Ga0079224_105219958 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 501 | Open in IMG/M |
| 3300009100|Ga0075418_12886199 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 524 | Open in IMG/M |
| 3300009147|Ga0114129_13231347 | Not Available | 529 | Open in IMG/M |
| 3300009148|Ga0105243_10043342 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3526 | Open in IMG/M |
| 3300009148|Ga0105243_10317203 | Not Available | 1419 | Open in IMG/M |
| 3300009148|Ga0105243_12165630 | Not Available | 592 | Open in IMG/M |
| 3300009156|Ga0111538_10725620 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1259 | Open in IMG/M |
| 3300009156|Ga0111538_10744099 | All Organisms → cellular organisms → Bacteria | 1242 | Open in IMG/M |
| 3300009156|Ga0111538_10837741 | All Organisms → cellular organisms → Bacteria | 1165 | Open in IMG/M |
| 3300009156|Ga0111538_10884470 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira | 1131 | Open in IMG/M |
| 3300009156|Ga0111538_11819097 | Not Available | 767 | Open in IMG/M |
| 3300009156|Ga0111538_12420374 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 659 | Open in IMG/M |
| 3300009156|Ga0111538_12484712 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
| 3300009156|Ga0111538_12564991 | Not Available | 639 | Open in IMG/M |
| 3300009156|Ga0111538_12613547 | Not Available | 633 | Open in IMG/M |
| 3300009156|Ga0111538_13345072 | Not Available | 558 | Open in IMG/M |
| 3300009157|Ga0105092_10669228 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rhodanobacter → unclassified Rhodanobacter → Rhodanobacter sp. C01 | 602 | Open in IMG/M |
| 3300009166|Ga0105100_10030037 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3150 | Open in IMG/M |
| 3300009176|Ga0105242_12653548 | Not Available | 550 | Open in IMG/M |
| 3300009553|Ga0105249_11030198 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 892 | Open in IMG/M |
| 3300009678|Ga0105252_10173411 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 911 | Open in IMG/M |
| 3300009687|Ga0116144_10156847 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1244 | Open in IMG/M |
| 3300009852|Ga0131851_1077715 | Not Available | 636 | Open in IMG/M |
| 3300009873|Ga0131077_10447873 | All Organisms → cellular organisms → Bacteria | 1726 | Open in IMG/M |
| 3300009984|Ga0105029_103511 | Not Available | 1051 | Open in IMG/M |
| 3300010046|Ga0126384_11912630 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300010335|Ga0134063_10178722 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 992 | Open in IMG/M |
| 3300010337|Ga0134062_10063499 | Not Available | 1529 | Open in IMG/M |
| 3300010337|Ga0134062_10503446 | Not Available | 609 | Open in IMG/M |
| 3300010356|Ga0116237_11012321 | Not Available | 697 | Open in IMG/M |
| 3300010362|Ga0126377_10061469 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales | 3308 | Open in IMG/M |
| 3300010362|Ga0126377_10170200 | Not Available | 2063 | Open in IMG/M |
| 3300010364|Ga0134066_10423070 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300010398|Ga0126383_10028601 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 4388 | Open in IMG/M |
| 3300010399|Ga0134127_10003287 | All Organisms → cellular organisms → Bacteria | 11626 | Open in IMG/M |
| 3300010399|Ga0134127_10031523 | All Organisms → cellular organisms → Bacteria | 4239 | Open in IMG/M |
| 3300010399|Ga0134127_10031523 | All Organisms → cellular organisms → Bacteria | 4239 | Open in IMG/M |
| 3300010399|Ga0134127_10384999 | Not Available | 1382 | Open in IMG/M |
| 3300010399|Ga0134127_10543594 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → sulfur-oxidizing symbionts → Candidatus Thiodiazotropha → Candidatus Thiodiazotropha endoloripes | 1181 | Open in IMG/M |
| 3300010399|Ga0134127_11119848 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 852 | Open in IMG/M |
| 3300010399|Ga0134127_11322858 | Not Available | 790 | Open in IMG/M |
| 3300010399|Ga0134127_11418969 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 766 | Open in IMG/M |
| 3300010399|Ga0134127_11806414 | Not Available | 687 | Open in IMG/M |
| 3300010399|Ga0134127_11900296 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 672 | Open in IMG/M |
| 3300010399|Ga0134127_12201114 | Not Available | 630 | Open in IMG/M |
| 3300010399|Ga0134127_12331474 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Marinobacteraceae → Marinobacter → Marinobacter mangrovi | 615 | Open in IMG/M |
| 3300010399|Ga0134127_12386990 | Not Available | 608 | Open in IMG/M |
| 3300010399|Ga0134127_12480071 | Not Available | 598 | Open in IMG/M |
| 3300010399|Ga0134127_13209660 | Not Available | 534 | Open in IMG/M |
| 3300010400|Ga0134122_10022764 | All Organisms → cellular organisms → Bacteria | 4712 | Open in IMG/M |
| 3300010400|Ga0134122_12743830 | Not Available | 545 | Open in IMG/M |
| 3300010401|Ga0134121_11721906 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300010403|Ga0134123_10404134 | All Organisms → cellular organisms → Bacteria | 1253 | Open in IMG/M |
| 3300010403|Ga0134123_10979037 | Not Available | 859 | Open in IMG/M |
| 3300010403|Ga0134123_11748534 | Not Available | 674 | Open in IMG/M |
| 3300010403|Ga0134123_12170576 | Not Available | 617 | Open in IMG/M |
| 3300010403|Ga0134123_12795075 | Not Available | 557 | Open in IMG/M |
| 3300011406|Ga0137454_1015217 | All Organisms → cellular organisms → Bacteria | 972 | Open in IMG/M |
| 3300011409|Ga0137323_1135176 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 536 | Open in IMG/M |
| 3300011421|Ga0137462_1018067 | Not Available | 1365 | Open in IMG/M |
| 3300011424|Ga0137439_1050205 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
| 3300011425|Ga0137441_1009878 | All Organisms → cellular organisms → Bacteria | 1841 | Open in IMG/M |
| 3300011428|Ga0137456_1113467 | All Organisms → cellular organisms → Bacteria → Spirochaetes | 709 | Open in IMG/M |
| 3300011433|Ga0137443_1147655 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 695 | Open in IMG/M |
| 3300011439|Ga0137432_1289269 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylobacter | 524 | Open in IMG/M |
| 3300011440|Ga0137433_1027532 | Not Available | 1655 | Open in IMG/M |
| 3300011440|Ga0137433_1142640 | Not Available | 768 | Open in IMG/M |
| 3300012041|Ga0137430_1079689 | All Organisms → cellular organisms → Bacteria | 911 | Open in IMG/M |
| 3300012041|Ga0137430_1127032 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter modestus | 728 | Open in IMG/M |
| 3300012143|Ga0137354_1017428 | All Organisms → cellular organisms → Bacteria | 1078 | Open in IMG/M |
| 3300012161|Ga0137336_1051636 | Not Available | 754 | Open in IMG/M |
| 3300012202|Ga0137363_10052230 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2935 | Open in IMG/M |
| 3300012670|Ga0137335_1006495 | All Organisms → cellular organisms → Bacteria | 1047 | Open in IMG/M |
| 3300012683|Ga0137398_10313170 | Not Available | 1057 | Open in IMG/M |
| 3300012884|Ga0157300_1005818 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 1353 | Open in IMG/M |
| 3300012884|Ga0157300_1024467 | Not Available | 821 | Open in IMG/M |
| 3300012891|Ga0157305_10016309 | All Organisms → cellular organisms → Bacteria | 1278 | Open in IMG/M |
| 3300012891|Ga0157305_10232728 | Not Available | 545 | Open in IMG/M |
| 3300012895|Ga0157309_10091091 | Not Available | 829 | Open in IMG/M |
| 3300012895|Ga0157309_10341836 | Not Available | 518 | Open in IMG/M |
| 3300012897|Ga0157285_10206825 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 620 | Open in IMG/M |
| 3300012899|Ga0157299_10122709 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
| 3300012904|Ga0157282_10307282 | Not Available | 561 | Open in IMG/M |
| 3300012905|Ga0157296_10116170 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter | 754 | Open in IMG/M |
| 3300012905|Ga0157296_10242179 | Not Available | 600 | Open in IMG/M |
| 3300012910|Ga0157308_10003365 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3036 | Open in IMG/M |
| 3300012910|Ga0157308_10006747 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2254 | Open in IMG/M |
| 3300012912|Ga0157306_10309114 | Not Available | 583 | Open in IMG/M |
| 3300012913|Ga0157298_10035195 | Not Available | 1062 | Open in IMG/M |
| 3300012916|Ga0157310_10351856 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 596 | Open in IMG/M |
| 3300012924|Ga0137413_11830073 | Not Available | 502 | Open in IMG/M |
| 3300012943|Ga0164241_10136922 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1754 | Open in IMG/M |
| 3300012943|Ga0164241_10720134 | Not Available | 725 | Open in IMG/M |
| 3300012944|Ga0137410_10000641 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 24298 | Open in IMG/M |
| 3300012944|Ga0137410_10000641 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 24298 | Open in IMG/M |
| 3300012944|Ga0137410_10052692 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2903 | Open in IMG/M |
| 3300012944|Ga0137410_10054471 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 2860 | Open in IMG/M |
| 3300012944|Ga0137410_10474882 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1018 | Open in IMG/M |
| 3300012964|Ga0153916_10019105 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 5751 | Open in IMG/M |
| 3300014166|Ga0134079_10010308 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Luteimonas → Luteimonas terricola | 2828 | Open in IMG/M |
| 3300014257|Ga0075319_1097839 | Not Available | 591 | Open in IMG/M |
| 3300014272|Ga0075327_1069346 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RIFCSPLOWO2_02_56_12 | 1051 | Open in IMG/M |
| 3300014272|Ga0075327_1142022 | Not Available | 745 | Open in IMG/M |
| 3300014272|Ga0075327_1165184 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
| 3300014326|Ga0157380_10052952 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3216 | Open in IMG/M |
| 3300014326|Ga0157380_12527118 | Not Available | 579 | Open in IMG/M |
| 3300014326|Ga0157380_13054441 | Not Available | 533 | Open in IMG/M |
| 3300014326|Ga0157380_13547691 | Not Available | 500 | Open in IMG/M |
| 3300014864|Ga0180068_1002649 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2384 | Open in IMG/M |
| 3300014968|Ga0157379_11842513 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300015052|Ga0137411_1026835 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1025 | Open in IMG/M |
| 3300015077|Ga0173483_10015496 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2641 | Open in IMG/M |
| 3300015201|Ga0173478_10093393 | All Organisms → cellular organisms → Bacteria | 1093 | Open in IMG/M |
| 3300015371|Ga0132258_11113447 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 1996 | Open in IMG/M |
| 3300015371|Ga0132258_13517525 | All Organisms → cellular organisms → Bacteria | 1073 | Open in IMG/M |
| 3300015371|Ga0132258_13545735 | Not Available | 1068 | Open in IMG/M |
| 3300015372|Ga0132256_103553938 | Not Available | 524 | Open in IMG/M |
| 3300015373|Ga0132257_100641213 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1316 | Open in IMG/M |
| 3300017792|Ga0163161_11897702 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 530 | Open in IMG/M |
| 3300018028|Ga0184608_10179688 | Not Available | 922 | Open in IMG/M |
| 3300018084|Ga0184629_10068845 | All Organisms → cellular organisms → Bacteria | 1665 | Open in IMG/M |
| 3300018422|Ga0190265_10091785 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Dyella → Dyella choica | 2817 | Open in IMG/M |
| 3300018422|Ga0190265_10117383 | All Organisms → cellular organisms → Bacteria | 2534 | Open in IMG/M |
| 3300018422|Ga0190265_10818199 | All Organisms → cellular organisms → Bacteria | 1054 | Open in IMG/M |
| 3300018422|Ga0190265_11838638 | Not Available | 713 | Open in IMG/M |
| 3300018422|Ga0190265_12235277 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Woeseiaceae | 649 | Open in IMG/M |
| 3300018469|Ga0190270_11809568 | Not Available | 666 | Open in IMG/M |
| 3300018469|Ga0190270_12121809 | Not Available | 621 | Open in IMG/M |
| 3300018476|Ga0190274_12044302 | Not Available | 669 | Open in IMG/M |
| 3300019356|Ga0173481_10001664 | All Organisms → cellular organisms → Bacteria | 5450 | Open in IMG/M |
| 3300019356|Ga0173481_10001664 | All Organisms → cellular organisms → Bacteria | 5450 | Open in IMG/M |
| 3300019356|Ga0173481_10006759 | Not Available | 3113 | Open in IMG/M |
| 3300019356|Ga0173481_10066866 | All Organisms → cellular organisms → Bacteria | 1288 | Open in IMG/M |
| 3300019356|Ga0173481_10156190 | All Organisms → cellular organisms → Bacteria | 946 | Open in IMG/M |
| 3300019356|Ga0173481_10616123 | Not Available | 573 | Open in IMG/M |
| 3300019356|Ga0173481_10716904 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae | 542 | Open in IMG/M |
| 3300019361|Ga0173482_10716546 | Not Available | 519 | Open in IMG/M |
| 3300019487|Ga0187893_10067732 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 3413 | Open in IMG/M |
| 3300019487|Ga0187893_10154217 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1861 | Open in IMG/M |
| 3300019487|Ga0187893_10194409 | All Organisms → cellular organisms → Bacteria | 1570 | Open in IMG/M |
| 3300019487|Ga0187893_10211966 | All Organisms → cellular organisms → Bacteria | 1474 | Open in IMG/M |
| 3300019487|Ga0187893_10443524 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 864 | Open in IMG/M |
| 3300019487|Ga0187893_10552085 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 740 | Open in IMG/M |
| 3300019487|Ga0187893_10658746 | Not Available | 654 | Open in IMG/M |
| 3300019880|Ga0193712_1036344 | Not Available | 1066 | Open in IMG/M |
| 3300020003|Ga0193739_1148219 | Not Available | 563 | Open in IMG/M |
| 3300020020|Ga0193738_1011670 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2857 | Open in IMG/M |
| 3300020020|Ga0193738_1060674 | Not Available | 1128 | Open in IMG/M |
| 3300020020|Ga0193738_1121001 | Not Available | 730 | Open in IMG/M |
| 3300020020|Ga0193738_1121001 | Not Available | 730 | Open in IMG/M |
| 3300020021|Ga0193726_1000551 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 38634 | Open in IMG/M |
| 3300022214|Ga0224505_10007312 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5606 | Open in IMG/M |
| 3300022309|Ga0224510_10331504 | Not Available | 915 | Open in IMG/M |
| 3300022880|Ga0247792_1060165 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
| 3300022886|Ga0247746_1108634 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter | 683 | Open in IMG/M |
| 3300022901|Ga0247788_1022793 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter | 1101 | Open in IMG/M |
| 3300022915|Ga0247790_10069691 | Not Available | 833 | Open in IMG/M |
| 3300023066|Ga0247793_1053215 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 651 | Open in IMG/M |
| 3300023261|Ga0247796_1036446 | Not Available | 819 | Open in IMG/M |
| 3300023266|Ga0247789_1013274 | All Organisms → cellular organisms → Bacteria | 1320 | Open in IMG/M |
| 3300025310|Ga0209172_10035818 | Not Available | 3236 | Open in IMG/M |
| 3300025912|Ga0207707_10938739 | Not Available | 713 | Open in IMG/M |
| 3300025917|Ga0207660_10331676 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1216 | Open in IMG/M |
| 3300025917|Ga0207660_10339383 | Not Available | 1202 | Open in IMG/M |
| 3300025917|Ga0207660_11053423 | Not Available | 663 | Open in IMG/M |
| 3300025917|Ga0207660_11062259 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| 3300025917|Ga0207660_11676510 | Not Available | 511 | Open in IMG/M |
| 3300025918|Ga0207662_11045136 | Not Available | 580 | Open in IMG/M |
| 3300025925|Ga0207650_10886082 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
| 3300025926|Ga0207659_10149849 | All Organisms → cellular organisms → Bacteria | 1820 | Open in IMG/M |
| 3300025926|Ga0207659_11917565 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Thermomonas → Thermomonas flagellata | 502 | Open in IMG/M |
| 3300025936|Ga0207670_10508788 | All Organisms → cellular organisms → Bacteria | 979 | Open in IMG/M |
| 3300025936|Ga0207670_11747230 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 529 | Open in IMG/M |
| 3300025938|Ga0207704_10725887 | Not Available | 824 | Open in IMG/M |
| 3300025938|Ga0207704_10725887 | Not Available | 824 | Open in IMG/M |
| 3300025938|Ga0207704_11081693 | Not Available | 681 | Open in IMG/M |
| 3300025942|Ga0207689_10258542 | All Organisms → cellular organisms → Bacteria | 1440 | Open in IMG/M |
| 3300025944|Ga0207661_11579033 | Not Available | 601 | Open in IMG/M |
| 3300026054|Ga0208659_1023081 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300026075|Ga0207708_10186456 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Rhizobacter → unclassified Rhizobacter → Rhizobacter sp. J219 | 1649 | Open in IMG/M |
| 3300026075|Ga0207708_11333945 | Not Available | 629 | Open in IMG/M |
| 3300026089|Ga0207648_10419391 | Not Available | 1215 | Open in IMG/M |
| 3300026089|Ga0207648_11068583 | Not Available | 757 | Open in IMG/M |
| 3300026116|Ga0207674_10456674 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Azospira → Azospira oryzae | 1235 | Open in IMG/M |
| 3300026118|Ga0207675_101544067 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 685 | Open in IMG/M |
| 3300026118|Ga0207675_101713399 | Not Available | 648 | Open in IMG/M |
| 3300026118|Ga0207675_102043589 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 590 | Open in IMG/M |
| 3300026121|Ga0207683_10589636 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1028 | Open in IMG/M |
| 3300027471|Ga0209995_1083249 | Not Available | 549 | Open in IMG/M |
| 3300027617|Ga0210002_1032733 | Not Available | 868 | Open in IMG/M |
| 3300027711|Ga0209075_1237622 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 725 | Open in IMG/M |
| 3300027818|Ga0209706_10320796 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 731 | Open in IMG/M |
| 3300027886|Ga0209486_10151125 | Not Available | 1279 | Open in IMG/M |
| 3300027886|Ga0209486_10167680 | All Organisms → cellular organisms → Bacteria | 1221 | Open in IMG/M |
| 3300027886|Ga0209486_10425332 | Not Available | 811 | Open in IMG/M |
| 3300027897|Ga0209254_10891102 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300027907|Ga0207428_10458751 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 928 | Open in IMG/M |
| 3300027909|Ga0209382_10495897 | Not Available | 1346 | Open in IMG/M |
| 3300027909|Ga0209382_11731681 | Not Available | 612 | Open in IMG/M |
| 3300027964|Ga0256864_1125005 | All Organisms → cellular organisms → Bacteria | 726 | Open in IMG/M |
| 3300027979|Ga0209705_10039427 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2618 | Open in IMG/M |
| 3300028380|Ga0268265_10613170 | Not Available | 1041 | Open in IMG/M |
| 3300028380|Ga0268265_11580396 | Not Available | 660 | Open in IMG/M |
| 3300028380|Ga0268265_12103959 | Not Available | 571 | Open in IMG/M |
| 3300028380|Ga0268265_12255555 | Not Available | 551 | Open in IMG/M |
| 3300028648|Ga0268299_1011463 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4323 | Open in IMG/M |
| 3300030339|Ga0311360_10730600 | Not Available | 788 | Open in IMG/M |
| 3300030620|Ga0302046_10057973 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3145 | Open in IMG/M |
| 3300030620|Ga0302046_10138400 | All Organisms → cellular organisms → Bacteria | 1996 | Open in IMG/M |
| 3300030620|Ga0302046_10541635 | All Organisms → cellular organisms → Bacteria | 951 | Open in IMG/M |
| 3300031184|Ga0307499_10198010 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
| 3300031184|Ga0307499_10212005 | Not Available | 601 | Open in IMG/M |
| 3300031184|Ga0307499_10232601 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300031198|Ga0307500_10033743 | Not Available | 1171 | Open in IMG/M |
| 3300031198|Ga0307500_10084032 | All Organisms → cellular organisms → Bacteria | 829 | Open in IMG/M |
| 3300031226|Ga0307497_10129122 | All Organisms → cellular organisms → Bacteria | 1024 | Open in IMG/M |
| 3300031226|Ga0307497_10722307 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter modestus | 516 | Open in IMG/M |
| 3300031228|Ga0299914_10148454 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 2077 | Open in IMG/M |
| 3300031455|Ga0307505_10316619 | Not Available | 733 | Open in IMG/M |
| 3300031538|Ga0310888_10187520 | Not Available | 1129 | Open in IMG/M |
| 3300031562|Ga0310886_10168750 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium | 1168 | Open in IMG/M |
| 3300031726|Ga0302321_103436547 | Not Available | 515 | Open in IMG/M |
| 3300031731|Ga0307405_12119210 | Not Available | 505 | Open in IMG/M |
| 3300031740|Ga0307468_102107219 | Not Available | 543 | Open in IMG/M |
| 3300031852|Ga0307410_11462398 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300031858|Ga0310892_10579965 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 757 | Open in IMG/M |
| 3300031858|Ga0310892_10734452 | Not Available | 680 | Open in IMG/M |
| 3300031858|Ga0310892_10943806 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 606 | Open in IMG/M |
| 3300031908|Ga0310900_10012485 | All Organisms → cellular organisms → Bacteria | 4229 | Open in IMG/M |
| 3300031908|Ga0310900_10125646 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1693 | Open in IMG/M |
| 3300031908|Ga0310900_10296640 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1186 | Open in IMG/M |
| 3300031908|Ga0310900_10884471 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 728 | Open in IMG/M |
| 3300031908|Ga0310900_11655663 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 542 | Open in IMG/M |
| 3300031940|Ga0310901_10377217 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 613 | Open in IMG/M |
| 3300031943|Ga0310885_10178222 | All Organisms → cellular organisms → Bacteria | 1036 | Open in IMG/M |
| 3300031944|Ga0310884_11035626 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 511 | Open in IMG/M |
| 3300032000|Ga0310903_10260822 | Not Available | 838 | Open in IMG/M |
| 3300032002|Ga0307416_102138469 | Not Available | 661 | Open in IMG/M |
| 3300032002|Ga0307416_103548065 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300032012|Ga0310902_10268110 | Not Available | 1037 | Open in IMG/M |
| 3300032012|Ga0310902_10789517 | Not Available | 646 | Open in IMG/M |
| 3300032013|Ga0310906_10395995 | All Organisms → cellular organisms → Bacteria | 911 | Open in IMG/M |
| 3300032013|Ga0310906_11062964 | Not Available | 584 | Open in IMG/M |
| 3300032017|Ga0310899_10098127 | All Organisms → cellular organisms → Bacteria | 1178 | Open in IMG/M |
| 3300032075|Ga0310890_10086067 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1926 | Open in IMG/M |
| 3300032075|Ga0310890_10900440 | Not Available | 706 | Open in IMG/M |
| 3300032075|Ga0310890_10986871 | Not Available | 677 | Open in IMG/M |
| 3300032075|Ga0310890_11137097 | Not Available | 633 | Open in IMG/M |
| 3300032075|Ga0310890_11275783 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geomonas | 600 | Open in IMG/M |
| 3300032126|Ga0307415_101458434 | Not Available | 653 | Open in IMG/M |
| 3300032144|Ga0315910_10012897 | All Organisms → cellular organisms → Bacteria | 6355 | Open in IMG/M |
| 3300032144|Ga0315910_10016483 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5550 | Open in IMG/M |
| 3300032144|Ga0315910_10021673 | All Organisms → cellular organisms → Bacteria | 4764 | Open in IMG/M |
| 3300032144|Ga0315910_10023230 | Not Available | 4590 | Open in IMG/M |
| 3300032144|Ga0315910_10043397 | All Organisms → cellular organisms → Bacteria | 3280 | Open in IMG/M |
| 3300032144|Ga0315910_10088800 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2261 | Open in IMG/M |
| 3300032144|Ga0315910_10093263 | All Organisms → cellular organisms → Bacteria | 2205 | Open in IMG/M |
| 3300032144|Ga0315910_10290653 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1239 | Open in IMG/M |
| 3300032144|Ga0315910_10294432 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → Candidatus Kentron → unclassified Candidatus Kentron → Candidatus Kentron sp. FW | 1231 | Open in IMG/M |
| 3300032144|Ga0315910_10317809 | All Organisms → cellular organisms → Bacteria | 1183 | Open in IMG/M |
| 3300032144|Ga0315910_10348816 | Not Available | 1128 | Open in IMG/M |
| 3300032144|Ga0315910_10470904 | All Organisms → cellular organisms → Bacteria | 967 | Open in IMG/M |
| 3300032144|Ga0315910_10557187 | All Organisms → cellular organisms → Bacteria | 886 | Open in IMG/M |
| 3300032144|Ga0315910_10616633 | Not Available | 841 | Open in IMG/M |
| 3300032144|Ga0315910_10705073 | Not Available | 784 | Open in IMG/M |
| 3300032144|Ga0315910_10991649 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300032157|Ga0315912_10058585 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 3040 | Open in IMG/M |
| 3300032157|Ga0315912_10073778 | Not Available | 2680 | Open in IMG/M |
| 3300032157|Ga0315912_10086176 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Solimonas → Solimonas marina | 2462 | Open in IMG/M |
| 3300032157|Ga0315912_10115364 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2105 | Open in IMG/M |
| 3300032157|Ga0315912_10334332 | All Organisms → cellular organisms → Bacteria | 1195 | Open in IMG/M |
| 3300032157|Ga0315912_10338878 | Not Available | 1187 | Open in IMG/M |
| 3300032157|Ga0315912_10554952 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 914 | Open in IMG/M |
| 3300032157|Ga0315912_10708747 | Not Available | 801 | Open in IMG/M |
| 3300032157|Ga0315912_10735009 | All Organisms → cellular organisms → Bacteria | 786 | Open in IMG/M |
| 3300032157|Ga0315912_10873005 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 715 | Open in IMG/M |
| 3300032157|Ga0315912_10881340 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
| 3300032157|Ga0315912_10941548 | Not Available | 686 | Open in IMG/M |
| 3300032157|Ga0315912_11613153 | Not Available | 510 | Open in IMG/M |
| 3300032157|Ga0315912_11651604 | Not Available | 503 | Open in IMG/M |
| 3300032180|Ga0307471_102654213 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300032211|Ga0310896_10496051 | Not Available | 668 | Open in IMG/M |
| 3300032828|Ga0335080_10951118 | Not Available | 878 | Open in IMG/M |
| 3300033004|Ga0335084_10041010 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4760 | Open in IMG/M |
| 3300033004|Ga0335084_10580269 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1148 | Open in IMG/M |
| 3300033407|Ga0214472_10038564 | All Organisms → cellular organisms → Bacteria | 4876 | Open in IMG/M |
| 3300033412|Ga0310810_10141811 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2804 | Open in IMG/M |
| 3300033417|Ga0214471_10362632 | All Organisms → cellular organisms → Bacteria | 1172 | Open in IMG/M |
| 3300033433|Ga0326726_10002899 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 15705 | Open in IMG/M |
| 3300033550|Ga0247829_10661885 | Not Available | 869 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 19.28% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 8.52% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 6.28% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.83% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 5.16% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 4.48% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 3.81% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.81% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Agricultural Soil | 2.91% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.69% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 2.47% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.24% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.02% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 2.02% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.57% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.57% |
| Microbial Mat On Rocks | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks | 1.57% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.35% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.35% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 1.35% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.35% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.12% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 1.12% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.12% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.12% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.12% |
| Hot Spring Sediment | Environmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment | 0.90% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.90% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.90% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.90% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.67% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.67% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.67% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.45% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.45% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.45% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.45% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.45% |
| Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 0.45% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.22% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.22% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.22% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.22% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.22% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.22% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.22% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.22% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.22% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.22% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.22% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.22% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.22% |
| Compost | Engineered → Solid Waste → Zoo Waste → Composting → Unclassified → Compost | 0.22% |
| Feedstock Adapted Compost | Engineered → Solid Waste → Feedstock → Composting → Unclassified → Feedstock Adapted Compost | 0.22% |
| Wastewater | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater | 0.22% |
| Activated Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge | 0.22% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459021 | Litter degradation NP4 | Engineered | Open in IMG/M |
| 3300000208 | Feedstock adapted compost microbial communities from Newby Island compost facility, Milpitas, CA, USA - Passage 4_AFX | Engineered | Open in IMG/M |
| 3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
| 3300003989 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_CordA_D2 | Environmental | Open in IMG/M |
| 3300004004 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_PWB_D2 | Environmental | Open in IMG/M |
| 3300004014 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_CattailNLA_D2 | Environmental | Open in IMG/M |
| 3300004047 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqC_D1 | Environmental | Open in IMG/M |
| 3300004058 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqB_D1 | Environmental | Open in IMG/M |
| 3300004066 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_CattailNLC_D2 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005218 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqC_D2 | Environmental | Open in IMG/M |
| 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
| 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005836 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB | Environmental | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300005878 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_104 | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006865 | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG | Environmental | Open in IMG/M |
| 3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009078 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009087 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009095 | Agricultural soil microbial communities from Utah to study Nitrogen management - Steer compost 2015 | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009157 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009166 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009678 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100 | Environmental | Open in IMG/M |
| 3300009687 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC035_MetaG | Engineered | Open in IMG/M |
| 3300009852 | Compost microbial communities from Sao Paulo Zoo, Brazil - Zoo Compost 4 - DAY 99 mira | Engineered | Open in IMG/M |
| 3300009873 | Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Wenshan plant | Engineered | Open in IMG/M |
| 3300009984 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG | Host-Associated | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010356 | AD_USDEca | Engineered | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011406 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT539_2 | Environmental | Open in IMG/M |
| 3300011409 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT423_2 | Environmental | Open in IMG/M |
| 3300011421 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT769_2 | Environmental | Open in IMG/M |
| 3300011424 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT200_2 | Environmental | Open in IMG/M |
| 3300011425 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT244_2 | Environmental | Open in IMG/M |
| 3300011428 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT615_2 | Environmental | Open in IMG/M |
| 3300011433 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT300_2 | Environmental | Open in IMG/M |
| 3300011439 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT820_2 | Environmental | Open in IMG/M |
| 3300011440 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT840_2 | Environmental | Open in IMG/M |
| 3300012041 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT754_2 | Environmental | Open in IMG/M |
| 3300012143 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT790_2 | Environmental | Open in IMG/M |
| 3300012161 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT300_2 | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012670 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT293_2 | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012884 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 | Environmental | Open in IMG/M |
| 3300012891 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S148-409B-2 | Environmental | Open in IMG/M |
| 3300012895 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S208-509C-2 | Environmental | Open in IMG/M |
| 3300012897 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1 | Environmental | Open in IMG/M |
| 3300012899 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2 | Environmental | Open in IMG/M |
| 3300012904 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S029-104C-1 | Environmental | Open in IMG/M |
| 3300012905 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S013-104B-2 | Environmental | Open in IMG/M |
| 3300012910 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S198-509B-2 | Environmental | Open in IMG/M |
| 3300012912 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2 | Environmental | Open in IMG/M |
| 3300012913 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S043-104R-2 | Environmental | Open in IMG/M |
| 3300012916 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S213-509R-2 | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012943 | Backyard soil microbial communities from Emeryville, California, USA - Original compost - Back yard soil (BY) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012964 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300014257 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_TuleC_D1 | Environmental | Open in IMG/M |
| 3300014272 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailB_D1 | Environmental | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014864 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT231A'_16_10D | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
| 3300015201 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300019487 | White microbial mat communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-4 metaG | Environmental | Open in IMG/M |
| 3300019880 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a1 | Environmental | Open in IMG/M |
| 3300020003 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a2 | Environmental | Open in IMG/M |
| 3300020020 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a1 | Environmental | Open in IMG/M |
| 3300020021 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1 | Environmental | Open in IMG/M |
| 3300022214 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_4_1 | Environmental | Open in IMG/M |
| 3300022309 | Sediment microbial communities from San Francisco Bay, California, United States - SF_May12_sed_USGS_4_1 | Environmental | Open in IMG/M |
| 3300022880 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S106-311C-6 | Environmental | Open in IMG/M |
| 3300022886 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S079-202R-5 | Environmental | Open in IMG/M |
| 3300022901 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S156-409C-4 | Environmental | Open in IMG/M |
| 3300022915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S171-409R-4 | Environmental | Open in IMG/M |
| 3300023066 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S223-509R-6 | Environmental | Open in IMG/M |
| 3300023261 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S166-409R-6 | Environmental | Open in IMG/M |
| 3300023266 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S220-509R-4 | Environmental | Open in IMG/M |
| 3300025310 | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026054 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleC_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027711 | Agricultural soil microbial communities from Utah to study Nitrogen management - Steer compost 2011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027818 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
| 3300027897 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - DIP11 DI (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027964 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111 HiSeq | Environmental | Open in IMG/M |
| 3300027979 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028648 | Activated sludge microbial communities from bioreactor in Nijmegen, Gelderland, Netherland - NOB reactor | Engineered | Open in IMG/M |
| 3300030339 | III_Bog_N1 coassembly | Environmental | Open in IMG/M |
| 3300030620 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111 | Environmental | Open in IMG/M |
| 3300031184 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_S | Environmental | Open in IMG/M |
| 3300031198 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 14_S | Environmental | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031228 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57 | Environmental | Open in IMG/M |
| 3300031455 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 23_S | Environmental | Open in IMG/M |
| 3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
| 3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
| 3300031726 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1 | Environmental | Open in IMG/M |
| 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
| 3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| 3300031940 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D2 | Environmental | Open in IMG/M |
| 3300031943 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2 | Environmental | Open in IMG/M |
| 3300031944 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1 | Environmental | Open in IMG/M |
| 3300032000 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3 | Environmental | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032012 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3 | Environmental | Open in IMG/M |
| 3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
| 3300032017 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4 | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
| 3300032144 | Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soil | Environmental | Open in IMG/M |
| 3300032157 | Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soil | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032211 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033407 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT140D175 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033417 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT142D155 | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| 4NP_00806040 | 2170459021 | Switchgrass, Maize And Mischanthus Litter | MWSFIARESPNKQLQRTVTRRRGDGASAPLHYALAPRWTEQRAAAELRR |
| NICFPass4AFXDRAFT_0092555 | 3300000208 | Feedstock Adapted Compost | MRSALRQPPNKQLQRTVIPNHGRAASAPPHYALAARGIRGRAAAELRR |
| JGI11643J12802_101511311 | 3300000890 | Soil | LRQLWCQPPNKQLQRTVTRRRGDGASAPFHYALAPRITRQ |
| JGI11643J12802_106545141 | 3300000890 | Soil | MDRAAPNKQLQRTVTRRCGRAASASFHCAHAARFTRQRAAAE |
| JGI10214J12806_105913931 | 3300000891 | Soil | VPLLERTVIRRRRRAAGASFHFALTARTNPQRAAAQLRRYATV |
| JGI10216J12902_1091529854 | 3300000956 | Soil | PHNKQLQRTVTRRRGDTASAPFHSALAVRFTQQRAAAELRR* |
| JGI25406J46586_102088872 | 3300003203 | Tabebuia Heterophylla Rhizosphere | MTHNKQLQRTVRPVARRAACASFHYAHAARSNGQRAAAELRRYTA* |
| Ga0055473_101895661 | 3300003989 | Natural And Restored Wetlands | MTHRQSSNKQLQRAVTRRRGDGASAPFHYALAPRITRQRAAAELRRYT* |
| Ga0055451_104696482 | 3300004004 | Natural And Restored Wetlands | IVMWCQPPNKQLQRTVTRRRGDGASAPFHYALAPRITQQRAAAELRR* |
| Ga0055456_103135852 | 3300004014 | Natural And Restored Wetlands | MCQAPNKQLQRTVKRHRGDAASAPFHYALASRFTRRRAAAELQR |
| Ga0055499_100994292 | 3300004047 | Natural And Restored Wetlands | MLQQPHNKQLQRTVIGRRGRAARAPFHYARASRWTVGHAA |
| Ga0055498_100543392 | 3300004058 | Natural And Restored Wetlands | MLCQPPNKQLQRTVTRRRGDGASAPFHYALAPRFTRQRAAAELRR* |
| Ga0055484_100223174 | 3300004066 | Natural And Restored Wetlands | MTHRQSSNKQLQRTVTRRRGDGASAPFHYALAPRITRQRAAAELRR |
| Ga0062593_1001006643 | 3300004114 | Soil | MANDTALSPNKQLERTVIRRRVRAASAPFHYALAARWTAQRAAAQLRR* |
| Ga0062589_1002054512 | 3300004156 | Soil | MRIASPNKQLERTVIRRDVRAACAPFHCAHAARWTRGHAAAQLRR* |
| Ga0062589_1010468432 | 3300004156 | Soil | VQVPHNKQLQRTVIRRRGDVASAPFHYALAPRVTRQRAAAELRR* |
| Ga0063356_1009442863 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MAYNKQLQRTVIGRRERDACASFHFAHAPRWTRGRAAAELRR |
| Ga0063356_1029165401 | 3300004463 | Arabidopsis Thaliana Rhizosphere | VIRRRGDGASAPFHSALAPRFKRQRAAAELRRYASAFRR* |
| Ga0063356_1029491251 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MSVLESASQSPNKQLERTVMHRRERAACASFHCAHAARWTVGHAAAQL |
| Ga0063356_1034496371 | 3300004463 | Arabidopsis Thaliana Rhizosphere | VLDLMLCQPPNKQLQRTVTLRRGDGTSAPFHYALAPRVTRQRAAA |
| Ga0062592_1000746491 | 3300004480 | Soil | MTANKQLQRTVTRRRGRGACASFHYAHAPRLTRQRAAAELRRYTTRGVAL* |
| Ga0062592_1025669302 | 3300004480 | Soil | VPPNKQLQRTVERHRGDAARASFHYARASRGKRQRAAAELRR* |
| Ga0062594_1020625491 | 3300005093 | Soil | LQRTVTRRRGDGASAPFHYALAPRITPQYAAAELRRYTSTPVQRTS* |
| Ga0068996_100761202 | 3300005218 | Natural And Restored Wetlands | MRMPYNKQLQRTAVRHHAVVASAPFHYALASRITRQRAAAELRR* |
| Ga0065712_102257262 | 3300005290 | Miscanthus Rhizosphere | LQQVPYNKQLQRTVKRRRRRAASASFHYALAARSNPQRAAAELRR* |
| Ga0070690_1014428392 | 3300005330 | Switchgrass Rhizosphere | MIRGPYNKQLQRTVIGRRGDGASAPFHYALAPRIARQRAAAELRR* |
| Ga0070670_1008624281 | 3300005331 | Switchgrass Rhizosphere | PPNKQLQRTVERCRGRAASASFHYALAARTNRQRAAAELRR* |
| Ga0070670_1014017112 | 3300005331 | Switchgrass Rhizosphere | MKSRIPLTPNKQLQRTVMRHRGDTASAPFHYALAPRITRRRAAAELRR* |
| Ga0066388_1073078151 | 3300005332 | Tropical Forest Soil | RALCQPPNKQLQRTVERSRGRAASASFHYALAARINPQRAAAELRRYTALST* |
| Ga0068869_1002129455 | 3300005334 | Miscanthus Rhizosphere | NKQLQRTVTRRRGRAARAAFHCAHAARWTRGRAAAELRR* |
| Ga0070680_1000329432 | 3300005336 | Corn Rhizosphere | MLVAMSPNKQLQRTVTRRRGDGASAPFHYALAPRITRQRAAAEQRR* |
| Ga0070682_1005944861 | 3300005337 | Corn Rhizosphere | NKQLQRTVERYRGRAASASFHYALAARSNRQRAAAELRR* |
| Ga0070682_1009239972 | 3300005337 | Corn Rhizosphere | VVTEALCQPPNKQLQRTVIPQRGRAASASFHCARAARWFVQRAAAELRR* |
| Ga0070682_1011331671 | 3300005337 | Corn Rhizosphere | VVLKPVCESPNKQLQRTVIGHRGRAARAAFHCAHGARFIRQRAAAELRR |
| Ga0070691_104381061 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | APHNKQLQRTVIRRRGRAAREPFHYARASRWTRGRAAAELRR* |
| Ga0070691_111055651 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | PPNKQLQRTVTRRRGDGASAPFHYALAPRSKRRRAAAELRR* |
| Ga0070687_1005773842 | 3300005343 | Switchgrass Rhizosphere | MSANKQLQRTVERYRGRAASASFHCALAARSKPQRAAAELRR* |
| Ga0070687_1007130592 | 3300005343 | Switchgrass Rhizosphere | NKQLQRTVQTVSRRAARAPFHFARASRFTRQCAAAELRR* |
| Ga0070687_1013822201 | 3300005343 | Switchgrass Rhizosphere | VTPNKQLQRTVIRRRGDGASAPFHYALAPRITRQRAAAELRR |
| Ga0070692_101923671 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | NKQLQRTVTRRRGDGASAPFHYALAPRFTRQRAAAELRRYASR* |
| Ga0070669_1003236622 | 3300005353 | Switchgrass Rhizosphere | VLHLVYESTSPNKQLQRTVTRRRGDGASAPFHYALAPRFTRQRAAAELRR* |
| Ga0070675_1018806071 | 3300005354 | Miscanthus Rhizosphere | PPNKQLQRTVERHRGDAARASFHYARASRGKRQRAAAELRR* |
| Ga0070688_1005170502 | 3300005365 | Switchgrass Rhizosphere | MVPHNKQLQRTVQQHRGRAGSASFHYALAARSNPHRAAAELRRCAA* |
| Ga0070688_1006773083 | 3300005365 | Switchgrass Rhizosphere | MLCQPPNKQLQRTVTRRRGDGASAPFHYALAPRITRQRAAAEL |
| Ga0070701_100039208 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | MLTHESPNKQLERTAIRRRVRAASAPFHYAHAARWTARRAAAQLRR* |
| Ga0070701_100160717 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | PNKQLQRTVTRRRGDGASAPFHYALAPRITPQYAAAELRRYTSTPVQRTS* |
| Ga0070701_102584441 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | PNKQLQRTVTRRRGDGASAPFHYALAPRFTRQCAAAELRR* |
| Ga0070701_104572352 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | PNKQLQRTVTRRRGRAARAAFHCAHAARWTRGRAAAELRR* |
| Ga0070701_106180991 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | NKQLQRTVIGRRGDGASAPFHYALAPRIARQRAAAELRR* |
| Ga0070701_109391183 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | NKQLQRTVTRRRGDGASAPFHYALAPRITRYRAAAELRR* |
| Ga0070701_113168842 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | PNKQLQRTVIRRRGDGASAPFHSALAPRITRQRAAAELRRYASN* |
| Ga0070700_1014505871 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MVQSPNKQLQRTVIPNHWRAASASFHYAHAARWTRGRAAAELRR* |
| Ga0070700_1016570241 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | QPPNKQLQRTVERCRGRAASASLHCALAARFKPQHAAAELRR* |
| Ga0070694_1003144352 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MIRGPYNKQLQRTVIGRRGDGASAPFHYALAPRITRQRAAAELRR* |
| Ga0070694_1017075661 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | NKQLQRTVTRRRGDGASAPFHYALAPRFTRQRAAAELRR* |
| Ga0070694_1018594152 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | AVLHLVYESTPHNKQLQRTVTRRRGDGASAPFHYALAPRITRQRAAAELRR* |
| Ga0070681_113159762 | 3300005458 | Corn Rhizosphere | MSASEVPANKQLQRTVTRRRGDGASAPFHSALAPRITRQRAAAELRR* |
| Ga0068867_1008610841 | 3300005459 | Miscanthus Rhizosphere | NKQLQRTVTGRRGRAARAAFHCAHAARWTRGRAAAELRR* |
| Ga0068867_1022382212 | 3300005459 | Miscanthus Rhizosphere | MAPYNKQLQRTVIRRRVRAASAPLHYALAARITRQRAAAELRRYAAR |
| Ga0070672_1015423732 | 3300005543 | Miscanthus Rhizosphere | PNKQLQRTVTRRRGDGASAPFHYALAPRITRQRAAAELRR* |
| Ga0070672_1017676321 | 3300005543 | Miscanthus Rhizosphere | NKQLQRTVTQRRGDGASAPLHYALAPRFTRQRAAAELRR* |
| Ga0070696_1000848085 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | VPHNKQLQRTVQTASRRGASASLHHARAPRLIVQRAAAELRL* |
| Ga0070696_1013676292 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | SCQPPNKQLQRTVERCRGRAASASFHYALAARSSGQRAAAELRR* |
| Ga0070696_1014491451 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | NKQLQRTVTRRRGDGASAPFHYALAPRIRRQRAAAELRR* |
| Ga0070696_1016128771 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | THNKQLQRTVTRRRGDGASAPFHYALAPRFTRQRAAAELRRYTALPA* |
| Ga0070665_1003791534 | 3300005548 | Switchgrass Rhizosphere | ALCQPPNKQLQRTVIRRRGRAASASFHCALAARSRLQRAAAELRR* |
| Ga0070704_1003291971 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | PNKQLQRTVTRRRGDGASAPFHYALAPRFTPKCAAAELRR* |
| Ga0070704_1004991531 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | PNKQLQRTVTGRRGDGASAPFHCALAARFTRQCAAAELRR* |
| Ga0070704_1006039312 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MKSTSCQPPNKQLERTVIRRHVRAACASFHYAHAARFTRLRAAAELRR* |
| Ga0070704_1007490702 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MSARSGTYKQLQRTVTRRRGDSASAPFHYTLALRFTRQRAAAELRR* |
| Ga0070704_1019223012 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MTACNQGARALCQPPNKQLQRTVTRRRGDGASAPFHYALAPRITRQRAAAELR |
| Ga0068857_1011805331 | 3300005577 | Corn Rhizosphere | NKQLQRTVTRRRGDGASAPLHYALAPRFTRRRAAAELRR* |
| Ga0068852_1003908691 | 3300005616 | Corn Rhizosphere | NKQLQRTVIRRRGRAASASLHCALAARSRRQRAAAELRR* |
| Ga0068859_1017401691 | 3300005617 | Switchgrass Rhizosphere | APNKQLQRTVTRRRGDGASAPFHYALAPRSTRQRAAAELRR* |
| Ga0068859_1025170831 | 3300005617 | Switchgrass Rhizosphere | NKQLQRTVQTVSRRGARASFHYARAPRFTRQRAAAELRR* |
| Ga0068859_1028557361 | 3300005617 | Switchgrass Rhizosphere | MRIASPNKQLQRTVTRRRGRAASAPFHYALAPRITRQRAAAEL |
| Ga0066905_1004594971 | 3300005713 | Tropical Forest Soil | MCHPPNKQLQRTVIRRRGDGASAPLHYALAPRFTRQ |
| Ga0068861_1000892445 | 3300005719 | Switchgrass Rhizosphere | MPSNKQLQRTVIRRRGDGASASFHYALAPRVTRQRAAAELRR* |
| Ga0068861_1002630024 | 3300005719 | Switchgrass Rhizosphere | MLCQPPNKQLQRTVTPRRGDGASAPLHYALAPRFTRQRAAAELRR* |
| Ga0074470_112672023 | 3300005836 | Sediment (Intertidal) | MIPLSEASSKSPNKQLQRTVTRHRGDGTSAPFHYALVPRFQRKRAAAELRH* |
| Ga0074470_118215271 | 3300005836 | Sediment (Intertidal) | MTHNKQLQRTVERYRGRAASASFHYALAARGNPQRAAAELRR* |
| Ga0068862_1005103991 | 3300005844 | Switchgrass Rhizosphere | HNKQLQRTVTRRRGDGASAPFHCALAPRVTRQRAAAELRR* |
| Ga0068862_1007773072 | 3300005844 | Switchgrass Rhizosphere | KQLQRTVIGRRGDGASAPFHYALAPRIARQRAAAELRR* |
| Ga0068862_1016029511 | 3300005844 | Switchgrass Rhizosphere | PPNKQLRRTVIRRHMRAASASFHYAHAARWLGQRAAAELRR* |
| Ga0068862_1019244091 | 3300005844 | Switchgrass Rhizosphere | RTVTRHRGDGASAPFHYALAPRFTRQRAAAELRR* |
| Ga0068862_1027394892 | 3300005844 | Switchgrass Rhizosphere | LQRTVIGRRGDGASAPFHYALAPRIARQRAAAELRR* |
| Ga0075297_10180022 | 3300005878 | Rice Paddy Soil | MKNGSSDMLCQSPNKQLERPVMRYRGDAASAPFHYALSSRVTRQRAAAQLRR* |
| Ga0066651_104134651 | 3300006031 | Soil | VNPPNKQLQRTVERHRGAAASAPFHCALASRITPQRAAAELRRYTAR |
| Ga0066652_1003919043 | 3300006046 | Soil | KQLQRMVTRRHMRAARASFQCAHAARFLAQRAAAELRR* |
| Ga0079221_114721662 | 3300006804 | Agricultural Soil | MSAREETYKQLQRTVQTVSRRGARASFHYARAPRSNGQRAAAELRRYAHR* |
| Ga0075421_1014472052 | 3300006845 | Populus Rhizosphere | VTANKQLQRTVERHCGDAASAPFHYALTARSIGQRAAAELRRW |
| Ga0075421_1019726072 | 3300006845 | Populus Rhizosphere | NKQLQRTVTRRRGDGASAPLHYALAPRFTRQRAAAELRR* |
| Ga0075431_1002833443 | 3300006847 | Populus Rhizosphere | PNKQLQRTVTRRRGDGASAPFHYALAPRITRQRAAAELRL* |
| Ga0075431_1008668002 | 3300006847 | Populus Rhizosphere | MMLFTSCQPRDKQLERTVIRRCVRAASAPFHYALAARWTAQRAAAQLRR* |
| Ga0075433_100410355 | 3300006852 | Populus Rhizosphere | VSAYNKQLQRTVTRHRGDGASASFHYALAPRITRQRAAAELRRSATL* |
| Ga0075433_100410358 | 3300006852 | Populus Rhizosphere | VSTLCQAPNKQLERTVIRQRVRAASASFHCAHAARWTGRRAAAQLRR* |
| Ga0075420_1015238722 | 3300006853 | Populus Rhizosphere | MEFLQASCQAHNKQLQRTVIWRRGRAASAAFHFAHAARWRAQRAAAELRR |
| Ga0075425_1000511255 | 3300006854 | Populus Rhizosphere | VLINEHPPRVPPNQQLERTVIRRRRRAASAPFHYAPAARNKRQRAAAELQR* |
| Ga0075425_1024072372 | 3300006854 | Populus Rhizosphere | TPNKQLQRTVKRRRGRAASASFHCALAVRSDRQRAAAELRRYTAQDAA* |
| Ga0073934_100975433 | 3300006865 | Hot Spring Sediment | MQPSVHSVTYDKQLQPTVIPQRMRAASASFHYALAARWTAQRAAAELRR* |
| Ga0073934_101068291 | 3300006865 | Hot Spring Sediment | LQRTVIPNRWRAASAPLHYALAARWTRGRAAAELRRWADRHHADSLKETN* |
| Ga0073934_103198831 | 3300006865 | Hot Spring Sediment | NKQLERTVIRRRVRAASAPFHYALATRWRAQRAAAQLRR* |
| Ga0079217_111667062 | 3300006876 | Agricultural Soil | PSAIPPNKQLERTVIRRRRRGASASFHYAHAQRWLAPRAAAELRR* |
| Ga0079217_117610791 | 3300006876 | Agricultural Soil | TSLSANKQLQRTVTRRRADGASAPFHYALAPRITRLRAAAEQRR* |
| Ga0075429_1010740512 | 3300006880 | Populus Rhizosphere | MSANKQLQRTVIRRRGDTASAPFHSALAARFTRQRAAA |
| Ga0075429_1016232561 | 3300006880 | Populus Rhizosphere | MNAMLVALAANKQLQRTVTGRRGDGVSAPFHYALAPRTTRQRAAAELRR* |
| Ga0068865_1011889151 | 3300006881 | Miscanthus Rhizosphere | NKQLQRTVTRRRGDGASAPFHYALAPRITPQYAAAELRRYTSTPVQRTS* |
| Ga0079215_103578163 | 3300006894 | Agricultural Soil | MPPNKQLQRTVIRRRGDAASAPSHYALAARFTRQR |
| Ga0075426_100253878 | 3300006903 | Populus Rhizosphere | MSHGVTPCRRVPANKQLQRTVTRRRGDGASAPFHCALAARFMRQRAAAELRR* |
| Ga0075424_1022909932 | 3300006904 | Populus Rhizosphere | AVLHLVYESTTPNKQLQRTVTRRRGRAARAPFHYARASRFTRQRAAAELRR* |
| Ga0079219_121859251 | 3300006954 | Agricultural Soil | PNKQLQRTVTRRRGRGACASFHCAHAPRWTVGHAAAELRRYTPD* |
| Ga0075419_106231892 | 3300006969 | Populus Rhizosphere | VCQPPNKQLERTVIRRRERAACASFHCALAARFTRQHAAAELRRYAP |
| Ga0075419_110529802 | 3300006969 | Populus Rhizosphere | MSIKQLQRTVIRRRGRAASASFHYALAARFTRQRAAAELRR* |
| Ga0079218_103188501 | 3300007004 | Agricultural Soil | NKQLQRTVTRRRGRGACASLHYAHAPRWMAQRAAAELRR* |
| Ga0079218_104435941 | 3300007004 | Agricultural Soil | MPANKQLQRTVTRRRGRAARAPFHYARASRWTVGHA |
| Ga0079218_106100412 | 3300007004 | Agricultural Soil | MPTSLPDSAAPYNKQLQPTVIPRHVRAASAPLHYALAARWTAQRAAAELRR |
| Ga0079218_109846501 | 3300007004 | Agricultural Soil | VPRAHNKQLQRTVIRRRGDGTSAPFHYALVPRFTRQRAAAELRRYAD* |
| Ga0079218_111437671 | 3300007004 | Agricultural Soil | PNKQLQRTVTRRRGDGASAPFHSALAPRIQQQRAAAELRR* |
| Ga0079218_114486441 | 3300007004 | Agricultural Soil | APNKQLQRTVTRRRGDGTSAPFHYALVPRFTRQRAAAELRR* |
| Ga0079218_120685191 | 3300007004 | Agricultural Soil | MIAPSSNKQLERTVIRRHVRAASAPFHYALAARWTAQRAAAQLRRYAATE |
| Ga0079218_123837303 | 3300007004 | Agricultural Soil | VTPNKQLQRTVTRRRGRGASAPFHYALAPRFTRQRAAAELRR* |
| Ga0079218_126636391 | 3300007004 | Agricultural Soil | MSPNKQLQRTVTRRRGDGASAPFHYALAPRVERHRAAA |
| Ga0079218_128606591 | 3300007004 | Agricultural Soil | YNKQLQPTVIPRHVRAASAPLHYALAARWTAQRAAAELRRYVA* |
| Ga0079218_129139431 | 3300007004 | Agricultural Soil | MKSGSFRMLCQSPNKQLQRTVTRRRVRVAASHFIYARAPRFTRQRAAAELRR* |
| Ga0079218_130787211 | 3300007004 | Agricultural Soil | YNKQLQPTVIPRHVRAASAPLHYALAARWTAQRAAAELRR* |
| Ga0105106_101454691 | 3300009078 | Freshwater Sediment | MAPYNKQLQRTVTRRRGDTASAPFHYALAVRFTQQRAAAELRL* |
| Ga0105106_112033541 | 3300009078 | Freshwater Sediment | MALAHNKQLQRTVTRHRGDAARAPFHYARASRFTRQRAAAELRRYTPR* |
| Ga0105107_101156873 | 3300009087 | Freshwater Sediment | MALAHNKQLQRTVTRHRGDAARAPFHYARASRFTRQRAAAELRL* |
| Ga0105107_105449612 | 3300009087 | Freshwater Sediment | MAVVTPNKQLQRTVTRRRGDGASAPFHYALAPRITRQRAAAELRR* |
| Ga0105107_106072952 | 3300009087 | Freshwater Sediment | MAPDKQVERTVTRRHVRAASAPFHYAHAARWTRGRAAAQL |
| Ga0105107_107669461 | 3300009087 | Freshwater Sediment | QSPNKQLQRTAERHRGDTTSAPFHYALAARGTRQRAAAELRR* |
| Ga0105107_110713362 | 3300009087 | Freshwater Sediment | MSANKQLQRTVIPKRMRAASASFHYALAARSKRQRAAAELRL* |
| Ga0105240_119097651 | 3300009093 | Corn Rhizosphere | WPPPNKQLQRTVERHRGAAARAPFHYARASRFTRQRAAAELRR* |
| Ga0111539_101031646 | 3300009094 | Populus Rhizosphere | MSPNKQLERTVMRHRVRAASAAFHYALAPRFTRQRAAAELRRSAT* |
| Ga0111539_103768851 | 3300009094 | Populus Rhizosphere | MSANKQLQRTVIRRRGDTASAPFHSALAARFTRQRAAAELRR* |
| Ga0111539_105766031 | 3300009094 | Populus Rhizosphere | KQLQRTVTRHRGDGTSAPFHFALAPRFTRQRAAAELRR* |
| Ga0111539_105969631 | 3300009094 | Populus Rhizosphere | MSGRGTAHNKQLQRTVTRRRGDGASAPFHYALAPRITRQRAAAELRR* |
| Ga0111539_112356871 | 3300009094 | Populus Rhizosphere | CQPPNKQLQRTVIRHRGDGASAPFHYALAPRFTRQRAAAELRR* |
| Ga0111539_125922092 | 3300009094 | Populus Rhizosphere | QLQRTVTRRRGDGASAPFHSALAPRITRQRAAAELRR* |
| Ga0111539_126873192 | 3300009094 | Populus Rhizosphere | NKQLQRTVIRRHVRAASAPFHYALAARWIARRAAAELQR* |
| Ga0111539_132095781 | 3300009094 | Populus Rhizosphere | KQLQRTVTRRRGDGASAPFHYALAPRFTRQRAAAELRR* |
| Ga0079224_1002852571 | 3300009095 | Agricultural Soil | NKQLQPTVIPNRWRGASAPFHCALAPRLIAHRAAAELRRYALVVR* |
| Ga0079224_1003178592 | 3300009095 | Agricultural Soil | MCRLGVSRTPNKQLQRTVIPLRVRGASASFHYALAPRIMRQHAAAELRR* |
| Ga0079224_1010979901 | 3300009095 | Agricultural Soil | PNKQLQRTVIPPRGDATSAPFHYALAARITRHHAAAELQR* |
| Ga0079224_1011344933 | 3300009095 | Agricultural Soil | PNKQLQRTVIPNRWRGASASFHYALAPRFKRHRAAAELRRYATNDT* |
| Ga0079224_1012557901 | 3300009095 | Agricultural Soil | KQLQRTVIPNHGRAASAPPHYALAARGIRGRAAAELRR* |
| Ga0079224_1014897791 | 3300009095 | Agricultural Soil | ANKQLQRTTIPQHVRAASASFHYALAARWTRGCAAAELRR* |
| Ga0079224_1020032301 | 3300009095 | Agricultural Soil | VPNKQLQRTVIPPRGDATSAPFHYALAARITRHHAAAELQR* |
| Ga0079224_1022893672 | 3300009095 | Agricultural Soil | AVPHNKQLQPTVIPNRWRGASAPFHCALAPRLIAHRAAAERRR* |
| Ga0079224_1027624861 | 3300009095 | Agricultural Soil | NKQLQPTVIPKTVRGARAPFHYARAPRFMRQRAAAELRG* |
| Ga0079224_1030351291 | 3300009095 | Agricultural Soil | NKQLQRTTIPQHVRAASASFHYALAARWTRGCAAAELRR* |
| Ga0079224_1047830142 | 3300009095 | Agricultural Soil | MYSCVTVAVPHNKQLQPTVIPNRWRGASAPFHCALAPRLIAHRAAAE |
| Ga0079224_1052199581 | 3300009095 | Agricultural Soil | MRSALRQPPNKQLQRTVIPNHGRAASAPPHYALAARGIRGRAAAEL |
| Ga0075418_128861991 | 3300009100 | Populus Rhizosphere | QLQRTVTRRRGDGASAPFHYALAPRFTLQRAAAELRR* |
| Ga0114129_132313471 | 3300009147 | Populus Rhizosphere | MKKLSRRPPNKQLERTVIPRRVRAASAPFHYALAARWTRGHAAAQLR |
| Ga0105243_100433428 | 3300009148 | Miscanthus Rhizosphere | LCQPPNKQLERAVTRHRERAASAPFHYALASHFSRQRAV |
| Ga0105243_103172031 | 3300009148 | Miscanthus Rhizosphere | QLQRTVTRRRGDGASAPFHYAHAARWTLGRAAAELRR* |
| Ga0105243_121656301 | 3300009148 | Miscanthus Rhizosphere | QLQRTVTRRRGDGASAPFHYALAPRITRYRAAAELRR* |
| Ga0111538_107256201 | 3300009156 | Populus Rhizosphere | GMSANKQLQRTVTRRRGDGASAPFHYALAPRFTRQCAAAELRR* |
| Ga0111538_107440993 | 3300009156 | Populus Rhizosphere | SPNKQLQRTVTRRRGDGASAPFHYALAPRVTRQRAAAELRR* |
| Ga0111538_108377411 | 3300009156 | Populus Rhizosphere | LQRTVIRRRGDGASAPFHYALAPRFTRQRAAAELRR* |
| Ga0111538_108844701 | 3300009156 | Populus Rhizosphere | NKQLQRTVIRRRGRAARAPFHYARASRWTRGRAAAELRR* |
| Ga0111538_118190971 | 3300009156 | Populus Rhizosphere | NKQLQRTVIRRRGDGASAPFHYALAPRITGQRAAAELRRYAP* |
| Ga0111538_124203741 | 3300009156 | Populus Rhizosphere | NKQLQRTVTRRRGDGASAPFHSALAPRFTRYRAAAELRR* |
| Ga0111538_124847122 | 3300009156 | Populus Rhizosphere | MAVLSSASQPPNKQLQRTVQTVSRRGARASFHYARAPRFKLQR |
| Ga0111538_125649911 | 3300009156 | Populus Rhizosphere | SPNKQLQRTVTRSRGDAARAPFHYARAPRFTRQRAAAELRR* |
| Ga0111538_126135471 | 3300009156 | Populus Rhizosphere | MSPNKQLQLTVIRRRGDDASAPFQYALAPRIKRRRAAAE |
| Ga0111538_133450721 | 3300009156 | Populus Rhizosphere | PPNKQLQRTVTRRRGDGASAPLHYALAPRFTRQRAAAELRR* |
| Ga0105092_106692281 | 3300009157 | Freshwater Sediment | TTPTSMAPAHNKLLQRTVIPNRVRAASASLHYALAARFTRQRAAAELRR* |
| Ga0105100_100300374 | 3300009166 | Freshwater Sediment | VTSNKQLQRTVIRRHMRAASAPFHYALTARSIGQRAAAELRR* |
| Ga0105242_126535482 | 3300009176 | Miscanthus Rhizosphere | NKQLQRTVTRRRGDGASAPFHYALAPRFTRQRAAAELRRYTAQIAGCGF* |
| Ga0105249_110301981 | 3300009553 | Switchgrass Rhizosphere | PPNKQLQRTVTRRRDDGASAPFHYALAPRFTRQRAAAELRR* |
| Ga0105252_101734111 | 3300009678 | Soil | QLERTAMPRRVRAASASFHYAHAARWIAQRAAAQLRR* |
| Ga0116144_101568471 | 3300009687 | Anaerobic Digestor Sludge | NGCVAMTANKQFERTVMRRCVRAASAPFHYAHAARWTPRRAAAQLRR* |
| Ga0131851_10777152 | 3300009852 | Compost | LSVVVPLPNKQLQPTVIPNRMRAASASFHYAIAPRWTRGRAAAELRR* |
| Ga0131077_104478733 | 3300009873 | Wastewater | MDAVTPHNKQLQRTVTQHRGDGASAPIHCALAPRFTRQRAAAELRR* |
| Ga0105029_1035112 | 3300009984 | Switchgrass Rhizosphere | MQDHGKQNGVSIKQLQPTVIPKRMRAASASFHYALAARWTAQRAAAELRR* |
| Ga0126384_119126302 | 3300010046 | Tropical Forest Soil | VPHNNRLQRTAIRQRGRAVSAPFHYALTARVTRQRAAAEPE |
| Ga0134063_101787221 | 3300010335 | Grasslands Soil | DVCQAPNKQLQRTVTRQRGDAASAPFHYALALRCTRQLAAAELRR* |
| Ga0134062_100634991 | 3300010337 | Grasslands Soil | TYKQLQRMVTRRHMRAARASFQCAHAARFLAQRAAAELRL* |
| Ga0134062_105034463 | 3300010337 | Grasslands Soil | YKQLQRTVTRRRGDGASAPFHYALAPRWTGSRAAAELRR* |
| Ga0116237_110123212 | 3300010356 | Anaerobic Digestor Sludge | MRIALSPNKQLQRTVIRRRGDGASAPFHYALAPRFIRQRAAAELQR* |
| Ga0126377_100614695 | 3300010362 | Tropical Forest Soil | VTLCQPPNKQLQRTVIPNRGRAASASFHYARAARWTARRAAAELPRWAVR* |
| Ga0126377_101702001 | 3300010362 | Tropical Forest Soil | KQLQRTVERSRGRAATASFRDAPAARINRQRAAAGLRR* |
| Ga0134066_104230702 | 3300010364 | Grasslands Soil | MPYNNRLQRTVTRRRGRAASASFHYAHAARWTARRAAAQLRRY |
| Ga0126383_100286018 | 3300010398 | Tropical Forest Soil | MLSFLTKSWRCALPPNKQLQRTVRPAERRAASASFHCALAARSKRQRAAAELRR* |
| Ga0134127_100032871 | 3300010399 | Terrestrial Soil | QLQRTVTRRRGDGASAPFHYALAPRFTRQRAAAELRRYTALPA* |
| Ga0134127_100315233 | 3300010399 | Terrestrial Soil | MPPDTALTLIALPPNKQLERTVMRRRMRAARAPFHYAPAARWTRGRAAAQLRR* |
| Ga0134127_100315235 | 3300010399 | Terrestrial Soil | MTPNKQLERTVILRHVRAASAPFHYALAARWTAQRAAAQLRR* |
| Ga0134127_103849995 | 3300010399 | Terrestrial Soil | NKQLQRTVTRRRGDGASAPFHYALAPRWTAQRAAAELRR* |
| Ga0134127_105435941 | 3300010399 | Terrestrial Soil | MGAAPHNKQLQRTVIRSRGDGASAPFHYALAPRFTRQRAAAELRRYAR* |
| Ga0134127_111198481 | 3300010399 | Terrestrial Soil | NKQLQRTVTRRRDDGASAPFHYALAPRFTRQRAAAELRR* |
| Ga0134127_113228583 | 3300010399 | Terrestrial Soil | PNKQLQRTVIRRRGDGASAPFHSALAPRITRQRAAAELRR* |
| Ga0134127_114189692 | 3300010399 | Terrestrial Soil | MPHNKQLQRTVIPNRWRAARASFHYALAPRWIAQRAAAELRRYA* |
| Ga0134127_118064143 | 3300010399 | Terrestrial Soil | MLCQPPNKQLQRTVTRRRGDGASAPFHYALAPRFTRQRA |
| Ga0134127_119002961 | 3300010399 | Terrestrial Soil | MVPYNKQLQRTLTRRRGRGACAPFHYAHAPRVTLQRAAAE |
| Ga0134127_122011141 | 3300010399 | Terrestrial Soil | MIRGPYNKQLQRTVIGRRGDGASAPFHYALAPRITRQRAAAELRR |
| Ga0134127_123314741 | 3300010399 | Terrestrial Soil | PNKQLQRTVTRRRGDGASAPFHYALAPRVTRQRAAAELRR* |
| Ga0134127_123869903 | 3300010399 | Terrestrial Soil | YNKQLQRTVTRRRGDGASAPFHYALAPRITRHRAAAELRR* |
| Ga0134127_124800712 | 3300010399 | Terrestrial Soil | MMPAPDVLSPNKQLQRTVERCRGRAASASFHYALAARYNRQRAAAELRR* |
| Ga0134127_132096601 | 3300010399 | Terrestrial Soil | QPPNKQLQRTVTRRRGDGASAPFHYALAPRVIRHRAAAELRR* |
| Ga0134122_100227643 | 3300010400 | Terrestrial Soil | MKCQAPDKQLQRTVTRHRSDVASAPFHCALAARVKRQRAAAELRR* |
| Ga0134122_127438302 | 3300010400 | Terrestrial Soil | MRFFVLSCQAYNKQLQRTVERCHGRAASASFHYALAARNNRQRA |
| Ga0134121_117219061 | 3300010401 | Terrestrial Soil | LQRTVERCRGRAASASFHYALAARSNRQRAAAELRR* |
| Ga0134123_104041343 | 3300010403 | Terrestrial Soil | MLVAMSPNKQLQRTVTRRRGDGASAPFHYALAPRVTR |
| Ga0134123_109790372 | 3300010403 | Terrestrial Soil | PNKQLQRTVTRRRGDGASAPFHYAHAARWTLGRAAAELRR* |
| Ga0134123_117485341 | 3300010403 | Terrestrial Soil | MACGFSEVSAAPHNKQLQRTVIRRRGRAAREPFHYARASRWTRGRAAAELRR |
| Ga0134123_121705762 | 3300010403 | Terrestrial Soil | VLHLVYESTAPNKQLQRTVTRHRGDGASAPFHYALAPRFTRRRAAAELRR |
| Ga0134123_127950751 | 3300010403 | Terrestrial Soil | KQLQRTVTRRRGDGASAPFHYALAPRFTPQRAAAELRR* |
| Ga0137454_10152173 | 3300011406 | Soil | PLQRTVTRRRERGASASFHYALAPRLTAQRAAAELRR* |
| Ga0137323_11351761 | 3300011409 | Soil | NKQLERTVIRRRVRAASASFHYAHAARWTAQRAAAQLRRYPH* |
| Ga0137462_10180673 | 3300011421 | Soil | MSARNGTYKQLQRTVTRRRGRAASASFHYALAARNHPQRAAAE |
| Ga0137439_10502053 | 3300011424 | Soil | MVRATALCQPPNKQLQRTVTRRRGDGASAPFHYALAPRFTRQRAAAELRR* |
| Ga0137441_10098786 | 3300011425 | Soil | VGTITIEGGALSPNKQLQRTVIRQHGRAASASFHYALAARWLGQRAAAELRRYALT* |
| Ga0137456_11134672 | 3300011428 | Soil | VTAPKSDFFPAACQPPNKQLQRTVIPNRWRGASASFHYALALRWTRGHAAAELRL* |
| Ga0137443_11476552 | 3300011433 | Soil | VPAPNKQLERTVIRHRGRATSASFHYALASRLTAQRAAAQL |
| Ga0137432_12892691 | 3300011439 | Soil | QPPNKQLQRTVIPQHVRATSAPFHYALAARITRRRAAAELRR* |
| Ga0137433_10275321 | 3300011440 | Soil | MMLMSVARAPNKQLQRTVMRRRGDVASAPFHYALAPRFTRQRAAAELRL* |
| Ga0137433_11426402 | 3300011440 | Soil | MSCQTHNKQLQRTVIPHRWRAASAPFHYALAARWAAHRAAAELRRYTAEER* |
| Ga0137430_10796892 | 3300012041 | Soil | MSGAITRAPHNKQLQRTVTRRRGDGTSAPFHYALAPRWTAQRAAVELRR* |
| Ga0137430_11270321 | 3300012041 | Soil | MTPNKQLQRTVTRRGGDAASAPFHYALAARFTRQRAAAELRR* |
| Ga0137354_10174283 | 3300012143 | Soil | LRRTVRRHRGRAASASFHDVLAARSMWQRAAAELRRWATIPLEKE* |
| Ga0137336_10516362 | 3300012161 | Soil | SPNKQLQRTVMRRRGRATSALFHYALASRFTRQRAAAELRL* |
| Ga0137363_100522304 | 3300012202 | Vadose Zone Soil | MTPNKQLQRTVTRRRGRGASAAFHYALAPRWIAQRAAAELRR* |
| Ga0137335_10064953 | 3300012670 | Soil | ANKQLERTVTRRHVRAASAPFHYAHAARWLAQRAAAQLRR* |
| Ga0137398_103131702 | 3300012683 | Vadose Zone Soil | ISVACQPHNKQLERAVTRYRGGAASAPFYYALTSRFTRQRAVAQLRR* |
| Ga0157300_10058182 | 3300012884 | Soil | VPANKQLQRTVIGRRGDGASAPFHYALAPRITRQRAAAELRR* |
| Ga0157300_10244671 | 3300012884 | Soil | VVPAHNKQLQRTVIRRRGDGASAPFHYAHAPRWWAQRAAAELQR* |
| Ga0157305_100163094 | 3300012891 | Soil | QRTVLGRRGRAASAAFHFAHAARWTRGRAAAELRR* |
| Ga0157305_102327282 | 3300012891 | Soil | SKSFIDVARLAPNKQLQRTVTRRRGDGASAPFHYALAPRITRQRAAAELRR* |
| Ga0157309_100910912 | 3300012895 | Soil | LVYESTAYNKQLQRTVTGRRGDGASAPFHYALAPRITRHRAAAELRR* |
| Ga0157309_103418362 | 3300012895 | Soil | VPFLEQQSALCQPPNKQLERTVMRHRGDTASAPFHYALAVCFTRQRAAAELRR* |
| Ga0157285_102068252 | 3300012897 | Soil | SPNKQLQLTVIRRRGDDASAPFQYALAPRIKRRRAAAELRR* |
| Ga0157299_101227092 | 3300012899 | Soil | VPANKQLQRTVIGRRGDGASAPFHYALAPRITRQRAAAELRL* |
| Ga0157282_103072821 | 3300012904 | Soil | MSPNKQLQLTVIRRRGDDASAPFQYALAPRIKRRRAAAELRL* |
| Ga0157296_101161702 | 3300012905 | Soil | MQSSLAPPNKQLQRTRRRGDGASAPFQYALAPRFTRRHAAAELRRYT |
| Ga0157296_102421793 | 3300012905 | Soil | LGRTVMRRRGRGARASFHYARALRFMRQRAAAELRR* |
| Ga0157308_100033655 | 3300012910 | Soil | MVLFTSCQPPNKQLQRTAIRRRVRAACASFHCAHAARWTRGRAAAQLRR* |
| Ga0157308_100067475 | 3300012910 | Soil | VPANKQLQRTVIGRRGDGASAPFHYALAPRITRQRAA |
| Ga0157306_103091142 | 3300012912 | Soil | NKQLQRTVTRRRGDGASAPFHYALAPRIKRRRAAAELRR* |
| Ga0157298_100351951 | 3300012913 | Soil | WERRTVPAPNKQLQRTVTRGRGDVAGAPFHYALAPRITRQRAAAELRL* |
| Ga0157310_103518561 | 3300012916 | Soil | MSPNKQLQLTVIRRRGDDASAPFQYALAPRIKRRRAAAELRR* |
| Ga0137413_118300732 | 3300012924 | Vadose Zone Soil | MMDDAPCQPPNKQLQRTVTGHRSAVASAPFHYALAPRVKRQRAAAELRR* |
| Ga0164241_101369221 | 3300012943 | Soil | NKQLQRTVIRHRGGATRAPFHYARAARSRRQRAAAELRL* |
| Ga0164241_107201343 | 3300012943 | Soil | LGGLTYNKQLQRTVTRRRGDGASAPFHYALAPRFTRQRAAAELRR* |
| Ga0137410_1000064111 | 3300012944 | Vadose Zone Soil | MGNARLEEFTWCQVPYNKQLQRTVERYRGRAASASFHYALAARWLAQRAAAELRR* |
| Ga0137410_1000064115 | 3300012944 | Vadose Zone Soil | MACQAHNKQLQRTVIRYRERAASASFHYALAARGNPQCAAAELRR* |
| Ga0137410_100526928 | 3300012944 | Vadose Zone Soil | NKQLQRTVIRRRGRGASAPFHYAHAPRWWAQRAAAELRR* |
| Ga0137410_100544711 | 3300012944 | Vadose Zone Soil | NKQLQRTVPRYRGRAASASFHYALAARFTRQRAAAELRRYAHPNV* |
| Ga0137410_104748821 | 3300012944 | Vadose Zone Soil | PATRSFAVAIESASLAHNKQLQRTVTPQRGRGASASLHCALAPPWLAQRAAAELRR* |
| Ga0153916_100191055 | 3300012964 | Freshwater Wetlands | MSPNKQLQRTVTRRRGDVASAPFHYALAPRFTRHRAAAELRR* |
| Ga0134079_100103081 | 3300014166 | Grasslands Soil | LQRTVTRRRGDGASAPFHYALAPRFTRQRAAAELRR* |
| Ga0075319_10978392 | 3300014257 | Natural And Restored Wetlands | MTHNKQLQRPVGAHRGDAARAPFHYARASRSNWQRAAAELQRSATQWS* |
| Ga0075327_10693461 | 3300014272 | Natural And Restored Wetlands | QTHNKQLQRTVIRHRGDAASAPFHYALAARFTRQRAAAELRRSATG* |
| Ga0075327_11420221 | 3300014272 | Natural And Restored Wetlands | INFAMARPPPNKQLQRTVIRRRGRGACASLHYAHAPRITRQRAAAELRRYVA* |
| Ga0075327_11651843 | 3300014272 | Natural And Restored Wetlands | SPTACSVSSNKQLQRTVTRRRGDGASASFHYALAPRIKRQRAAAELRR* |
| Ga0157380_100529521 | 3300014326 | Switchgrass Rhizosphere | ANKQLQRTVTRRRGDGASAPFHYALAPRFTRQRAAAELRR* |
| Ga0157380_125271181 | 3300014326 | Switchgrass Rhizosphere | MWSFIARESPNKQLQRTVTRRRGDGASAPLHYALAPRWTEQRAAAELRR* |
| Ga0157380_130544411 | 3300014326 | Switchgrass Rhizosphere | APNKQLQRTVTRRRGDAASAPFHYALAARFTRQRAAAELRL* |
| Ga0157380_135476911 | 3300014326 | Switchgrass Rhizosphere | MTPCPSPNKQLQRTVTRRRGAGASAPFHYALAPRVTR |
| Ga0180068_10026491 | 3300014864 | Soil | QQLQRTVIPHRWRAASASFHCAHAARWTLGRAAAELRRYTHTSAAS* |
| Ga0157379_118425131 | 3300014968 | Switchgrass Rhizosphere | PNKQLQRTVERYRGRAASASFHYALAARSRRQRAAAELRR* |
| Ga0137411_10268351 | 3300015052 | Vadose Zone Soil | VSANKQLQRTVRRYRGRAASASFHYALAARSNPQPAAR |
| Ga0173483_100154963 | 3300015077 | Soil | MQSSLAPPNKQLQRTRRRGDGASAPLQYALAPRFTRRHAAAELRRYTPG* |
| Ga0173478_100933932 | 3300015201 | Soil | VPANKQLQRTVIGRRGDGASAPFHYALAPRITRQRAAAELRRYAT* |
| Ga0132258_111134474 | 3300015371 | Arabidopsis Rhizosphere | AVRTPIDSACQPPNKQLQRTVTRRRGDGASAPFHSALAPRITRQRAAAELRR* |
| Ga0132258_135175253 | 3300015371 | Arabidopsis Rhizosphere | MLCAVPAPNKQLQRTAIRRRGDAASAPFHSAPAPRFTRQGAAA |
| Ga0132258_135457352 | 3300015371 | Arabidopsis Rhizosphere | DLVQMPNRALCQPPNKQLQRTVTRRRGDGASAPFHYALAPRFKRQRAAAELRL* |
| Ga0132256_1035539381 | 3300015372 | Arabidopsis Rhizosphere | MTPNKQLQRTVTRRRDDGASAPFHYALAPRFKRQRAAAELRL* |
| Ga0132257_1006412131 | 3300015373 | Arabidopsis Rhizosphere | VAPPPNKQLQRTVERHRGRAASASFHYAHAARWTVGHAAAELRR* |
| Ga0163161_118977022 | 3300017792 | Switchgrass Rhizosphere | ILSNSPQLAPPNKQLQRTVTRRRDDGASAPFHYALAPRFTRQRAAAELRR |
| Ga0184608_101796882 | 3300018028 | Groundwater Sediment | MALVPPNKQLQRTVIRRRGRGASAPFHYALAPRWTAQRAAAELRRYTELPA |
| Ga0184629_100688454 | 3300018084 | Groundwater Sediment | YSALCQPANKQLQRTVTPRRGDVAGDVASAPFHYALAPRFTRQRAAAELRR |
| Ga0190265_100917853 | 3300018422 | Soil | MTPNKQLQRTVTRHRGDGASAPFHYALASRITRQRAAAELRR |
| Ga0190265_101173831 | 3300018422 | Soil | NKLLQRTVIGRRERGASASLHCALAPRWLVQRAAAELRR |
| Ga0190265_108181991 | 3300018422 | Soil | VTPNKQLQQSVERRRGRGACAPFHYGHAPRWTRGHAAAE |
| Ga0190265_118386381 | 3300018422 | Soil | QLERTVTRRRVRAASAPFRYALAARWAARRAAAELPR |
| Ga0190265_122352771 | 3300018422 | Soil | SVSSNKQLQRTVTRRRGDGASAPFHYALAPRFIRQRAAAELRRYTALPA |
| Ga0190270_118095683 | 3300018469 | Soil | LGGLTYNKQLQRTVTRRRGRAASTLFHYALAPRFTLQRAAAELRRYAQH |
| Ga0190270_121218091 | 3300018469 | Soil | HNKQLQRTVIPNRWRAASAPFHYAHAARWTRGRAAAELRR |
| Ga0190274_120443021 | 3300018476 | Soil | IRMSMALAHNKQLRRTTIRHRGDVASAPFRYALASRFTRQRVAAELRR |
| Ga0173481_1000166410 | 3300019356 | Soil | VPANKQLQRTVIGRRGDGASAPFHYALAPRITRQRAAAELRR |
| Ga0173481_100016642 | 3300019356 | Soil | MQSSLAPPNKQLQRTRRRGDGASAPFQYALAPRFTRRHAAAELRRYTPG |
| Ga0173481_100067592 | 3300019356 | Soil | MSPNKQLQLTVIRRRGDDASAPFQYALAPRIKRRRAAAELRL |
| Ga0173481_100668663 | 3300019356 | Soil | MRIASPNKQLERTVIRRDVRAACAPFHCAHAARWTRGHAAAQLRR |
| Ga0173481_101561903 | 3300019356 | Soil | HNKQLQRTVTRRRGDGASAPFHYALAPRITRQRAAAELRR |
| Ga0173481_106161231 | 3300019356 | Soil | MANDTALSPNKQLERTVIRRRVRAASAPFHYALAARWTAQRAAAQL |
| Ga0173481_107169043 | 3300019356 | Soil | IDVARLAPNKQLQRTVTRRRGDGASAPFHYALAPRITPQRAAAELRR |
| Ga0173482_107165461 | 3300019361 | Soil | MTLCQPPNKQLQRTVTRRRGDSTSAPFHYALVLRFIRQRAAAELR |
| Ga0187893_100677324 | 3300019487 | Microbial Mat On Rocks | MLTRVSRAPNKQLERTVIRRHVRAASAPFHYAHAARWTAQRAAAQLRR |
| Ga0187893_101542174 | 3300019487 | Microbial Mat On Rocks | MNCYVPPYNKQLERTVMRRRVRAASAPFHYALAARWTTQRAAA |
| Ga0187893_101944094 | 3300019487 | Microbial Mat On Rocks | MSPFSFEARCQAHNKQLERTVIRRRVRATSAPFHYALAARWTARRAAAQLRR |
| Ga0187893_102119661 | 3300019487 | Microbial Mat On Rocks | NKQLERTVIRRCVRAASASFHCAHAARWTAQRAAAQLQRYAA |
| Ga0187893_104435241 | 3300019487 | Microbial Mat On Rocks | RMNCYVPPYNKQLERTVMRRRVRAASAPFHYALAARWTAQRAAAQLRR |
| Ga0187893_105520851 | 3300019487 | Microbial Mat On Rocks | VPPHNKQLERTVIRRCVRAASASFHCAHAARWTAQRAAAQLQR |
| Ga0187893_106587461 | 3300019487 | Microbial Mat On Rocks | NKQLERTVIRRCVRAASASFHCAHAARWTAQRAAAQLQRYVA |
| Ga0193712_10363441 | 3300019880 | Soil | MPHNKQLQRTVKTRRERGASASFHYALAPRWWAQRAAAELRR |
| Ga0193739_11482191 | 3300020003 | Soil | NKQLQRTVIRRHMRAASASFHYALAARWLGQRAAAELRRYTARHA |
| Ga0193738_10116706 | 3300020020 | Soil | MSANKQLQRTVTRRRGDAASAPFHYALASRFTRQRAAAELRR |
| Ga0193738_10606742 | 3300020020 | Soil | MAPYNKQLQRTVIRRHMRAASASFHYALAARWLGQRAAAELRRYTARHA |
| Ga0193738_11210011 | 3300020020 | Soil | MLPRPRAVPANKQLERTVIRRRVRAASAPLHYALAARWTAQRAAAQLQR |
| Ga0193738_11210013 | 3300020020 | Soil | VPANKQLERTVIRRRVRAASAPLHYALAARWTAQRAAAQLQR |
| Ga0193726_100055120 | 3300020021 | Soil | MEPHNKQLQRTVIRQRGRGANTSFHYALAERSIGRRAAAELRRYAHRW |
| Ga0224505_100073123 | 3300022214 | Sediment | MAPNKQLQRTVIRRRGDGASAPFHYALAPRFTRQRAAAELRRWAS |
| Ga0224510_103315042 | 3300022309 | Sediment | VIRRRGDGASAPFHYALAPRFTRQRAAAELRRWAS |
| Ga0247792_10601651 | 3300022880 | Soil | VPANKQLQRTVIGRRGDGASAPFHYALAPRITRQRAAAELRRYAAL |
| Ga0247746_11086342 | 3300022886 | Soil | LIMQSSLAPPNKQLQRTRRRGDGASAPFQYALAPRFTRRHA |
| Ga0247788_10227933 | 3300022901 | Soil | MQSSLAPPNKQLQRTRRRGDGASAPFQYALAPRFTRRHAAAEL |
| Ga0247790_100696912 | 3300022915 | Soil | VARLAPNKQLQRTVTRRRGDGASAPFHYALAPRITPQRAAAEL |
| Ga0247793_10532151 | 3300023066 | Soil | VLDLMLCQPPNKQLQRTVTLRRGDGTSAPFHYALAPRVTRQRAAAELRRYAAT |
| Ga0247796_10364461 | 3300023261 | Soil | ASKSFIDVARLAPNKQLQRTVTRRRGDGASAPFHYALAPRITPQRAAAELRR |
| Ga0247789_10132744 | 3300023266 | Soil | VPANKQLQRTVIGRRGDGASAPFHYALAPRITRQRAAAELRL |
| Ga0209172_100358186 | 3300025310 | Hot Spring Sediment | MIEKQPAAVPTPNKQLQRTVTRHRGDGASAPFHYALAPRFTRQRAAAELRR |
| Ga0207707_109387391 | 3300025912 | Corn Rhizosphere | SGTMVAPNKQLQRTVIPNRWRGASAPFHYALAPRFTRCRAAAELRRYAAR |
| Ga0207660_103316763 | 3300025917 | Corn Rhizosphere | APNKQLQRTVRPYRERAASASFHYALAARSKPQRAAAELRRYAPSERL |
| Ga0207660_103393833 | 3300025917 | Corn Rhizosphere | SQPPNKQLQRTVTRRRGDGASAPFHYALAPRFTRQRAAAELRR |
| Ga0207660_110534231 | 3300025917 | Corn Rhizosphere | SVSSFLSTVCQPPNKQLQRTVTRRRGDGASAPFHYALAPRIRRQRAAAELRR |
| Ga0207660_110622591 | 3300025917 | Corn Rhizosphere | MSASEVPANKQLQRTVTRRRGDGASAPFHSALAPRITRQRAAAELRR |
| Ga0207660_116765102 | 3300025917 | Corn Rhizosphere | MRFLYALCQPPNKQLQRTVTRRRGDGASAPFHSALAPRFTRYRAAAELR |
| Ga0207662_110451361 | 3300025918 | Switchgrass Rhizosphere | MSANKQLQRTVERYRGRAASASLHCALAARSKPQRAAAELRR |
| Ga0207650_108860823 | 3300025925 | Switchgrass Rhizosphere | MQSSLAPPNKQLQRTRRRGDGASAPFQYALAPRFTRRHAAAELRRYTP |
| Ga0207659_101498494 | 3300025926 | Miscanthus Rhizosphere | MWSFIARESPNKQLQRTVTRPRGDGASAPLHYALAPRVTRHRAAAELRR |
| Ga0207659_119175651 | 3300025926 | Miscanthus Rhizosphere | NKQLQRTVTGRRGDGASAPFHYALAPRITRHRAAAELRR |
| Ga0207670_105087881 | 3300025936 | Switchgrass Rhizosphere | MRIASPNKQLQRTVTRRRGRAASAPFHYALAPRITRQRAAAELHV |
| Ga0207670_117472301 | 3300025936 | Switchgrass Rhizosphere | LQRTVTRRRGDGASAPFHYALAPRFTRQCAAAELRR |
| Ga0207704_107258871 | 3300025938 | Miscanthus Rhizosphere | CSVSSNKQLQRTVTQRRGDGASAPFHYALAPRFTRRRAAAELRR |
| Ga0207704_107258873 | 3300025938 | Miscanthus Rhizosphere | VIAPNKQLQRTVTRRRGDGASAPFHYALAPRFTPKCAAAELR |
| Ga0207704_110816931 | 3300025938 | Miscanthus Rhizosphere | LQRTVTRRRGDGASAPFHYAHAARWTLGRAAAELRR |
| Ga0207689_102585425 | 3300025942 | Miscanthus Rhizosphere | QPPNKQLQRTVTRRRGDGASAPFHYALAPRFTRQRAAAELRR |
| Ga0207661_115790332 | 3300025944 | Corn Rhizosphere | CSEGVAVTPNKQLQRTVTKYRGRAASASFHYALAARANPQRAAAELRR |
| Ga0208659_10230811 | 3300026054 | Natural And Restored Wetlands | MRMPYNKQLQRTAVRHHAVVASAPFHYALASRITRQRAAAELRR |
| Ga0207708_101864561 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MTACNQGARALCQPPNKQLQRTVIRRRGRAASASLLCALAARSMRQRAAAELR |
| Ga0207708_113339451 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | QLQRTVTRRRGDGASAPFHYALAPRITRYRAAAELRR |
| Ga0207648_104193912 | 3300026089 | Miscanthus Rhizosphere | AYWKGDEHNKQLQRIVIRRRGRGASASFHCAHAPRWTRGRAAAELRR |
| Ga0207648_110685831 | 3300026089 | Miscanthus Rhizosphere | MAPYNKQLQRTVIRRRVRAASAPLHYALAARITRQRAAAELRRYAARP |
| Ga0207674_104566743 | 3300026116 | Corn Rhizosphere | MNRTPHNKQLQRTVTRRRGDTASAPFHYALAVRFTRHRAAAELRR |
| Ga0207675_1015440671 | 3300026118 | Switchgrass Rhizosphere | MLSPNKQLQRTVTRRRGDGASAPFHSALAPRFTRQRAAAE |
| Ga0207675_1017133991 | 3300026118 | Switchgrass Rhizosphere | QAVNVSVTPNKQLQRTVTRRRGDGASAPFHYALAPRFTRHRAAAELRR |
| Ga0207675_1020435891 | 3300026118 | Switchgrass Rhizosphere | NKQLQRTVIRRRGDGASAPFHSALAPRFQRQRAAAELRR |
| Ga0207683_105896363 | 3300026121 | Miscanthus Rhizosphere | PNKQLQPTVTRHRGSDASAPFRYALASCVTRQRAAAELRR |
| Ga0209995_10832492 | 3300027471 | Arabidopsis Thaliana Rhizosphere | VPANKQLQRTVIGRRGDGASAPFHYALAPRITRQRAAAELRRYAT |
| Ga0210002_10327331 | 3300027617 | Arabidopsis Thaliana Rhizosphere | TGMKARTSKCIAGSHNKQLQRTVIRRRGRAARASRWTAGHAAAELRR |
| Ga0209075_12376222 | 3300027711 | Agricultural Soil | MRSALRQPPNKQLQRTVIPNHGRAASAPPHDALAARGIRGRAAAELRRY |
| Ga0209706_103207962 | 3300027818 | Freshwater Sediment | ANKQLQRTVIPNRWRGASASFHYALAPRWTTQRAAAELRR |
| Ga0209486_101511253 | 3300027886 | Agricultural Soil | AYNKQLQRTVTRRRGDGASAPFHYALAPRFTRQRAAAELRR |
| Ga0209486_101676804 | 3300027886 | Agricultural Soil | AVPASNKQLQRTVTRRRGDGASAPFHYALAPRFTRQRAAAELRRYAAL |
| Ga0209486_104253321 | 3300027886 | Agricultural Soil | MLSAEPHNKQLQRTVIRRRRRAASASFHCAHAARFIRQRAAAE |
| Ga0209254_108911022 | 3300027897 | Freshwater Lake Sediment | MTSNKQLQRTVIPQRVRAASAPLHYALAARITRQRAAAELRR |
| Ga0207428_104587513 | 3300027907 | Populus Rhizosphere | VCQPPNKQFQRTVIRRRGRAARAPFHYERASRWTRGHAAAE |
| Ga0209382_104958971 | 3300027909 | Populus Rhizosphere | VWFVITMRSPAYNKQLQRTVIRRRGDAASAPFHYALAARFTRQRAAAELRL |
| Ga0209382_117316811 | 3300027909 | Populus Rhizosphere | VPANKQLQRTVIRRRGRAASASFHYALAARWTAQRAAA |
| Ga0256864_11250051 | 3300027964 | Soil | MPANKQLQRTVIRHRGDTASAPFHYALAVHFTRQRAAAELWRYA |
| Ga0209705_100394276 | 3300027979 | Freshwater Sediment | VTSNKQLQRTVIRRHMRAASAPFHYALTARSIGQRAAAELRR |
| Ga0268265_106131701 | 3300028380 | Switchgrass Rhizosphere | SDGVIAPNKQLQRTVTRRRGDGASAPFHYALAPRFTPKCAAAELRR |
| Ga0268265_115803962 | 3300028380 | Switchgrass Rhizosphere | LQRTVIGRRGDGASAPFHYALAPRIARQRAAAELRR |
| Ga0268265_121039592 | 3300028380 | Switchgrass Rhizosphere | LQRTVTRRRGDGASAPFHYALAPRITPQYAAAELRR |
| Ga0268265_122555552 | 3300028380 | Switchgrass Rhizosphere | SNKQLQRTVTQRRGDGASAPFHYALAPRFTRRRAAAELRR |
| Ga0268299_10114635 | 3300028648 | Activated Sludge | MTRQMPNKQLQLTVERHHVRGASASFHYALAPRWFAPRAAAELRRYAP |
| Ga0311360_107306001 | 3300030339 | Bog | LNVTQSPNKQLQRSVKRRRSAAARAPFHYARTSRITRQRAAAELQS |
| Ga0302046_100579738 | 3300030620 | Soil | VRYSVSQESANKQLQRTVVRRRGRGASASFHCALAPRCRAQRAAAELRRY |
| Ga0302046_101384003 | 3300030620 | Soil | KQLQRVVIPNRWRAASAPLHYARAARWTAQHAAAELRR |
| Ga0302046_105416351 | 3300030620 | Soil | MTPNKQLQRTVRRQRGDGASAPFHYALAPRITRQRAAAELRRSASQ |
| Ga0307499_101980102 | 3300031184 | Soil | MRISSSRAPPNKELQRTVERYRGRAASASFHYALAARSNLQRAAAELRR |
| Ga0307499_102120053 | 3300031184 | Soil | PNEPLQRTVERYRGCAANASFHGALAARSKPQRAAAEPDR |
| Ga0307499_102326011 | 3300031184 | Soil | PVVEPHNNQLQRTAIRYRGRVASASFHCAHVPRWLAQRAAAELRR |
| Ga0307500_100337431 | 3300031198 | Soil | MSARSGTYKQLQRTVERYRERAASASFHYALAARGKPQRAAAELRR |
| Ga0307500_100840321 | 3300031198 | Soil | MGLEMLCSCQPPNKQLQRTVIGRHGDGASAPFHYALAPRVTRQRAAAELR |
| Ga0307497_101291221 | 3300031226 | Soil | VAAYNKQLQRTVEPRRERAASASFHYALAARGKPQRAAAELRR |
| Ga0307497_107223072 | 3300031226 | Soil | MTPNKQLQRTVRRYRGRAASASFHYALAARGNPQRAAAEL |
| Ga0299914_101484542 | 3300031228 | Soil | VPLNKQLQRTVIRRRGDGASAPFHYALAPRVTRQRAAAELRRYAT |
| Ga0307505_103166192 | 3300031455 | Soil | KQLQRTVLRHRGDTASAPFHYALAVRFTRQRAAAELRR |
| Ga0310888_101875202 | 3300031538 | Soil | MKVVLLGVGAPPNKQLERTVMRRRVRAASAPFHYALAARWTAQRAAAQLRR |
| Ga0310886_101687501 | 3300031562 | Soil | ESAVCQPPNKQLQRTVTRRRGDGASAPFHYALAPRFTLQRAAAELRR |
| Ga0302321_1034365472 | 3300031726 | Fen | MKRALLPNEQLQQTVKRHRGDAASAPFHYALASRITRQRAAAELQR |
| Ga0307405_121192101 | 3300031731 | Rhizosphere | AHNKQLQRTVTRRRGDGASAPFHYALAPRVTRQRAAAELRR |
| Ga0307468_1021072191 | 3300031740 | Hardwood Forest Soil | VLLAMTQAPPNKQLQRTVIRRRGRGACAAFHFARAPRWLTHRAAAELRR |
| Ga0307468_1021713151 | 3300031740 | Hardwood Forest Soil | MKSRMPPNKQLQRTVITQRGRTASASFHYALAARSKRQRAAAELRRYVALPAVIVVPA |
| Ga0307410_114623982 | 3300031852 | Rhizosphere | LTLVPAHNKQLQRTVTRRRGDGASAPFHYALAPRITRQRAAAELRRYARI |
| Ga0307410_119856902 | 3300031852 | Rhizosphere | MSNRAVPHNKQLQRTVTGRRGRAARASFHYARASRFT |
| Ga0310892_105799651 | 3300031858 | Soil | VRSNKQLQRTVTRRRGDGASAPFHYALAPRWTAQRAAAELRR |
| Ga0310892_107344523 | 3300031858 | Soil | MWSFIARESPNKQLQRTVIQRRGRAARAPFHYARASHRTAQRAAA |
| Ga0310892_109438062 | 3300031858 | Soil | IESTCQPPNKQLQRTVTRRRGDGASAPFHYALAPRFQRQRAAAELRR |
| Ga0310900_100124856 | 3300031908 | Soil | MSSRVVPHNKQLQRTVIRRRGRGASASFHYALAPRFILQRAAAELRR |
| Ga0310900_101256463 | 3300031908 | Soil | DRNNGEEPLCQAPNKQLQRTVILNRWRGASASFHYALAPRFTRHRAAAELRL |
| Ga0310900_102966401 | 3300031908 | Soil | MSPQAANKQLQRTVTRRRGDGASASFHCALVPRWTRQRAAAELRRYTP |
| Ga0310900_108844711 | 3300031908 | Soil | RTREMLTHESPNKQLERTAIRRRVRAASAPFHYAHAARWTAQRAAAQLRR |
| Ga0310900_116556632 | 3300031908 | Soil | MLTHESPNKQLERTAIRRRVRAASAPFHYAHAARWTARRAAAQL |
| Ga0310901_103772172 | 3300031940 | Soil | IARESPNKQLQRTVTRRRGDGASAPLHYALAPRFTRQRAAAELRR |
| Ga0310885_101782221 | 3300031943 | Soil | MSSRVVPHNKQLQRTVIRRRGRGASASFHYALAPRFTLQRAAA |
| Ga0310884_110356262 | 3300031944 | Soil | MAPNKQLQRTVTRRRGDGASAPFHYALAPRFIRQRAAAELRRYTLV |
| Ga0310903_102608221 | 3300032000 | Soil | MSPNKQLQRTVTRRRGDGASAPFHYALAPRFTRQRAAAELRL |
| Ga0307416_1021384691 | 3300032002 | Rhizosphere | QLQRTVIRRRGRAASASFHCALAARSEGQRAAAELRR |
| Ga0307416_1035480652 | 3300032002 | Rhizosphere | MTPNKQLQRTVTWRRGDSASAPFHYALAPRVIRQRAAAELRR |
| Ga0310902_102681103 | 3300032012 | Soil | MPHNKQLQRTVTRRRGDGASAPFHSALAPRFTRYRAAAELRRYAA |
| Ga0310902_107895171 | 3300032012 | Soil | MAYNKQLQRTVIPRRGDGASAPFHYALAPRFRRQRAAAELRRYAASTSESPR |
| Ga0310906_103959953 | 3300032013 | Soil | VLSDDGPSVMRVPAPNKQLQRTVTRHRGDGASAPFHYALAVRFTRQRAAAELRR |
| Ga0310906_110629642 | 3300032013 | Soil | MSGRGTAHNKQLQRTVTRRRGDGASAPFHYALAPRITRQRAAAELR |
| Ga0310899_100981271 | 3300032017 | Soil | MRQAPHNKQLQRTVIPNRGRAARAPFHYVRASRFTRQRAAAELRR |
| Ga0310890_100860671 | 3300032075 | Soil | TAPNKQLQRTVKQRRGRAASASFHYPHAARWTLGRAAAELRL |
| Ga0310890_101132341 | 3300032075 | Soil | GGRGMKSRIPLTPNKQLQRTVMRHRGDTASAPFHYALAVRFTRQRAAAELRR |
| Ga0310890_109004403 | 3300032075 | Soil | PHNKQLQRTVTRRRGDGASAPLHYALAPRFKRQRAAAELRC |
| Ga0310890_109868711 | 3300032075 | Soil | HNKQLQRTVIRRRGDGASAPFHYAFAPRWTAQRAAAELRR |
| Ga0310890_111370972 | 3300032075 | Soil | MQVATSKSRRSHNKQLQRTVIRRHVRAACAPFHYALAARVTRQRAAAELRR |
| Ga0310890_112757831 | 3300032075 | Soil | VAPNKQLQRTVIRHRGRAASASFHYALAARSNRQRAAAELR |
| Ga0310890_114403292 | 3300032075 | Soil | MSSRVVPHNKQLQRTVIRRRGRGASASFHYALAPRFTLQ |
| Ga0307415_1014584342 | 3300032126 | Rhizosphere | QLQRTVIRRRGDGASAPFHYALAPRFTRQRAAAELRR |
| Ga0315910_100128971 | 3300032144 | Soil | MLPTNNKQLPRTETRRRGDDASAQLHYALAPLFTRQRAAA |
| Ga0315910_100164837 | 3300032144 | Soil | MSAVSRSGPKQLQRNVIRRRGRAARAPFHYARASRFTRQRAAAELRR |
| Ga0315910_100216739 | 3300032144 | Soil | MRLAWPPVAANKQLERTVKRGRRRAASAPFHYARAARLMRERAAAQLRR |
| Ga0315910_100232302 | 3300032144 | Soil | MMLFTSCQPPPNKQLQRTVTRRRGDGASAPLHYALAPRWTAGHAAAELRR |
| Ga0315910_100433976 | 3300032144 | Soil | MCVVPAPNKQLQRTVTRRRGRAASAPFHYALAARWTRGRAAAELRR |
| Ga0315910_100888001 | 3300032144 | Soil | VPHNKQLERTVMRRHVRAASAPLHYALAARWTAQRAAAQLRR |
| Ga0315910_100932634 | 3300032144 | Soil | MSFLYALCQPPNKQLQRTVTRRRGDGASAPFHFALAPRVTRQRAAAELRR |
| Ga0315910_102906532 | 3300032144 | Soil | MSFLFTLCQPPNKQLQRTVIRCRGDGASAPFHYALAPRWTRGHAAAELRR |
| Ga0315910_102944324 | 3300032144 | Soil | LGGLTYNKQLQRTVTRRRGDGTSAPFHYALAPRITRQRAAAELRR |
| Ga0315910_103178091 | 3300032144 | Soil | PLVSLQAWRRRLSSNMQLQRTVTRRRGDGASAPFHYALAPRWTAQRAAAELRR |
| Ga0315910_103488163 | 3300032144 | Soil | MCQPHNKQLERTVIRRRVRAASAPFHYALAARWTAQRAAAQLRRYAATAWDRSDVDSP |
| Ga0315910_104709041 | 3300032144 | Soil | LTYHKQLQRTVTRRRGDGASAPFHYAHAARWTAQRAAAQLRR |
| Ga0315910_105571871 | 3300032144 | Soil | MPPNKQLERTVIRRRMRAASAPFHYALAARWTARRAAAQLRRYVHL |
| Ga0315910_106166333 | 3300032144 | Soil | MQLQRTVTRRRGDTASAPLHYALAVRLKRRRAAAELRR |
| Ga0315910_107050734 | 3300032144 | Soil | KQLQRTVIRRRGDGASATFHYALAPRFTRQRAAAELRR |
| Ga0315910_109916492 | 3300032144 | Soil | MSPNKQLERTVIRRHVRAASAPLHYALAARFTRQRAAAQLRRYARLRST |
| Ga0315912_100585855 | 3300032157 | Soil | MSCQPPNKQLERTVIRRRVRAASAPFHYALAARWTAQRAAAQL |
| Ga0315912_100737785 | 3300032157 | Soil | MRMTPNKQLERTVTRRRVRAASAPFHYALAARWTARCAAAQLRR |
| Ga0315912_100861761 | 3300032157 | Soil | KQLQRTVTRRRGDGASAPFHYALAPRITRQRAAAELRR |
| Ga0315912_101153642 | 3300032157 | Soil | MSSYVPPYNKQLERTVIRRRVRAASAPFHYVLAAPMTCCRAAAEPQRYAAL |
| Ga0315912_103343321 | 3300032157 | Soil | VVAHNKQLQRTVTRRRGDGASAPFHYALAPRFTRQRAAAELRR |
| Ga0315912_103388783 | 3300032157 | Soil | MRLAWPPVAANKQLERTVKRGRRRAASAPFHYARAARLMRERAAAQ |
| Ga0315912_105549523 | 3300032157 | Soil | VPAYNKQLQRTVTRRRGDGASAPFHFALAPRFTWQRAAAELQRYAA |
| Ga0315912_107087471 | 3300032157 | Soil | VWCQPHNKRLERTVIRRRERAACASFHCAHAARWTRGHAAAQLRRYAP |
| Ga0315912_107350092 | 3300032157 | Soil | QSPNKQLQRTVTRRRGDGASAPFHYALAPRVIRQRAAAELRR |
| Ga0315912_108730051 | 3300032157 | Soil | VRLPDNKQLQRTVIRRRGDGASAPFHYALAPRWTLGRAAAEL |
| Ga0315912_108813403 | 3300032157 | Soil | TLVVPHNKQFEPTVIRRHVRAACAPFHFAHAARWTLGRAAAQLRR |
| Ga0315912_109415482 | 3300032157 | Soil | RAAHNTQLQRTVTRCRGDGASAPFHYALAPRFQRRRAAAELRRYATQE |
| Ga0315912_116131531 | 3300032157 | Soil | MRRLKRALCQPPNKQLQRTVTRRRGRAARAPFHYARAPRITRQRAAAE |
| Ga0315912_116516042 | 3300032157 | Soil | MIAIPLSTLGVARRAYNKQLQRTVIRRRGDGASATFHYALAPRFTRQRAAAELRR |
| Ga0307471_1026542131 | 3300032180 | Hardwood Forest Soil | MIALSSNKQLQRTVTRYRERAASASFHYALAARSNPQRAAAELRR |
| Ga0310896_104960511 | 3300032211 | Soil | NKQLQRTVIRRRGRGARASFHHARAPRFIRQRAAAELRR |
| Ga0335080_109511182 | 3300032828 | Soil | KQLQRTVIRRRGDTASAPFHYALAVRVKRQRAPAELRR |
| Ga0335084_1004101010 | 3300033004 | Soil | PLREPPNKQLQRTVTPHRGDAASTPFHYALAARFIRQRAAAELRR |
| Ga0335084_105802691 | 3300033004 | Soil | LAVAAQPHNKQLQRTVERHHGDAARASFHYARASRIERQRAAAELRRYAA |
| Ga0214472_100385647 | 3300033407 | Soil | MLHRLRDAAAHDKQLQRTVIRRRGRGASAQCNDALAPRWTAQRAAAELRR |
| Ga0310810_101418112 | 3300033412 | Soil | MTLAMSCQPPNKQLQRTVERCRGRAASASFHYALAARYNRQRADAELRR |
| Ga0214471_103626322 | 3300033417 | Soil | MPANKQLQRTVIRHRGDTASAPFHYALAVHFTRQRAAAELWRYAR |
| Ga0326726_100028999 | 3300033433 | Peat Soil | MAPDKQLQRTVQRYRGDIASAPLHYALAPRITRQRAAAELRR |
| Ga0247829_106618851 | 3300033550 | Soil | MVPYNKQLQRTVTRRRGDGASAPFHYALAPRITRQRAAAELRL |
| ⦗Top⦘ |