


| Basic Information | |
|---|---|
| Family ID | F004120 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 452 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MRDLVADWKKWSRAERVLAVMGTLLMVALPLGLLMTG |
| Number of Associated Samples | 293 |
| Number of Associated Scaffolds | 452 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 67.92 % |
| % of genes near scaffold ends (potentially truncated) | 27.21 % |
| % of genes from short scaffolds (< 2000 bps) | 87.83 % |
| Associated GOLD sequencing projects | 259 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.55 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (64.159 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (17.478 % of family members) |
| Environment Ontology (ENVO) | Unclassified (20.796 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (48.673 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.77% β-sheet: 0.00% Coil/Unstructured: 49.23% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.55 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 452 Family Scaffolds |
|---|---|---|
| PF08734 | GYD | 19.69 |
| PF00266 | Aminotran_5 | 7.08 |
| PF00903 | Glyoxalase | 3.54 |
| PF13714 | PEP_mutase | 2.65 |
| PF07681 | DoxX | 2.21 |
| PF02371 | Transposase_20 | 1.11 |
| PF00486 | Trans_reg_C | 0.88 |
| PF00296 | Bac_luciferase | 0.88 |
| PF12833 | HTH_18 | 0.88 |
| PF08281 | Sigma70_r4_2 | 0.66 |
| PF03737 | RraA-like | 0.66 |
| PF02518 | HATPase_c | 0.66 |
| PF00872 | Transposase_mut | 0.44 |
| PF07969 | Amidohydro_3 | 0.44 |
| PF10067 | DUF2306 | 0.44 |
| PF13551 | HTH_29 | 0.44 |
| PF01266 | DAO | 0.44 |
| PF00083 | Sugar_tr | 0.44 |
| PF13577 | SnoaL_4 | 0.44 |
| PF02515 | CoA_transf_3 | 0.44 |
| PF00072 | Response_reg | 0.44 |
| PF13191 | AAA_16 | 0.44 |
| PF00571 | CBS | 0.44 |
| PF06210 | DUF1003 | 0.22 |
| PF04392 | ABC_sub_bind | 0.22 |
| PF07869 | DUF1656 | 0.22 |
| PF13410 | GST_C_2 | 0.22 |
| PF01979 | Amidohydro_1 | 0.22 |
| PF04075 | F420H2_quin_red | 0.22 |
| PF13610 | DDE_Tnp_IS240 | 0.22 |
| PF07228 | SpoIIE | 0.22 |
| PF02525 | Flavodoxin_2 | 0.22 |
| PF03167 | UDG | 0.22 |
| PF13472 | Lipase_GDSL_2 | 0.22 |
| PF00383 | dCMP_cyt_deam_1 | 0.22 |
| PF00578 | AhpC-TSA | 0.22 |
| PF01522 | Polysacc_deac_1 | 0.22 |
| PF02705 | K_trans | 0.22 |
| PF00042 | Globin | 0.22 |
| PF03534 | SpvB | 0.22 |
| PF00535 | Glycos_transf_2 | 0.22 |
| PF13604 | AAA_30 | 0.22 |
| PF13360 | PQQ_2 | 0.22 |
| PF08327 | AHSA1 | 0.22 |
| PF00378 | ECH_1 | 0.22 |
| PF02195 | ParBc | 0.22 |
| PF00211 | Guanylate_cyc | 0.22 |
| PF12746 | GNAT_acetyltran | 0.22 |
| PF00005 | ABC_tran | 0.22 |
| PF00067 | p450 | 0.22 |
| PF07286 | D-Glu_cyclase | 0.22 |
| PF00248 | Aldo_ket_red | 0.22 |
| PF03372 | Exo_endo_phos | 0.22 |
| PF01578 | Cytochrom_C_asm | 0.22 |
| PF13185 | GAF_2 | 0.22 |
| PF01695 | IstB_IS21 | 0.22 |
| PF00313 | CSD | 0.22 |
| PF00574 | CLP_protease | 0.22 |
| PF01799 | Fer2_2 | 0.22 |
| PF12681 | Glyoxalase_2 | 0.22 |
| PF04679 | DNA_ligase_A_C | 0.22 |
| PF13358 | DDE_3 | 0.22 |
| PF12697 | Abhydrolase_6 | 0.22 |
| PF07690 | MFS_1 | 0.22 |
| PF00171 | Aldedh | 0.22 |
| PF10604 | Polyketide_cyc2 | 0.22 |
| PF01370 | Epimerase | 0.22 |
| PF13365 | Trypsin_2 | 0.22 |
| PF07732 | Cu-oxidase_3 | 0.22 |
| PF00561 | Abhydrolase_1 | 0.22 |
| COG ID | Name | Functional Category | % Frequency in 452 Family Scaffolds |
|---|---|---|---|
| COG4274 | Uncharacterized conserved protein, contains GYD domain | Function unknown [S] | 19.69 |
| COG2259 | Uncharacterized membrane protein YphA, DoxX/SURF4 family | Function unknown [S] | 2.21 |
| COG4270 | Uncharacterized membrane protein | Function unknown [S] | 2.21 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 1.11 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.88 |
| COG0684 | RNA degradosome component RraA (regulator of RNase E activity) | Translation, ribosomal structure and biogenesis [J] | 0.66 |
| COG0616 | Periplasmic serine protease, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 0.44 |
| COG0740 | ATP-dependent protease ClpP, protease subunit | Posttranslational modification, protein turnover, chaperones [O] | 0.44 |
| COG1804 | Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases | Lipid transport and metabolism [I] | 0.44 |
| COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 0.44 |
| COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 0.22 |
| COG0692 | Uracil-DNA glycosylase | Replication, recombination and repair [L] | 0.22 |
| COG0726 | Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 family | Cell wall/membrane/envelope biogenesis [M] | 0.22 |
| COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 0.22 |
| COG1017 | Hemoglobin-like flavoprotein | Energy production and conversion [C] | 0.22 |
| COG1030 | Membrane-bound serine protease NfeD, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 0.22 |
| COG1484 | DNA replication protein DnaC | Replication, recombination and repair [L] | 0.22 |
| COG1573 | Uracil-DNA glycosylase | Replication, recombination and repair [L] | 0.22 |
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 0.22 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.22 |
| COG2124 | Cytochrome P450 | Defense mechanisms [V] | 0.22 |
| COG2132 | Multicopper oxidase with three cupredoxin domains (includes cell division protein FtsP and spore coat protein CotA) | Cell cycle control, cell division, chromosome partitioning [D] | 0.22 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.22 |
| COG3158 | K+ uptake protein Kup | Inorganic ion transport and metabolism [P] | 0.22 |
| COG3663 | G:T/U-mismatch repair DNA glycosylase | Replication, recombination and repair [L] | 0.22 |
| COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 0.22 |
| COG4336 | Uncharacterized conserved protein YcsI, UPF0317/DUF1446 family | Function unknown [S] | 0.22 |
| COG4420 | Uncharacterized membrane protein | Function unknown [S] | 0.22 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 64.16 % |
| Unclassified | root | N/A | 35.84 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2189573000|GPBTN7E01ATV5N | Not Available | 509 | Open in IMG/M |
| 3300000574|JGI1357J11328_10014568 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4186 | Open in IMG/M |
| 3300000574|JGI1357J11328_10120732 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocella → Methylocella tundrae | 782 | Open in IMG/M |
| 3300001334|A2165W6_1076282 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Deinococcus-Thermus → Deinococci → Thermales → Thermaceae → Meiothermus | 1577 | Open in IMG/M |
| 3300001661|JGI12053J15887_10045079 | All Organisms → cellular organisms → Bacteria | 2471 | Open in IMG/M |
| 3300001661|JGI12053J15887_10314497 | Not Available | 763 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100954159 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 741 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101420582 | Not Available | 587 | Open in IMG/M |
| 3300002568|C688J35102_120923178 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2385 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10156049 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 923 | Open in IMG/M |
| 3300004081|Ga0063454_100363881 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 946 | Open in IMG/M |
| 3300004114|Ga0062593_100673319 | All Organisms → cellular organisms → Bacteria | 1003 | Open in IMG/M |
| 3300004114|Ga0062593_102284661 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 608 | Open in IMG/M |
| 3300004152|Ga0062386_101436750 | Not Available | 574 | Open in IMG/M |
| 3300004157|Ga0062590_100626416 | Not Available | 951 | Open in IMG/M |
| 3300004268|Ga0066398_10205495 | Not Available | 522 | Open in IMG/M |
| 3300004463|Ga0063356_101860001 | All Organisms → cellular organisms → Bacteria | 906 | Open in IMG/M |
| 3300004463|Ga0063356_102026678 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 871 | Open in IMG/M |
| 3300004479|Ga0062595_102427248 | Not Available | 521 | Open in IMG/M |
| 3300004633|Ga0066395_10135158 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1233 | Open in IMG/M |
| 3300004643|Ga0062591_101760513 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 630 | Open in IMG/M |
| 3300005167|Ga0066672_10085606 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1895 | Open in IMG/M |
| 3300005167|Ga0066672_10234189 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1178 | Open in IMG/M |
| 3300005167|Ga0066672_10394373 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 905 | Open in IMG/M |
| 3300005167|Ga0066672_10688858 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
| 3300005171|Ga0066677_10545385 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 664 | Open in IMG/M |
| 3300005172|Ga0066683_10623776 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
| 3300005177|Ga0066690_10260876 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1164 | Open in IMG/M |
| 3300005332|Ga0066388_100643383 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1676 | Open in IMG/M |
| 3300005332|Ga0066388_100812113 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1526 | Open in IMG/M |
| 3300005332|Ga0066388_104877679 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 682 | Open in IMG/M |
| 3300005335|Ga0070666_10500438 | All Organisms → cellular organisms → Bacteria | 881 | Open in IMG/M |
| 3300005336|Ga0070680_101366693 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300005337|Ga0070682_100162243 | All Organisms → cellular organisms → Bacteria | 1545 | Open in IMG/M |
| 3300005338|Ga0068868_100979068 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 773 | Open in IMG/M |
| 3300005354|Ga0070675_100089443 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2578 | Open in IMG/M |
| 3300005434|Ga0070709_11258096 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300005436|Ga0070713_100917600 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 843 | Open in IMG/M |
| 3300005445|Ga0070708_101290250 | Not Available | 682 | Open in IMG/M |
| 3300005458|Ga0070681_10133749 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2411 | Open in IMG/M |
| 3300005458|Ga0070681_10720206 | All Organisms → cellular organisms → Bacteria | 914 | Open in IMG/M |
| 3300005471|Ga0070698_101040152 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 766 | Open in IMG/M |
| 3300005526|Ga0073909_10147858 | All Organisms → cellular organisms → Bacteria | 977 | Open in IMG/M |
| 3300005534|Ga0070735_10034086 | All Organisms → cellular organisms → Bacteria | 3506 | Open in IMG/M |
| 3300005535|Ga0070684_101473581 | Not Available | 641 | Open in IMG/M |
| 3300005538|Ga0070731_10248740 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1180 | Open in IMG/M |
| 3300005538|Ga0070731_11041940 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300005541|Ga0070733_10261605 | All Organisms → cellular organisms → Bacteria | 1139 | Open in IMG/M |
| 3300005545|Ga0070695_100782237 | Not Available | 763 | Open in IMG/M |
| 3300005548|Ga0070665_100739307 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Deinococcus-Thermus → Deinococci → Thermales → Thermaceae → Meiothermus → Meiothermus taiwanensis | 997 | Open in IMG/M |
| 3300005557|Ga0066704_10432437 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 871 | Open in IMG/M |
| 3300005557|Ga0066704_10800654 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 586 | Open in IMG/M |
| 3300005560|Ga0066670_10560613 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 698 | Open in IMG/M |
| 3300005576|Ga0066708_10404762 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 876 | Open in IMG/M |
| 3300005577|Ga0068857_101384665 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
| 3300005587|Ga0066654_10398487 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 750 | Open in IMG/M |
| 3300005607|Ga0070740_10047869 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 2188 | Open in IMG/M |
| 3300005614|Ga0068856_101837928 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300005764|Ga0066903_101040842 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1502 | Open in IMG/M |
| 3300005764|Ga0066903_101443929 | Not Available | 1295 | Open in IMG/M |
| 3300005764|Ga0066903_103759714 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 816 | Open in IMG/M |
| 3300005764|Ga0066903_104167555 | Not Available | 774 | Open in IMG/M |
| 3300005937|Ga0081455_11036653 | Not Available | 507 | Open in IMG/M |
| 3300006028|Ga0070717_11085521 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 729 | Open in IMG/M |
| 3300006028|Ga0070717_11111352 | Not Available | 720 | Open in IMG/M |
| 3300006028|Ga0070717_11312783 | Not Available | 658 | Open in IMG/M |
| 3300006102|Ga0075015_100753971 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Boseaceae → Bosea → Bosea lathyri | 581 | Open in IMG/M |
| 3300006173|Ga0070716_101859337 | Not Available | 500 | Open in IMG/M |
| 3300006175|Ga0070712_102033088 | Not Available | 503 | Open in IMG/M |
| 3300006176|Ga0070765_100925262 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 824 | Open in IMG/M |
| 3300006176|Ga0070765_101633509 | Not Available | 606 | Open in IMG/M |
| 3300006580|Ga0074049_10943425 | Not Available | 513 | Open in IMG/M |
| 3300006796|Ga0066665_10735949 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocella → Methylocella tundrae | 780 | Open in IMG/M |
| 3300006800|Ga0066660_11007426 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300006854|Ga0075425_102914381 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocella → Methylocella tundrae | 525 | Open in IMG/M |
| 3300006893|Ga0073928_10000419 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 100320 | Open in IMG/M |
| 3300006893|Ga0073928_10004045 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 22264 | Open in IMG/M |
| 3300006893|Ga0073928_10027496 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 5574 | Open in IMG/M |
| 3300006954|Ga0079219_10485763 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 858 | Open in IMG/M |
| 3300007258|Ga0099793_10657921 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 527 | Open in IMG/M |
| 3300007265|Ga0099794_10738671 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 525 | Open in IMG/M |
| 3300007788|Ga0099795_10282911 | Not Available | 724 | Open in IMG/M |
| 3300007788|Ga0099795_10387629 | Not Available | 632 | Open in IMG/M |
| 3300007821|Ga0104323_126961 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 2208 | Open in IMG/M |
| 3300009038|Ga0099829_10045985 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3208 | Open in IMG/M |
| 3300009038|Ga0099829_10432557 | Not Available | 1089 | Open in IMG/M |
| 3300009038|Ga0099829_10440693 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1079 | Open in IMG/M |
| 3300009038|Ga0099829_10552336 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocella → Methylocella tundrae | 957 | Open in IMG/M |
| 3300009088|Ga0099830_10547850 | Not Available | 946 | Open in IMG/M |
| 3300009088|Ga0099830_11614771 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 540 | Open in IMG/M |
| 3300009089|Ga0099828_10129256 | All Organisms → cellular organisms → Bacteria | 2216 | Open in IMG/M |
| 3300009089|Ga0099828_10379129 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocella → Methylocella tundrae | 1275 | Open in IMG/M |
| 3300009090|Ga0099827_10066436 | All Organisms → cellular organisms → Bacteria | 2768 | Open in IMG/M |
| 3300009090|Ga0099827_10162898 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1833 | Open in IMG/M |
| 3300009090|Ga0099827_10428943 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocella → Methylocella tundrae | 1132 | Open in IMG/M |
| 3300009090|Ga0099827_10595406 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 953 | Open in IMG/M |
| 3300009090|Ga0099827_11087302 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 694 | Open in IMG/M |
| 3300009093|Ga0105240_11246107 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae | 786 | Open in IMG/M |
| 3300009094|Ga0111539_10062527 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4406 | Open in IMG/M |
| 3300009137|Ga0066709_100626176 | Not Available | 1536 | Open in IMG/M |
| 3300009137|Ga0066709_100751593 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocella → Methylocella tundrae | 1408 | Open in IMG/M |
| 3300009137|Ga0066709_101866577 | Not Available | 839 | Open in IMG/M |
| 3300009137|Ga0066709_102277476 | Not Available | 744 | Open in IMG/M |
| 3300009143|Ga0099792_10282238 | Not Available | 979 | Open in IMG/M |
| 3300009148|Ga0105243_11343508 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 733 | Open in IMG/M |
| 3300009156|Ga0111538_11239352 | All Organisms → cellular organisms → Bacteria | 942 | Open in IMG/M |
| 3300009177|Ga0105248_13283484 | Not Available | 514 | Open in IMG/M |
| 3300009683|Ga0116224_10331654 | Not Available | 723 | Open in IMG/M |
| 3300009789|Ga0126307_10217979 | All Organisms → cellular organisms → Bacteria | 1532 | Open in IMG/M |
| 3300009789|Ga0126307_10574203 | Not Available | 911 | Open in IMG/M |
| 3300009792|Ga0126374_10559397 | Not Available | 836 | Open in IMG/M |
| 3300009792|Ga0126374_11303777 | Not Available | 587 | Open in IMG/M |
| 3300009792|Ga0126374_11562980 | Not Available | 543 | Open in IMG/M |
| 3300010037|Ga0126304_10190890 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocella → Methylocella tundrae | 1337 | Open in IMG/M |
| 3300010038|Ga0126315_10451364 | Not Available | 814 | Open in IMG/M |
| 3300010038|Ga0126315_10775146 | Not Available | 630 | Open in IMG/M |
| 3300010040|Ga0126308_11312557 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 514 | Open in IMG/M |
| 3300010041|Ga0126312_10733109 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 715 | Open in IMG/M |
| 3300010043|Ga0126380_10317806 | All Organisms → cellular organisms → Bacteria | 1117 | Open in IMG/M |
| 3300010043|Ga0126380_11755074 | Not Available | 559 | Open in IMG/M |
| 3300010044|Ga0126310_10253543 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1188 | Open in IMG/M |
| 3300010046|Ga0126384_10393609 | All Organisms → cellular organisms → Bacteria | 1168 | Open in IMG/M |
| 3300010046|Ga0126384_12325467 | Not Available | 518 | Open in IMG/M |
| 3300010048|Ga0126373_10185920 | Not Available | 2003 | Open in IMG/M |
| 3300010048|Ga0126373_10524833 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1229 | Open in IMG/M |
| 3300010048|Ga0126373_10639423 | Not Available | 1119 | Open in IMG/M |
| 3300010048|Ga0126373_11005761 | Not Available | 899 | Open in IMG/M |
| 3300010146|Ga0126320_1146093 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 550 | Open in IMG/M |
| 3300010321|Ga0134067_10031905 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1636 | Open in IMG/M |
| 3300010323|Ga0134086_10465844 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 518 | Open in IMG/M |
| 3300010325|Ga0134064_10437977 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 530 | Open in IMG/M |
| 3300010358|Ga0126370_10466686 | All Organisms → cellular organisms → Bacteria | 1057 | Open in IMG/M |
| 3300010358|Ga0126370_11064379 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 743 | Open in IMG/M |
| 3300010358|Ga0126370_12335392 | Not Available | 530 | Open in IMG/M |
| 3300010358|Ga0126370_12651806 | Not Available | 502 | Open in IMG/M |
| 3300010359|Ga0126376_11633867 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
| 3300010359|Ga0126376_12178553 | Not Available | 599 | Open in IMG/M |
| 3300010359|Ga0126376_12467233 | Not Available | 567 | Open in IMG/M |
| 3300010360|Ga0126372_11109911 | Not Available | 810 | Open in IMG/M |
| 3300010361|Ga0126378_10071346 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3328 | Open in IMG/M |
| 3300010361|Ga0126378_12765337 | Not Available | 560 | Open in IMG/M |
| 3300010366|Ga0126379_10881138 | Not Available | 997 | Open in IMG/M |
| 3300010366|Ga0126379_13527323 | Not Available | 524 | Open in IMG/M |
| 3300010376|Ga0126381_100888487 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1282 | Open in IMG/M |
| 3300010376|Ga0126381_101320610 | Not Available | 1042 | Open in IMG/M |
| 3300010376|Ga0126381_101666438 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 921 | Open in IMG/M |
| 3300010379|Ga0136449_103556859 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 592 | Open in IMG/M |
| 3300010379|Ga0136449_104559364 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 508 | Open in IMG/M |
| 3300010391|Ga0136847_11693681 | All Organisms → cellular organisms → Bacteria | 2082 | Open in IMG/M |
| 3300010396|Ga0134126_10456501 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1478 | Open in IMG/M |
| 3300010398|Ga0126383_10372971 | Not Available | 1455 | Open in IMG/M |
| 3300010398|Ga0126383_11020342 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 916 | Open in IMG/M |
| 3300010398|Ga0126383_11575366 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 746 | Open in IMG/M |
| 3300010398|Ga0126383_12722774 | Not Available | 577 | Open in IMG/M |
| 3300010401|Ga0134121_10712301 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Deinococcus-Thermus → Deinococci → Thermales → Thermaceae → Meiothermus → Meiothermus taiwanensis | 953 | Open in IMG/M |
| 3300011269|Ga0137392_10237867 | All Organisms → cellular organisms → Bacteria | 1496 | Open in IMG/M |
| 3300011269|Ga0137392_10298585 | All Organisms → cellular organisms → Bacteria | 1331 | Open in IMG/M |
| 3300011269|Ga0137392_11636049 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 502 | Open in IMG/M |
| 3300011270|Ga0137391_10995290 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
| 3300011429|Ga0137455_1180033 | Not Available | 633 | Open in IMG/M |
| 3300011440|Ga0137433_1017033 | All Organisms → cellular organisms → Bacteria | 2114 | Open in IMG/M |
| 3300011441|Ga0137452_1166379 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocella → Methylocella tundrae | 744 | Open in IMG/M |
| 3300011444|Ga0137463_1118180 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocella → Methylocella tundrae | 998 | Open in IMG/M |
| 3300011444|Ga0137463_1290798 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocella → Methylocella tundrae | 601 | Open in IMG/M |
| 3300011999|Ga0120148_1019840 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocella → Methylocella tundrae | 1519 | Open in IMG/M |
| 3300012096|Ga0137389_10085274 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2477 | Open in IMG/M |
| 3300012203|Ga0137399_11316310 | Not Available | 607 | Open in IMG/M |
| 3300012206|Ga0137380_10560550 | All Organisms → cellular organisms → Bacteria | 1002 | Open in IMG/M |
| 3300012206|Ga0137380_11268884 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 622 | Open in IMG/M |
| 3300012207|Ga0137381_10792719 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 822 | Open in IMG/M |
| 3300012208|Ga0137376_10701446 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 873 | Open in IMG/M |
| 3300012209|Ga0137379_10604383 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Deinococcus-Thermus → Deinococci → Thermales → Thermaceae → Meiothermus → Meiothermus taiwanensis | 1003 | Open in IMG/M |
| 3300012210|Ga0137378_10044917 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3962 | Open in IMG/M |
| 3300012210|Ga0137378_11439930 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 601 | Open in IMG/M |
| 3300012210|Ga0137378_11655083 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 547 | Open in IMG/M |
| 3300012211|Ga0137377_11104844 | Not Available | 723 | Open in IMG/M |
| 3300012212|Ga0150985_100195288 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 557 | Open in IMG/M |
| 3300012212|Ga0150985_107110412 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300012350|Ga0137372_10259403 | All Organisms → cellular organisms → Bacteria | 1364 | Open in IMG/M |
| 3300012351|Ga0137386_10122766 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1849 | Open in IMG/M |
| 3300012351|Ga0137386_11011071 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 591 | Open in IMG/M |
| 3300012354|Ga0137366_10139201 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1829 | Open in IMG/M |
| 3300012357|Ga0137384_10673755 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 841 | Open in IMG/M |
| 3300012359|Ga0137385_10120848 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2313 | Open in IMG/M |
| 3300012359|Ga0137385_10439918 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1108 | Open in IMG/M |
| 3300012359|Ga0137385_10516175 | Not Available | 1010 | Open in IMG/M |
| 3300012360|Ga0137375_11300403 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 549 | Open in IMG/M |
| 3300012361|Ga0137360_10785291 | Not Available | 819 | Open in IMG/M |
| 3300012363|Ga0137390_10323237 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1524 | Open in IMG/M |
| 3300012582|Ga0137358_11074073 | Not Available | 515 | Open in IMG/M |
| 3300012683|Ga0137398_10708827 | Not Available | 700 | Open in IMG/M |
| 3300012922|Ga0137394_10476461 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1061 | Open in IMG/M |
| 3300012922|Ga0137394_10862601 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocella → Methylocella tundrae | 757 | Open in IMG/M |
| 3300012925|Ga0137419_10600520 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 884 | Open in IMG/M |
| 3300012925|Ga0137419_11475922 | Not Available | 575 | Open in IMG/M |
| 3300012927|Ga0137416_10296273 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1339 | Open in IMG/M |
| 3300012971|Ga0126369_10046523 | All Organisms → cellular organisms → Bacteria | 3680 | Open in IMG/M |
| 3300012971|Ga0126369_10224820 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1829 | Open in IMG/M |
| 3300012971|Ga0126369_10407330 | All Organisms → cellular organisms → Bacteria | 1399 | Open in IMG/M |
| 3300012975|Ga0134110_10405960 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 605 | Open in IMG/M |
| 3300012977|Ga0134087_10040716 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1798 | Open in IMG/M |
| 3300013297|Ga0157378_10619577 | Not Available | 1095 | Open in IMG/M |
| 3300014497|Ga0182008_10065690 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1785 | Open in IMG/M |
| 3300014501|Ga0182024_10015463 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 14604 | Open in IMG/M |
| 3300014829|Ga0120104_1051283 | Not Available | 778 | Open in IMG/M |
| 3300015245|Ga0137409_11479420 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 527 | Open in IMG/M |
| 3300015371|Ga0132258_10315459 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3851 | Open in IMG/M |
| 3300015371|Ga0132258_10434966 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3267 | Open in IMG/M |
| 3300016270|Ga0182036_11001321 | Not Available | 689 | Open in IMG/M |
| 3300016294|Ga0182041_10200047 | Not Available | 1590 | Open in IMG/M |
| 3300016319|Ga0182033_10046392 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2909 | Open in IMG/M |
| 3300016319|Ga0182033_10474985 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1070 | Open in IMG/M |
| 3300016319|Ga0182033_10833978 | All Organisms → cellular organisms → Bacteria | 814 | Open in IMG/M |
| 3300016319|Ga0182033_11037482 | Not Available | 730 | Open in IMG/M |
| 3300016341|Ga0182035_10399787 | All Organisms → cellular organisms → Bacteria | 1154 | Open in IMG/M |
| 3300016357|Ga0182032_10467055 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1032 | Open in IMG/M |
| 3300016371|Ga0182034_11131354 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 679 | Open in IMG/M |
| 3300016387|Ga0182040_10809154 | Not Available | 773 | Open in IMG/M |
| 3300016404|Ga0182037_10118060 | Not Available | 1943 | Open in IMG/M |
| 3300016404|Ga0182037_10328123 | All Organisms → cellular organisms → Bacteria | 1239 | Open in IMG/M |
| 3300016404|Ga0182037_11149243 | Not Available | 681 | Open in IMG/M |
| 3300016422|Ga0182039_11269197 | Not Available | 667 | Open in IMG/M |
| 3300016445|Ga0182038_10101772 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2089 | Open in IMG/M |
| 3300016445|Ga0182038_10407859 | All Organisms → cellular organisms → Bacteria | 1141 | Open in IMG/M |
| 3300017823|Ga0187818_10001481 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 9486 | Open in IMG/M |
| 3300017934|Ga0187803_10474501 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 511 | Open in IMG/M |
| 3300017970|Ga0187783_10822587 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 670 | Open in IMG/M |
| 3300017970|Ga0187783_11087330 | Not Available | 576 | Open in IMG/M |
| 3300017972|Ga0187781_10553623 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocella → Methylocella tundrae | 828 | Open in IMG/M |
| 3300018058|Ga0187766_11454629 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 505 | Open in IMG/M |
| 3300018061|Ga0184619_10170338 | Not Available | 997 | Open in IMG/M |
| 3300018062|Ga0187784_10474481 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1009 | Open in IMG/M |
| 3300018084|Ga0184629_10224951 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocella → Methylocella tundrae | 976 | Open in IMG/M |
| 3300018088|Ga0187771_10120276 | All Organisms → cellular organisms → Bacteria | 2135 | Open in IMG/M |
| 3300018088|Ga0187771_11871935 | Not Available | 509 | Open in IMG/M |
| 3300018431|Ga0066655_10724259 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 674 | Open in IMG/M |
| 3300018433|Ga0066667_12216237 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 512 | Open in IMG/M |
| 3300018468|Ga0066662_10380642 | All Organisms → cellular organisms → Bacteria | 1230 | Open in IMG/M |
| 3300018468|Ga0066662_11890777 | Not Available | 624 | Open in IMG/M |
| 3300018476|Ga0190274_10173769 | All Organisms → cellular organisms → Bacteria | 1855 | Open in IMG/M |
| 3300018482|Ga0066669_10637058 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium | 937 | Open in IMG/M |
| 3300018482|Ga0066669_10665266 | Not Available | 916 | Open in IMG/M |
| 3300018482|Ga0066669_10854857 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocella → Methylocella tundrae | 810 | Open in IMG/M |
| 3300018482|Ga0066669_11067735 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 729 | Open in IMG/M |
| 3300018482|Ga0066669_11089906 | Not Available | 721 | Open in IMG/M |
| 3300018482|Ga0066669_11434000 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 626 | Open in IMG/M |
| 3300019786|Ga0182025_1159048 | Not Available | 1337 | Open in IMG/M |
| 3300019887|Ga0193729_1129511 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocella → Methylocella tundrae | 932 | Open in IMG/M |
| 3300019888|Ga0193751_1015301 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3912 | Open in IMG/M |
| 3300019888|Ga0193751_1037555 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2199 | Open in IMG/M |
| 3300019888|Ga0193751_1112458 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1029 | Open in IMG/M |
| 3300019889|Ga0193743_1086902 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocella → Methylocella tundrae | 1210 | Open in IMG/M |
| 3300020069|Ga0197907_11366174 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 589 | Open in IMG/M |
| 3300020199|Ga0179592_10095026 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1369 | Open in IMG/M |
| 3300020579|Ga0210407_10066723 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2698 | Open in IMG/M |
| 3300020579|Ga0210407_10240850 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1408 | Open in IMG/M |
| 3300020579|Ga0210407_10322479 | Not Available | 1207 | Open in IMG/M |
| 3300020580|Ga0210403_10061951 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 2999 | Open in IMG/M |
| 3300020580|Ga0210403_10811517 | Not Available | 743 | Open in IMG/M |
| 3300020580|Ga0210403_11198417 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 585 | Open in IMG/M |
| 3300020581|Ga0210399_10051334 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3313 | Open in IMG/M |
| 3300020581|Ga0210399_10310069 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1317 | Open in IMG/M |
| 3300020583|Ga0210401_10481055 | Not Available | 1104 | Open in IMG/M |
| 3300021088|Ga0210404_10181158 | All Organisms → cellular organisms → Bacteria | 1121 | Open in IMG/M |
| 3300021170|Ga0210400_10003734 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 13390 | Open in IMG/M |
| 3300021171|Ga0210405_11398652 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 510 | Open in IMG/M |
| 3300021181|Ga0210388_11074218 | Not Available | 688 | Open in IMG/M |
| 3300021344|Ga0193719_10384244 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 580 | Open in IMG/M |
| 3300021358|Ga0213873_10062630 | Not Available | 1010 | Open in IMG/M |
| 3300021374|Ga0213881_10322285 | Not Available | 691 | Open in IMG/M |
| 3300021377|Ga0213874_10094425 | Not Available | 987 | Open in IMG/M |
| 3300021384|Ga0213876_10145348 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocella → Methylocella tundrae | 1261 | Open in IMG/M |
| 3300021388|Ga0213875_10073884 | All Organisms → cellular organisms → Bacteria | 1591 | Open in IMG/M |
| 3300021401|Ga0210393_10383919 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1145 | Open in IMG/M |
| 3300021403|Ga0210397_11296704 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 566 | Open in IMG/M |
| 3300021404|Ga0210389_10556498 | All Organisms → cellular organisms → Bacteria | 902 | Open in IMG/M |
| 3300021405|Ga0210387_10367243 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1273 | Open in IMG/M |
| 3300021432|Ga0210384_11319842 | Not Available | 626 | Open in IMG/M |
| 3300021432|Ga0210384_11613839 | Not Available | 554 | Open in IMG/M |
| 3300021478|Ga0210402_10392090 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1289 | Open in IMG/M |
| 3300021559|Ga0210409_11692289 | Not Available | 509 | Open in IMG/M |
| 3300021560|Ga0126371_10035889 | Not Available | 4674 | Open in IMG/M |
| 3300021560|Ga0126371_10796393 | All Organisms → cellular organisms → Bacteria | 1091 | Open in IMG/M |
| 3300021560|Ga0126371_10821831 | Not Available | 1075 | Open in IMG/M |
| 3300021560|Ga0126371_10902494 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1028 | Open in IMG/M |
| 3300021560|Ga0126371_11481183 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
| 3300021560|Ga0126371_11956338 | Not Available | 705 | Open in IMG/M |
| 3300021560|Ga0126371_13548093 | Not Available | 526 | Open in IMG/M |
| 3300021861|Ga0213853_10687880 | All Organisms → cellular organisms → Bacteria | 835 | Open in IMG/M |
| 3300021861|Ga0213853_11488376 | Not Available | 545 | Open in IMG/M |
| 3300022532|Ga0242655_10199717 | Not Available | 611 | Open in IMG/M |
| 3300022557|Ga0212123_10000744 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 100375 | Open in IMG/M |
| 3300022557|Ga0212123_10001042 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 81348 | Open in IMG/M |
| 3300022557|Ga0212123_10028411 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 5865 | Open in IMG/M |
| 3300022557|Ga0212123_10068806 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 3066 | Open in IMG/M |
| 3300022720|Ga0242672_1017664 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 954 | Open in IMG/M |
| 3300022726|Ga0242654_10119775 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 848 | Open in IMG/M |
| 3300024317|Ga0247660_1096217 | Not Available | 512 | Open in IMG/M |
| 3300024330|Ga0137417_1374802 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 515 | Open in IMG/M |
| 3300025910|Ga0207684_10506615 | Not Available | 1034 | Open in IMG/M |
| 3300025912|Ga0207707_10280383 | All Organisms → cellular organisms → Bacteria | 1444 | Open in IMG/M |
| 3300025913|Ga0207695_10559991 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1024 | Open in IMG/M |
| 3300025913|Ga0207695_10904145 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocella → Methylocella tundrae | 762 | Open in IMG/M |
| 3300025915|Ga0207693_10348842 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 1158 | Open in IMG/M |
| 3300025917|Ga0207660_10596925 | All Organisms → cellular organisms → Bacteria | 899 | Open in IMG/M |
| 3300025926|Ga0207659_11029934 | Not Available | 708 | Open in IMG/M |
| 3300025930|Ga0207701_10833758 | Not Available | 775 | Open in IMG/M |
| 3300026041|Ga0207639_11190147 | Not Available | 715 | Open in IMG/M |
| 3300026078|Ga0207702_11302345 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 721 | Open in IMG/M |
| 3300026326|Ga0209801_1107623 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium | 1202 | Open in IMG/M |
| 3300026335|Ga0209804_1224118 | Not Available | 748 | Open in IMG/M |
| 3300026490|Ga0257153_1053032 | Not Available | 829 | Open in IMG/M |
| 3300026555|Ga0179593_1021199 | All Organisms → cellular organisms → Bacteria | 2965 | Open in IMG/M |
| 3300027071|Ga0209214_1009637 | Not Available | 1150 | Open in IMG/M |
| 3300027074|Ga0208092_106955 | Not Available | 685 | Open in IMG/M |
| 3300027583|Ga0209527_1105129 | Not Available | 633 | Open in IMG/M |
| 3300027635|Ga0209625_1128931 | Not Available | 567 | Open in IMG/M |
| 3300027667|Ga0209009_1033216 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1274 | Open in IMG/M |
| 3300027684|Ga0209626_1017807 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1674 | Open in IMG/M |
| 3300027701|Ga0209447_10065190 | Not Available | 1000 | Open in IMG/M |
| 3300027706|Ga0209581_1120029 | Not Available | 880 | Open in IMG/M |
| 3300027815|Ga0209726_10000226 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 117080 | Open in IMG/M |
| 3300027815|Ga0209726_10016576 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 6624 | Open in IMG/M |
| 3300027846|Ga0209180_10224673 | All Organisms → cellular organisms → Bacteria | 1082 | Open in IMG/M |
| 3300027867|Ga0209167_10098675 | All Organisms → cellular organisms → Bacteria | 1492 | Open in IMG/M |
| 3300027875|Ga0209283_10161251 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1488 | Open in IMG/M |
| 3300027875|Ga0209283_10493124 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 789 | Open in IMG/M |
| 3300027875|Ga0209283_10780314 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocella → Methylocella tundrae | 589 | Open in IMG/M |
| 3300027882|Ga0209590_10065674 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2072 | Open in IMG/M |
| 3300027882|Ga0209590_10961048 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 535 | Open in IMG/M |
| 3300027884|Ga0209275_10480947 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocella → Methylocella tundrae | 706 | Open in IMG/M |
| 3300027903|Ga0209488_10119186 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1985 | Open in IMG/M |
| 3300027903|Ga0209488_10385525 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1039 | Open in IMG/M |
| 3300027905|Ga0209415_10004996 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 24060 | Open in IMG/M |
| 3300027907|Ga0207428_11196180 | Not Available | 529 | Open in IMG/M |
| 3300028047|Ga0209526_10160237 | Not Available | 1573 | Open in IMG/M |
| 3300028047|Ga0209526_10538002 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 756 | Open in IMG/M |
| 3300028047|Ga0209526_10656480 | Not Available | 665 | Open in IMG/M |
| 3300028906|Ga0308309_11629556 | Not Available | 549 | Open in IMG/M |
| 3300030997|Ga0073997_12233852 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 526 | Open in IMG/M |
| 3300030998|Ga0073996_12449895 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 666 | Open in IMG/M |
| 3300031022|Ga0138301_1211589 | Not Available | 722 | Open in IMG/M |
| 3300031023|Ga0073998_11020172 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 550 | Open in IMG/M |
| 3300031023|Ga0073998_11649427 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 512 | Open in IMG/M |
| 3300031057|Ga0170834_101387461 | Not Available | 510 | Open in IMG/M |
| 3300031057|Ga0170834_111628155 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1168 | Open in IMG/M |
| 3300031057|Ga0170834_113125840 | Not Available | 846 | Open in IMG/M |
| 3300031058|Ga0308189_10078993 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 993 | Open in IMG/M |
| 3300031122|Ga0170822_16114252 | Not Available | 740 | Open in IMG/M |
| 3300031128|Ga0170823_17311304 | Not Available | 664 | Open in IMG/M |
| 3300031231|Ga0170824_103828152 | Not Available | 1283 | Open in IMG/M |
| 3300031231|Ga0170824_111990293 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2283 | Open in IMG/M |
| 3300031231|Ga0170824_115224373 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 926 | Open in IMG/M |
| 3300031231|Ga0170824_116746961 | Not Available | 507 | Open in IMG/M |
| 3300031421|Ga0308194_10171320 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 684 | Open in IMG/M |
| 3300031446|Ga0170820_10873931 | Not Available | 501 | Open in IMG/M |
| 3300031446|Ga0170820_12474293 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300031446|Ga0170820_13152317 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300031446|Ga0170820_17093909 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 993 | Open in IMG/M |
| 3300031474|Ga0170818_102742261 | Not Available | 742 | Open in IMG/M |
| 3300031543|Ga0318516_10159093 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1299 | Open in IMG/M |
| 3300031543|Ga0318516_10461531 | Not Available | 730 | Open in IMG/M |
| 3300031543|Ga0318516_10468252 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 724 | Open in IMG/M |
| 3300031544|Ga0318534_10765349 | Not Available | 543 | Open in IMG/M |
| 3300031545|Ga0318541_10027480 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodopila | 2789 | Open in IMG/M |
| 3300031545|Ga0318541_10036787 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2461 | Open in IMG/M |
| 3300031545|Ga0318541_10052050 | All Organisms → cellular organisms → Bacteria | 2105 | Open in IMG/M |
| 3300031545|Ga0318541_10199042 | All Organisms → cellular organisms → Bacteria | 1108 | Open in IMG/M |
| 3300031545|Ga0318541_10322301 | Not Available | 862 | Open in IMG/M |
| 3300031545|Ga0318541_10494928 | Not Available | 684 | Open in IMG/M |
| 3300031545|Ga0318541_10713231 | Not Available | 560 | Open in IMG/M |
| 3300031546|Ga0318538_10470676 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 681 | Open in IMG/M |
| 3300031546|Ga0318538_10639882 | Not Available | 577 | Open in IMG/M |
| 3300031561|Ga0318528_10758381 | Not Available | 519 | Open in IMG/M |
| 3300031564|Ga0318573_10662334 | Not Available | 561 | Open in IMG/M |
| 3300031573|Ga0310915_10029808 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3397 | Open in IMG/M |
| 3300031573|Ga0310915_10355175 | Not Available | 1039 | Open in IMG/M |
| 3300031573|Ga0310915_10546176 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 822 | Open in IMG/M |
| 3300031573|Ga0310915_10984275 | Not Available | 589 | Open in IMG/M |
| 3300031640|Ga0318555_10403808 | Not Available | 740 | Open in IMG/M |
| 3300031679|Ga0318561_10214685 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1045 | Open in IMG/M |
| 3300031679|Ga0318561_10438659 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 718 | Open in IMG/M |
| 3300031679|Ga0318561_10546241 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 638 | Open in IMG/M |
| 3300031680|Ga0318574_10854386 | Not Available | 533 | Open in IMG/M |
| 3300031718|Ga0307474_10451579 | Not Available | 1005 | Open in IMG/M |
| 3300031719|Ga0306917_10410053 | Not Available | 1058 | Open in IMG/M |
| 3300031719|Ga0306917_11032826 | Not Available | 641 | Open in IMG/M |
| 3300031719|Ga0306917_11395304 | Not Available | 540 | Open in IMG/M |
| 3300031720|Ga0307469_10151377 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1737 | Open in IMG/M |
| 3300031720|Ga0307469_11569604 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 632 | Open in IMG/M |
| 3300031744|Ga0306918_10083831 | All Organisms → cellular organisms → Bacteria | 2226 | Open in IMG/M |
| 3300031744|Ga0306918_10277637 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1285 | Open in IMG/M |
| 3300031753|Ga0307477_11171528 | Not Available | 500 | Open in IMG/M |
| 3300031754|Ga0307475_10437037 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1052 | Open in IMG/M |
| 3300031768|Ga0318509_10573211 | Not Available | 629 | Open in IMG/M |
| 3300031779|Ga0318566_10662979 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 506 | Open in IMG/M |
| 3300031796|Ga0318576_10316334 | Not Available | 737 | Open in IMG/M |
| 3300031819|Ga0318568_10519904 | Not Available | 742 | Open in IMG/M |
| 3300031820|Ga0307473_10787927 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 677 | Open in IMG/M |
| 3300031823|Ga0307478_11089382 | Not Available | 667 | Open in IMG/M |
| 3300031845|Ga0318511_10115828 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales | 1150 | Open in IMG/M |
| 3300031860|Ga0318495_10274832 | Not Available | 752 | Open in IMG/M |
| 3300031879|Ga0306919_10010176 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 5267 | Open in IMG/M |
| 3300031879|Ga0306919_10607228 | Not Available | 844 | Open in IMG/M |
| 3300031879|Ga0306919_11227196 | Not Available | 569 | Open in IMG/M |
| 3300031880|Ga0318544_10058190 | Not Available | 1407 | Open in IMG/M |
| 3300031880|Ga0318544_10392561 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 539 | Open in IMG/M |
| 3300031890|Ga0306925_10470656 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1341 | Open in IMG/M |
| 3300031893|Ga0318536_10597080 | Not Available | 552 | Open in IMG/M |
| 3300031897|Ga0318520_10692984 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 636 | Open in IMG/M |
| 3300031910|Ga0306923_11804454 | Not Available | 628 | Open in IMG/M |
| 3300031912|Ga0306921_10297384 | Not Available | 1890 | Open in IMG/M |
| 3300031912|Ga0306921_10570351 | All Organisms → cellular organisms → Bacteria | 1311 | Open in IMG/M |
| 3300031912|Ga0306921_10753165 | All Organisms → cellular organisms → Bacteria | 1116 | Open in IMG/M |
| 3300031912|Ga0306921_12019576 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 613 | Open in IMG/M |
| 3300031912|Ga0306921_12622371 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocella → Methylocella tundrae | 520 | Open in IMG/M |
| 3300031942|Ga0310916_10984336 | Not Available | 704 | Open in IMG/M |
| 3300031946|Ga0310910_10579035 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 890 | Open in IMG/M |
| 3300031946|Ga0310910_11230194 | Not Available | 580 | Open in IMG/M |
| 3300031947|Ga0310909_10187510 | Not Available | 1714 | Open in IMG/M |
| 3300031954|Ga0306926_10497106 | Not Available | 1499 | Open in IMG/M |
| 3300031954|Ga0306926_10945538 | Not Available | 1029 | Open in IMG/M |
| 3300031954|Ga0306926_13024123 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 501 | Open in IMG/M |
| 3300031962|Ga0307479_10457864 | All Organisms → cellular organisms → Bacteria | 1260 | Open in IMG/M |
| 3300031962|Ga0307479_10523731 | All Organisms → cellular organisms → Bacteria | 1169 | Open in IMG/M |
| 3300031965|Ga0326597_10017469 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 9331 | Open in IMG/M |
| 3300031965|Ga0326597_10311928 | All Organisms → cellular organisms → Bacteria | 1784 | Open in IMG/M |
| 3300031981|Ga0318531_10255725 | Not Available | 791 | Open in IMG/M |
| 3300032001|Ga0306922_11286068 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 740 | Open in IMG/M |
| 3300032042|Ga0318545_10031701 | All Organisms → cellular organisms → Bacteria | 1734 | Open in IMG/M |
| 3300032042|Ga0318545_10290393 | Not Available | 588 | Open in IMG/M |
| 3300032044|Ga0318558_10115992 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1267 | Open in IMG/M |
| 3300032052|Ga0318506_10205563 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales | 869 | Open in IMG/M |
| 3300032059|Ga0318533_11173843 | Not Available | 562 | Open in IMG/M |
| 3300032074|Ga0308173_11311066 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 678 | Open in IMG/M |
| 3300032076|Ga0306924_10642259 | All Organisms → cellular organisms → Bacteria | 1197 | Open in IMG/M |
| 3300032076|Ga0306924_10863443 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1004 | Open in IMG/M |
| 3300032076|Ga0306924_10938645 | Not Available | 954 | Open in IMG/M |
| 3300032090|Ga0318518_10148638 | Not Available | 1189 | Open in IMG/M |
| 3300032090|Ga0318518_10408476 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
| 3300032090|Ga0318518_10674950 | Not Available | 526 | Open in IMG/M |
| 3300032160|Ga0311301_12949601 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 514 | Open in IMG/M |
| 3300032180|Ga0307471_103448938 | Not Available | 560 | Open in IMG/M |
| 3300032205|Ga0307472_101416003 | Not Available | 675 | Open in IMG/M |
| 3300032261|Ga0306920_101038682 | Not Available | 1191 | Open in IMG/M |
| 3300032261|Ga0306920_101349396 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1024 | Open in IMG/M |
| 3300032261|Ga0306920_101636016 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocella → Methylocella tundrae | 915 | Open in IMG/M |
| 3300032261|Ga0306920_101955359 | Not Available | 823 | Open in IMG/M |
| 3300032261|Ga0306920_103924471 | Not Available | 541 | Open in IMG/M |
| 3300032892|Ga0335081_11057963 | All Organisms → cellular organisms → Bacteria | 939 | Open in IMG/M |
| 3300033233|Ga0334722_10955026 | Not Available | 604 | Open in IMG/M |
| 3300033289|Ga0310914_10011841 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 6504 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 17.48% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 13.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.51% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 8.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.32% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.10% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 3.10% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.10% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.65% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.65% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.43% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.99% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 1.77% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.77% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.55% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.55% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.55% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.11% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.11% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.11% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.11% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.66% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.66% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.66% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.66% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.44% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.44% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.44% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.44% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.44% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.44% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.44% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.44% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.44% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.44% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.44% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.22% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment | 0.22% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.22% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.22% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.22% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.22% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.22% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.22% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.22% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.22% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.22% |
| Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.22% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.22% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.22% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.22% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.22% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.22% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.22% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.22% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.89% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.89% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2189573000 | Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO 1O1 lysis 0-21cm (T0 for microcosms) | Environmental | Open in IMG/M |
| 3300000574 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m | Environmental | Open in IMG/M |
| 3300001334 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A21-65cm)- 6 month illumina | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004268 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005607 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006580 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300007821 | Permafrost core soil microbial communities from Svalbard, Norway - sample 2-10-2 Soapdenovo | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010146 | Soil microbial communities from California, USA to study soil gas exchange rates - JR-CA-SND metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010391 | Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011429 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT600_2 | Environmental | Open in IMG/M |
| 3300011440 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT840_2 | Environmental | Open in IMG/M |
| 3300011441 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT513_2 | Environmental | Open in IMG/M |
| 3300011444 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2 | Environmental | Open in IMG/M |
| 3300011999 | Permafrost microbial communities from Nunavut, Canada - A28_65cm_6M | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014829 | Permafrost microbial communities from Nunavut, Canada - A10_35cm_6M | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019786 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
| 3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
| 3300019889 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2c2 | Environmental | Open in IMG/M |
| 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Host-Associated | Open in IMG/M |
| 3300021374 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08 | Environmental | Open in IMG/M |
| 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Host-Associated | Open in IMG/M |
| 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Host-Associated | Open in IMG/M |
| 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Host-Associated | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022532 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300022720 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024317 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK01 | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
| 3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
| 3300026490 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-A | Environmental | Open in IMG/M |
| 3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300027071 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027074 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF014 (SPAdes) | Environmental | Open in IMG/M |
| 3300027583 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027635 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027667 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027684 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027701 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027706 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027815 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300030997 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-3B (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030998 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-3A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031022 | Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A3_MS_spring Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300031023 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil TCEFA (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031058 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031122 | Oak Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031421 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300033233 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| N55_03981850 | 2189573000 | Grass Soil | MQRGVPMRDFVADWKKWSRAERVLAGIVILLTVALPLGFLMTG |
| JGI1357J11328_100145685 | 3300000574 | Groundwater | MRDWVSDWKRWTRAERILALLVAALLVALPLSIVVTGSGV* |
| JGI1357J11328_101207322 | 3300000574 | Groundwater | MSDWAADWKKWSQVERVLAVLIAVMLVAVPLGLLLTGVARV* |
| A2165W6_10762821 | 3300001334 | Permafrost | MRDLVADWKRWSRSERLLAVIVTVLMVAVPLGLMITARAGV* |
| JGI12053J15887_100450793 | 3300001661 | Forest Soil | MRDWIADWNKWSRAERVLALLVTFVLLALPLGLLLTGKAGV* |
| JGI12053J15887_103144971 | 3300001661 | Forest Soil | MRDLVADWKKWSRAERVLAVVVTVLLVAVPIGLR* |
| JGIcombinedJ26739_1009541593 | 3300002245 | Forest Soil | MRDLVADWNKWSAAERVLAVIVTLLLAMVPLGLLMTGNSGIQLQSTL* |
| JGIcombinedJ26739_1014205822 | 3300002245 | Forest Soil | MRDLVADWNKWSAAERVLAVIVTLLLAMVPLGLLITGKSGI* |
| C688J35102_1209231781 | 3300002568 | Soil | VRDWVADWNKWSRAERVLAVVVTVLLAALPLSLLITGKLAG* |
| JGIcombinedJ51221_101560492 | 3300003505 | Forest Soil | VRDWVADWNKWSRGERVLAIVVTLVLAALPLSLAIAGGAGG* |
| Ga0063454_1003638813 | 3300004081 | Soil | VRDWVADWNKWSRGERLLAVLVTVLLAALPFSLLISGRLAG* |
| Ga0062593_1006733193 | 3300004114 | Soil | VPQGLTMRDFVADWKRWSRTERVLAVLVTLVLVALPLGLLVTAKGGV* |
| Ga0062593_1022846612 | 3300004114 | Soil | MRDWIADWNKWSRAERVLALLVTLILLALPLSLLITAKTGV* |
| Ga0062386_1014367501 | 3300004152 | Bog Forest Soil | MQRGVPMRDFVADWKKWSRAERVLAGMVILLMVALPLGLLMTG* |
| Ga0062590_1006264163 | 3300004157 | Soil | MRDFVADWNKWSRTERVLAVLVTLMLVALPLGALTGKPGV* |
| Ga0066398_102054951 | 3300004268 | Tropical Forest Soil | MQRGVPMRDFVADWKKWSRAERVLAVMIILLMVALPVGVLMTD* |
| Ga0063356_1018600012 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MRDFVADWKKWSRTERVLAVLVTLMLVALPLGLLLTGKTGV* |
| Ga0063356_1020266781 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MRDFIADWNKWSRAERVLAVLVTLTLVALPLGLLLTGKTGV* |
| Ga0062595_1024272481 | 3300004479 | Soil | MRDWVADWNKWSHAERVLALLVTLILLALPLSLLITAKTGV* |
| Ga0066395_101351581 | 3300004633 | Tropical Forest Soil | MAWPMRDLVADWKKWSRAERVLAVMVTLLMAALPLGLLMTG* |
| Ga0062591_1017605132 | 3300004643 | Soil | MRDVVADWKKWSRTERVLAVVVTLLLVALPLGVLLTGKTGV* |
| Ga0066672_100856062 | 3300005167 | Soil | MRDWIADWNKWSRAERVLALLVTFMLLALPLGLLITGKAGV* |
| Ga0066672_102341892 | 3300005167 | Soil | MRDWVADWNKWSRAERVLAVLVTFVLLALPLGLLITGKAGV* |
| Ga0066672_103943731 | 3300005167 | Soil | MRDWIADWNKWSRAERVLALLVTLILLALPLSLLISAKTGV* |
| Ga0066672_106888581 | 3300005167 | Soil | MRDMVADWKKWSRAERVVAVLVTALMVGLPLGLMLAASVGV* |
| Ga0066677_105453851 | 3300005171 | Soil | MRDWIADWNKWSRAERVLAFVVTLMLLALPLGLLISSKTGI* |
| Ga0066683_106237761 | 3300005172 | Soil | DMVADWKKWSRAERVFAVLVTALMVGLPLGLMLAATVGV* |
| Ga0066690_102608762 | 3300005177 | Soil | MRDMVADWKKWSRAERVFAVLVTALMVGLPLGLMLAATVGV* |
| Ga0066388_1006433831 | 3300005332 | Tropical Forest Soil | MQDGVPMRDLIADWKKWSRGERALAVMGTLLMVALPLGLLMTG* |
| Ga0066388_1008121132 | 3300005332 | Tropical Forest Soil | MRDWIADWNKWSRAERVLALLVTLILLALPLSLLITGKTGV* |
| Ga0066388_1048776792 | 3300005332 | Tropical Forest Soil | MRDFAADWKKWSRTERVLAVLVTLLLVALPLGLLLTGKTGV* |
| Ga0070666_105004382 | 3300005335 | Switchgrass Rhizosphere | MRDFVADWNKWSRTERVLAVLVTLMLVALPLGILLTGKTGI* |
| Ga0070680_1013666931 | 3300005336 | Corn Rhizosphere | MRDLLADWNRWSRTERVLAVLMMLMLAALPLGILLTGKTGV* |
| Ga0070682_1001622432 | 3300005337 | Corn Rhizosphere | MGAAGNWSMRDFVADWKKWSRTERVLAVLMTLMLVALPLGLLLTGKAGV* |
| Ga0068868_1009790682 | 3300005338 | Miscanthus Rhizosphere | MQDWKADWNRWSRAERVLAVLMAFMLVALPLGFLLSSLRPGA* |
| Ga0070675_1000894434 | 3300005354 | Miscanthus Rhizosphere | LVGVTVSTMQDWKADWNRWSRAERVLAVLMAFMLVALPLGFLLSSLRPGA* |
| Ga0070709_112580962 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MRDWIADWNKWSRTERVLALLVTFVLLALPLSLLLTGKAGV* |
| Ga0070713_1009176002 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MRDLVADWNRWSAAERMLAVIVTLLLAMVPLGLLMTGQSGI* |
| Ga0070708_1012902501 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MQHGVSMRDLAADWKKWSRAERVLAVMVTLLMVALPLGLLMNG* |
| Ga0070681_101337495 | 3300005458 | Corn Rhizosphere | MQDFVADWKKWSRTERVLALVVTGTLLALPLSFLLSTKAGV* |
| Ga0070681_107202062 | 3300005458 | Corn Rhizosphere | MRDVVADWKKWSRTERLLAVLMTLILVALPLGLLLTGKAGV* |
| Ga0070698_1010401522 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MRDWIADWNKWSRAERVLALLVTFMLLALPLGLLMTGKAGV* |
| Ga0073909_101478581 | 3300005526 | Surface Soil | MRDLVADWKRWSRSERLLAVIVTVLIVAVPLGLMITARAGV* |
| Ga0070735_100340864 | 3300005534 | Surface Soil | MRDWVADWNRWSRGERVLALLVATALFALPLGMLLTAAKAGV* |
| Ga0070684_1014735812 | 3300005535 | Corn Rhizosphere | MRDFVADWNKWSRTERVLAVLVTLMLVALPLGILLTGKTG |
| Ga0070731_102487404 | 3300005538 | Surface Soil | MHDLIADWKRWSRAERALAVILTLTMVALPLGLLLAATGSGI* |
| Ga0070731_110419401 | 3300005538 | Surface Soil | ADWKKWSRAERVFAVLVTVLMVALPLGLMLAATVGV* |
| Ga0070733_102616052 | 3300005541 | Surface Soil | MRDWVADWKKWSRSERALAVLVTGLMVALPLGLLLAA* |
| Ga0070695_1007822371 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | GVFAGRDLVADWKKWSRAERILAVVGTLLRVALPFGLLMTG* |
| Ga0070665_1007393072 | 3300005548 | Switchgrass Rhizosphere | NGSMRDFVADWNKWSRTERVLAVLVTLMLVALPLGMLLTGKTGV* |
| Ga0066704_104324371 | 3300005557 | Soil | MRDWVADWNKWSRAERVLAVLVTFVLLALPLGLLITGK |
| Ga0066704_108006541 | 3300005557 | Soil | MRDLAADWKKWSRAERVLAVMVTLLMVALPLGLLMNG* |
| Ga0066670_105606132 | 3300005560 | Soil | MRDLVADWKRWSRAERVLAVVVTVMMVALPLGLLLTGKTGI* |
| Ga0066708_104047622 | 3300005576 | Soil | MRDWIADWNKWSRAERVLALLVTFMLLALPLGLLMTGKAGI* |
| Ga0068857_1013846651 | 3300005577 | Corn Rhizosphere | DWKKWSRTERVLAVLMTLMLVALPLGLLLTGKAGV* |
| Ga0066654_103984872 | 3300005587 | Soil | MRDFVADWNKWSPAERVLAVMVILLMVALPAGLLMTG* |
| Ga0070740_100478693 | 3300005607 | Surface Soil | MRDFAADWKRWSRFERLFAVLLALTLIALPLSLVLTAIPGS* |
| Ga0068856_1018379282 | 3300005614 | Corn Rhizosphere | MRDFVADWKRWSRTERVLAVLVTLVLVALPLGLLVTAKGGV* |
| Ga0066903_1010408422 | 3300005764 | Tropical Forest Soil | MQHGVPMRDLVADWKKWSSAERVLAVMGTLLMVALPLGLLITG* |
| Ga0066903_1014439292 | 3300005764 | Tropical Forest Soil | MRDMGVPMRDLVADWKKWSRAERVLAVMVTLLMAALPLGLLMTG* |
| Ga0066903_1037597141 | 3300005764 | Tropical Forest Soil | MRDWIADWNKWSRAERVLALLVTLILLALPLSLLITGKAGV* |
| Ga0066903_1041675552 | 3300005764 | Tropical Forest Soil | MQRGVPMRDFVADWKKWSRAERVLAVIIILLMVTLPVGVLMTG* |
| Ga0081455_110366532 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MRDFTADWKKWSRAERVLALVVAVTLIALPLSFLLTAPRPGI* |
| Ga0070717_110855211 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MRDLLADWNKWSAAERVLAAILTLLLAMVPLGLVMTGNSGI* |
| Ga0070717_111113521 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MRDWVADWNKWSRAERVLAVLVTFVLLALPLGLLITGKTGV* |
| Ga0070717_113127831 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MRDLVADWKKWSRAERVLAVVVTVLLAAMPIGLR* |
| Ga0075015_1007539712 | 3300006102 | Watersheds | MRDWVADWKRWSRSERALAVFVTVLMVAVPLGLLLAAKAGV* |
| Ga0070716_1018593372 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | AQLRADPNAAVPVRDFVADWKKWSPAERVLAVMVTLSMVALPLGLLMTG* |
| Ga0070712_1020330882 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MRDWVADWKKWSRGERLLAVFVTGLMAAFPLGLLLAATVGV* |
| Ga0070765_1009252622 | 3300006176 | Soil | MRDWIADWNKWSRAERLLALLVTFILLALPLSLLITGKAGI* |
| Ga0070765_1016335091 | 3300006176 | Soil | MQRGVPMRDFLADWKKWSRAERVLAGMVILLMVALPLGLLMTG* |
| Ga0074049_109434251 | 3300006580 | Soil | MRDLVADWKRWSRTERLLAVIVTVLMVALPLGLLLTTRAGV* |
| Ga0066665_107359493 | 3300006796 | Soil | MRDWVADWNKWSRAERALAVLVTFVLLALPLGLLITGKAGV* |
| Ga0066660_110074262 | 3300006800 | Soil | CDLVADWKKWSRTERVLAIGVTLMLVALPLGLLLSGKAGV* |
| Ga0075425_1029143812 | 3300006854 | Populus Rhizosphere | MRDMVADWNKWSRAERVFAVLVTCLMVALPLGLMTRI* |
| Ga0073928_1000041975 | 3300006893 | Iron-Sulfur Acid Spring | MRDWVADWKKWTRRERVLAVFVTILMVGLPIGLLLVASVGV* |
| Ga0073928_100040459 | 3300006893 | Iron-Sulfur Acid Spring | MRDWIADWNKWSRAERVLALVVTFVLLALPLGLLITGKAGV* |
| Ga0073928_100274964 | 3300006893 | Iron-Sulfur Acid Spring | MRDWVSDWNRWSRGERLLALIVALSMFALPLSLLLTGAKPGI* |
| Ga0079219_104857632 | 3300006954 | Agricultural Soil | ADWNKWSRAERVLALLVTLILLALPLSLLITAKTGV* |
| Ga0099793_106579211 | 3300007258 | Vadose Zone Soil | MRDMVADWKKWSRAERVFAVLVTFLMVALPLGLMLVATVGV* |
| Ga0099794_107386711 | 3300007265 | Vadose Zone Soil | MRDWVADWKKWNRAERILAVLVTFVLLALPLGLLITGKAGV* |
| Ga0099795_102829111 | 3300007788 | Vadose Zone Soil | MRDWIADWNKWSRAERVLALLVTLILLALPLSLLITAKT |
| Ga0099795_103876292 | 3300007788 | Vadose Zone Soil | GAPMRDLVADWNKWSAAERVLAVILTLLLAMVPLGLVMTRKSGI* |
| Ga0104323_1269613 | 3300007821 | Soil | MRDLLADWKRWSRSERLLAVVVTVLMVALPLGLLLAAKSGV* |
| Ga0099829_100459851 | 3300009038 | Vadose Zone Soil | MVADWKKWSRAERVSAVLVMIVMAAVPLGSMLAAVIGV* |
| Ga0099829_104325573 | 3300009038 | Vadose Zone Soil | MRDWVADWKRWSRGERVLAVVVTGLMVALPLGFLLATKAGV* |
| Ga0099829_104406933 | 3300009038 | Vadose Zone Soil | MRDIVADWKKWSRAERVFAVLVTVLMVALPLGLMLVATVGV* |
| Ga0099829_105523361 | 3300009038 | Vadose Zone Soil | MRDLVADWRRWSRTERVLAVIVTVLMVALPLGLLLSTHAGV* |
| Ga0099830_105478502 | 3300009088 | Vadose Zone Soil | MRDWVADWKRWSRGERVLAVVVTGLMVALPLGFLLATKGGV* |
| Ga0099830_116147712 | 3300009088 | Vadose Zone Soil | MRDLAADWKKWSRGERVLAVLVTLLMVGVPLGLLLATVGV* |
| Ga0099828_101292562 | 3300009089 | Vadose Zone Soil | MRDIVADWKKWSRAERVFAVIVTFLMVALPLGLMLVATVGV* |
| Ga0099828_103791292 | 3300009089 | Vadose Zone Soil | MRDWVADWKKWSRAERILALLVTFVLLALPLGLLITGKAGV* |
| Ga0099827_100664363 | 3300009090 | Vadose Zone Soil | MRDIVADWKKWSRVERVFAVLVTFLMVALPLGLMLVATVGV* |
| Ga0099827_101628983 | 3300009090 | Vadose Zone Soil | MRDMVADWKKWSRAERVSAVLVMIVMAAVPLGSMLAAVIGV* |
| Ga0099827_104289432 | 3300009090 | Vadose Zone Soil | MRDLVADWKRWSRTERVLAVIVTVMMVALPLGLLLTTRAGV* |
| Ga0099827_105954063 | 3300009090 | Vadose Zone Soil | MRDMVADWKKWSRAERVFAVLVTCLMVALPLGLMLVATVGV* |
| Ga0099827_110873022 | 3300009090 | Vadose Zone Soil | MVADWKKWSRAERVFAVLVTFLMVALPLGLMLVATVGI* |
| Ga0105240_112461072 | 3300009093 | Corn Rhizosphere | MRDWIADWRRWSRAERIFAIIVMVGMIALPLGLLLTGTAGV* |
| Ga0111539_100625274 | 3300009094 | Populus Rhizosphere | MRDFVADWKKWSRTERVVAVVVTLMLVALPLGLLLTGKAGV* |
| Ga0066709_1006261763 | 3300009137 | Grasslands Soil | MRDIVSDWNKWSRGERVLAVVVTLLMVGLPLGLLLATVAV* |
| Ga0066709_1007515933 | 3300009137 | Grasslands Soil | MHDFVADWKKWSRGERVLAILVTGMLVLLPLGLLISGKGV* |
| Ga0066709_1018665771 | 3300009137 | Grasslands Soil | MRDVVADWKKWSRTERVLAVIVTMLMVAVPLGLLLTGQAGI* |
| Ga0066709_1022774761 | 3300009137 | Grasslands Soil | MRDFVADWNKWSPAERVLEVMVILLMVALPAGLLMTG* |
| Ga0099792_102822382 | 3300009143 | Vadose Zone Soil | MQHGVPMRDLVADWKKWSRAERVLAVMGTLLMVALPFGLLMTG* |
| Ga0105243_113435081 | 3300009148 | Miscanthus Rhizosphere | EWPMRDFVADWNKWSRTERVLAVLVTLMLVALPLGML* |
| Ga0111538_112393522 | 3300009156 | Populus Rhizosphere | MRDFLADWKKWSRTERLLAVVMTLMLVALPLGLLLTGKAGV* |
| Ga0105248_132834841 | 3300009177 | Switchgrass Rhizosphere | MRDFVADWNKWSRAERVLAVLVTLMLVALPLGML* |
| Ga0116224_103316542 | 3300009683 | Peatlands Soil | MRDLMADWKRWSRAERVFAVLVTLLMIALPLGLMLAASV* |
| Ga0126307_102179791 | 3300009789 | Serpentine Soil | MRDLVADWNRWSRAERVLAVVVTMLMVALPLGLLITGRAGI* |
| Ga0126307_105742033 | 3300009789 | Serpentine Soil | MRDLVADWNRWSRAERVLAVVVTMLMVALPLGLLITGKAGI* |
| Ga0126374_105593973 | 3300009792 | Tropical Forest Soil | DLVADWKKWSRAERVLAVMGTLLMVALPLGLLMTG* |
| Ga0126374_113037771 | 3300009792 | Tropical Forest Soil | MQRGVPMRDFVADWKKWSRAERVLAVMIILLMVALPVGVLMTG* |
| Ga0126374_115629801 | 3300009792 | Tropical Forest Soil | MRDFAADWKKWSRAERVLALAVAFTLIALPLSLLFLSGPGPGI* |
| Ga0126304_101908903 | 3300010037 | Serpentine Soil | MRDLVADWKRWSRAERVLAVVVTMLMVALPLGLLITGKAGI* |
| Ga0126315_104513641 | 3300010038 | Serpentine Soil | MRDLVADWKKWSRAERVLAVVVTMLMVALPLGLLITGRAGI* |
| Ga0126315_107751461 | 3300010038 | Serpentine Soil | MRDWITDWNKWSRAERVLALLVTFMLLALPLGLLMTGKAGV* |
| Ga0126308_113125571 | 3300010040 | Serpentine Soil | VRDWVSDWNKWSRGERVLAVVVTVLLAALPLSLVITGKLAG* |
| Ga0126312_107331092 | 3300010041 | Serpentine Soil | ADWNKWSRAERVLAVVVTVLLAALPLSLLVTGKLAG* |
| Ga0126380_103178061 | 3300010043 | Tropical Forest Soil | MQDGVPMRDLVADWKKWSRAERVLAVMGTLLMVALPLGLLMTG* |
| Ga0126380_117550742 | 3300010043 | Tropical Forest Soil | MQRGVPMRDFVADWKKWSRAERVLAMMIILLMVALPVGVLMTG* |
| Ga0126310_102535433 | 3300010044 | Serpentine Soil | VRDWVADWNKWSRGERVLAVVVTVLLAVLPLSLLITGKLAG* |
| Ga0126384_103936092 | 3300010046 | Tropical Forest Soil | MQHGVPMRDLVADWKKWSRAERVLAVMGSLLIVALPLGLLITG* |
| Ga0126384_123254671 | 3300010046 | Tropical Forest Soil | MSGSKFNMAWPMRDLVADWKKWSRAERMLAVVVTLLMVALPLRLLMTD* |
| Ga0126373_101859201 | 3300010048 | Tropical Forest Soil | MGVPMRDLVADWKKWSRAERVLAVMVTLLMAALPLGLLMTG* |
| Ga0126373_105248332 | 3300010048 | Tropical Forest Soil | MQSGVQRRDFVVDWKKWNRAERVPAVMMVALRLGLLKTG* |
| Ga0126373_106394232 | 3300010048 | Tropical Forest Soil | MSGSKFNMAWPMRDLVADWKKWSHAERMLAVVVTLLMVALPLRLLMTG* |
| Ga0126373_110057611 | 3300010048 | Tropical Forest Soil | MQHGVPMRDLVADWKKWTRAERVLAVMGAVLLVALPLGLLITG* |
| Ga0126320_11460932 | 3300010146 | Soil | RDWIADWNKWSRAERVLALLVTLILLALPLSLLITAKTGV* |
| Ga0134067_100319051 | 3300010321 | Grasslands Soil | MRDWIADWKKWSRAERVLALLVTLILLALPLSLLISAKTGV* |
| Ga0134086_104658442 | 3300010323 | Grasslands Soil | ADWNKWSRAERVLALLVTLILLALPLSLLISAKTGV* |
| Ga0134064_104379771 | 3300010325 | Grasslands Soil | WIADWNKWSRAERVLALLVTLILLALPLSLLITAKTGV* |
| Ga0126370_104666862 | 3300010358 | Tropical Forest Soil | MQHGVPMRDLVADWKKWSRAERVLAVMGSLLMVALPLGLLMTG* |
| Ga0126370_110643793 | 3300010358 | Tropical Forest Soil | MGVPMRDLVADWKKWSRAERVLAVMVTLLMVALPLGLLMTG* |
| Ga0126370_123353921 | 3300010358 | Tropical Forest Soil | MQHGVPMRDLVADWKRWSRAERVLAVMGTLLLVALPLGLLTTG* |
| Ga0126370_126518061 | 3300010358 | Tropical Forest Soil | MTWACENADLVADWKKWSHAERALAVMLTLLMIALPLGLLMTG* |
| Ga0126376_116338671 | 3300010359 | Tropical Forest Soil | MRDLVADWKRWSRAERVSAVMGTLLLVALPLGLLTTG* |
| Ga0126376_121785532 | 3300010359 | Tropical Forest Soil | RDLVADWKKWSPAERVLAAMGTLLMVSLPLGLLMTG* |
| Ga0126376_124672331 | 3300010359 | Tropical Forest Soil | MQHGVPMRDLVADWKKWSRAERVLAVMGTLLMVALPLGLLMTG* |
| Ga0126372_111099111 | 3300010360 | Tropical Forest Soil | MSGSKFNMAWPMRDLVADWKKWSRAERMLAVVVTLLMVALPLRLLMTG* |
| Ga0126378_100713462 | 3300010361 | Tropical Forest Soil | MQHGVPMRDLVADWKKWSRTERVLAVMGTLLMVALSLGLLITR* |
| Ga0126378_127653371 | 3300010361 | Tropical Forest Soil | HGVPMRDLVADWKKWSRAERVIAVMCTLLMVALPLGLLMTG* |
| Ga0126379_108811381 | 3300010366 | Tropical Forest Soil | MQHGVPMRDLVSGLQRWNREERVLAVMGTLLLVALPFGLLTTG* |
| Ga0126379_135273231 | 3300010366 | Tropical Forest Soil | MRDFVADWKKWSRAERVLAVIVVSLMVALPLGLLLTGKAT* |
| Ga0126381_1008884871 | 3300010376 | Tropical Forest Soil | RGVPMRDFVADWKKWSRAERVLAVMIILLMVALPVGVLMTD* |
| Ga0126381_1013206102 | 3300010376 | Tropical Forest Soil | MQREVPMRDLVADWKKWNSAERVLAVMVILLMVAWPLGLLMTG* |
| Ga0126381_1016664382 | 3300010376 | Tropical Forest Soil | MQHGVPMRDLVADWRKWSRAERILAVMGSLLMVAL |
| Ga0136449_1035568592 | 3300010379 | Peatlands Soil | MRDWLADWKKWSRSERVLAVCVTFAMVALPLGLLLGA* |
| Ga0136449_1045593642 | 3300010379 | Peatlands Soil | MRDLVADWKRWSRAERVFAVFVTLLMVALPLGLMLAASV* |
| Ga0136847_116936813 | 3300010391 | Freshwater Sediment | MRDWVADWKRWSRSERALAVLVTVLMVAVPLGLLLAAKVGV* |
| Ga0134126_104565012 | 3300010396 | Terrestrial Soil | MRDWVADWNKWSRAERVLALLVTLILLALPLSLLITAKTGV* |
| Ga0126383_103729713 | 3300010398 | Tropical Forest Soil | MRDLVADWKKWSRAERVLAVMGTLLMVALPLGLLMTG* |
| Ga0126383_110203421 | 3300010398 | Tropical Forest Soil | MRDLVADWKKWSRAERVLAVTGTLLMVASPLGLLITL* |
| Ga0126383_115753662 | 3300010398 | Tropical Forest Soil | MQHGVPMRNLVADWKKWSRAERVLAMMGTLLVVALPLGLLMLD |
| Ga0126383_127227742 | 3300010398 | Tropical Forest Soil | MQHGVPMRDLVADWKRWSRAERVLAVMGTLLLVALPFGLLTTG* |
| Ga0134121_107123012 | 3300010401 | Terrestrial Soil | MRDFVADWNKWSRTERVLAVLVTLMLVALPLGML* |
| Ga0137392_102378672 | 3300011269 | Vadose Zone Soil | MRDMVADWKKWSRAERVFAVLVTVLMVALPLGLMLVATVGV* |
| Ga0137392_102985852 | 3300011269 | Vadose Zone Soil | MVADWKKWSRAERVFAVLVTFLMVALPLGLMLVATVGV* |
| Ga0137392_116360491 | 3300011269 | Vadose Zone Soil | MRDMVADWKKWSRAERIFAVLVTFLMIALPLGLMLAVSVGV* |
| Ga0137391_109952902 | 3300011270 | Vadose Zone Soil | MRDLVADWRRWSRTERVLAVIVTVLMVALPLGLLLTTRAGV* |
| Ga0137455_11800331 | 3300011429 | Soil | MRDLMADWKRWSHSERVLAVLVTFLMVAVPLGVLLTARASV* |
| Ga0137433_10170334 | 3300011440 | Soil | MRDLVADWKRWSRTERVLAVVVTVLMVVLPIGLLLTGKAGI* |
| Ga0137452_11663791 | 3300011441 | Soil | MRDLVADWKRWSRTERLLAVIVTVLMVALPLGLLLTTRVGV* |
| Ga0137463_11181803 | 3300011444 | Soil | MRDLVADWKRWSRTERLLAVIVTVLMVALPLGLLLTARVGV* |
| Ga0137463_12907981 | 3300011444 | Soil | MRDLVADWKRWSRTERLLAVIVTVLMVALPLGLLLTARAGV* |
| Ga0120148_10198404 | 3300011999 | Permafrost | MRDLVADWKRWSRSERLLAVIVTVLMVAVPLGLLFTARVGV* |
| Ga0137389_100852744 | 3300012096 | Vadose Zone Soil | MRDFVADWKRWSCAERVLAVVVTVLMVALPLALLLAGRLV* |
| Ga0137399_113163101 | 3300012203 | Vadose Zone Soil | MCDLVADWKKWSRAERVLAVVVTVLLVAVPIGLR* |
| Ga0137380_105605502 | 3300012206 | Vadose Zone Soil | MRDLVADWKRWSRAERVLAVLVTVLMVALPLGLLLTGKAGI* |
| Ga0137380_112688842 | 3300012206 | Vadose Zone Soil | MRDMVADWKKWSRAERVFAVLVTVLMVALPLGLMLVATVGI* |
| Ga0137381_107927192 | 3300012207 | Vadose Zone Soil | MRDIVADWKKWTRAERVFAVLVSFLMVALPLGLMLVATVGV* |
| Ga0137376_107014462 | 3300012208 | Vadose Zone Soil | MRDLVADWNKWSAAERVLAVILTLLLAMVPLGLVMIGKSRI* |
| Ga0137379_106043832 | 3300012209 | Vadose Zone Soil | RDMVADWKKWSRAERVFAVLVTVLMIALPLGLMLVGSIGI* |
| Ga0137378_100449176 | 3300012210 | Vadose Zone Soil | MRDMVADWKKWSRAERVSAVLVMIVMAAVPFGSMLAAVIGV* |
| Ga0137378_114399302 | 3300012210 | Vadose Zone Soil | MRDIVADWKKWSRAERVFAVVVTFLMVALPLGLMIVASVGV* |
| Ga0137378_116550831 | 3300012210 | Vadose Zone Soil | MRDWVADWKKWNRAERILAVLVTFVLLALPLGLLITGKTGV* |
| Ga0137377_111048443 | 3300012211 | Vadose Zone Soil | WKKWNRAERILAVLVTFVLLALPLGLLITGKAGV* |
| Ga0150985_1001952882 | 3300012212 | Avena Fatua Rhizosphere | VLPVRDWVADWNKWSRGERVLAVLVTVLLAALPFSLLISGRLAG* |
| Ga0150985_1071104122 | 3300012212 | Avena Fatua Rhizosphere | MRDFVADWNRWSRGERVLAVLVTLMLAALPLGLLLTGKAGV* |
| Ga0137372_102594033 | 3300012350 | Vadose Zone Soil | MRDVVADWKKWSRAERVFAVLVTVLMVALPLGLMLVGSIGI* |
| Ga0137386_101227662 | 3300012351 | Vadose Zone Soil | MRDMVADWKKWSRTERVSAVLVMIVMAAVPLGSMLAAVIGV* |
| Ga0137386_110110711 | 3300012351 | Vadose Zone Soil | DWKKWSRAERVFAVLVTVLMVALPLGLMLVRSVGV* |
| Ga0137366_101392013 | 3300012354 | Vadose Zone Soil | MRDMRDMVADWKKWSRAERVFAVVVTFLMVALPLGLMIVASVGV* |
| Ga0137384_106737552 | 3300012357 | Vadose Zone Soil | MVADWKKWSRAERVFAVVVTFLMVALPLGLMIVASVGV* |
| Ga0137385_101208482 | 3300012359 | Vadose Zone Soil | MRDMVADWKKWSRTERVSAVLVMIVMAAVPFGSMLAAVIGV* |
| Ga0137385_104399182 | 3300012359 | Vadose Zone Soil | MVADWKKWSRAERVFAVLVTVLMVALPLGLMLVATVGI* |
| Ga0137385_105161752 | 3300012359 | Vadose Zone Soil | MRDIVADWKKWTRAERVFAVLVTFLMVALPLGLMLVATVGV* |
| Ga0137375_113004032 | 3300012360 | Vadose Zone Soil | MRDLVADWKRWSRAERVLAVVVTVLMVALPIGFLFTGKPGI* |
| Ga0137360_107852911 | 3300012361 | Vadose Zone Soil | MRDMVADWKKWTRAERVFAVLVTFLMVALPLGLMLVATVGV* |
| Ga0137390_103232373 | 3300012363 | Vadose Zone Soil | MRDMVADWKKWSRAERVSAVLVMIVMAAFPLGSMLAAVIGV* |
| Ga0137358_110740731 | 3300012582 | Vadose Zone Soil | MQRGVPIHDFFADWKKWSRAERVLAGMVILLMVALPL |
| Ga0137398_107088271 | 3300012683 | Vadose Zone Soil | MRDFTADWKKWSRAERVLALVVAFTLLALPLSLLLVVTRPVP* |
| Ga0137394_104764612 | 3300012922 | Vadose Zone Soil | MQHGVSMRDLAADWKKWSRPERVLAVMVTLLMVALPLGLLMNG* |
| Ga0137394_108626013 | 3300012922 | Vadose Zone Soil | MRDLVADWKRWSRAERVLAVVVTVLMVALPLGLLFTGKA |
| Ga0137419_106005202 | 3300012925 | Vadose Zone Soil | MRDFTDFTADWKKWSRAERVLALLVAFALLALPLSLLLIGTKPGI* |
| Ga0137419_114759222 | 3300012925 | Vadose Zone Soil | MRDWIADWSKWSRAERVLALLVTLILLALPLSLLITAKTGV* |
| Ga0137416_102962731 | 3300012927 | Vadose Zone Soil | WWLDMRDWIADWNKWSRAERVLALLVTLILLALPLSLLITAKTGV* |
| Ga0126369_100465233 | 3300012971 | Tropical Forest Soil | MQHGVAMRDLVADWKRWSRAERVSAVMGTLLLVALPLGLLTTG* |
| Ga0126369_102248202 | 3300012971 | Tropical Forest Soil | MSGSRFNMAWPMRDLVADWKKWSRAERMLAVVVTLLMVALPLRLLMTG* |
| Ga0126369_104073303 | 3300012971 | Tropical Forest Soil | MGVPMRDLVADWKKWSRAERVLAVMVTLPMAALPLGLLMTG* |
| Ga0134110_104059602 | 3300012975 | Grasslands Soil | DGGWNMRDWIADWNKWSRAERVLALLVTLILLALPLSLLITAKTGV* |
| Ga0134087_100407161 | 3300012977 | Grasslands Soil | LDMRDWIADWNKWSRAERVLALLVTLILLALPLSLLISAKTGV* |
| Ga0157378_106195773 | 3300013297 | Miscanthus Rhizosphere | MRDFVADWNKWSRTERVLAVLVTLMLVALPLGMLLTGKTGV* |
| Ga0182008_100656903 | 3300014497 | Rhizosphere | MRDLVADWKKWSPAERILAVVVTILIIAVPLGVLLTGKLAV* |
| Ga0182024_100154634 | 3300014501 | Permafrost | MRDMIADWKRWSRAERAFAVLVTLAMVALPLGLMLAASVGV* |
| Ga0120104_10512832 | 3300014829 | Permafrost | MRDLVADWKRWSRTERLLAVIVTVLMVAVPLGLMITARAGV* |
| Ga0137409_114794201 | 3300015245 | Vadose Zone Soil | MRDLVADWKRWSRAERVLAVVVTVLMVALPLGLLLTGKAGI* |
| Ga0132258_103154594 | 3300015371 | Arabidopsis Rhizosphere | MQDWKADWNRWSRAERVLAVLMAFLLVALPLGFLLSSLRPGA* |
| Ga0132258_104349664 | 3300015371 | Arabidopsis Rhizosphere | MRDLVADWNRWSRAERVLAVVVTVLMVALPLGLLI* |
| Ga0182036_110013212 | 3300016270 | Soil | MQHGVLMRDLVADWKKWSRAEHVLAVMGTLLMVALP |
| Ga0182041_102000471 | 3300016294 | Soil | HGVPMRDLVADWKKWSRAERVIAVMGTLLMVALPLGLLMTG |
| Ga0182033_100463922 | 3300016319 | Soil | MRDLVADWKKWSRAERVLAVMGTLLIVGLLIVALPLGLLMTG |
| Ga0182033_104749851 | 3300016319 | Soil | VASGSMQHGVPMRDLVADWKKWSRAERILAVMGTLLMAALPLGLLMTG |
| Ga0182033_108339781 | 3300016319 | Soil | LLPMRDWAADWKRWSRAERVLALVVAISLFALPLSLLLTARVGV |
| Ga0182033_110374821 | 3300016319 | Soil | HGVPMRDLVADWKKWSRAERVLAVMGTFLMVALPLGLLMTG |
| Ga0182035_103997871 | 3300016341 | Soil | MYHGVPMRDLVADWKKWSRAERVIAVMGTLLMVALRLGLLMTG |
| Ga0182032_104670551 | 3300016357 | Soil | MYHGVAMRDLVCRLLQENRAERVIAVMGTLLMVALPLGLLMTG |
| Ga0182034_111313541 | 3300016371 | Soil | VASRIMKHGVPMRDLVADWKKWSRAERVLAVMGTLLMVALPLGLLITR |
| Ga0182040_108091542 | 3300016387 | Soil | MQRGVPMRDFVADWKKWSRAERVLAVIIILLMVTLTVGVLMTG |
| Ga0182037_101180601 | 3300016404 | Soil | EGSRERSMQHGVLMRDLVADWKKWSRAEHVLAVMGTLLMVALPFGLLMTG |
| Ga0182037_103281231 | 3300016404 | Soil | AVASGSMYHGVPMRDLVADWKKWSRAERVIAVMGTLLMVALPLGLLMTG |
| Ga0182037_111492432 | 3300016404 | Soil | MRDLVADWKKWSHVERALAVMLTLLMVALPLGLLMTG |
| Ga0182039_112691971 | 3300016422 | Soil | HGVPMRDLVADWKKWSRAERVLAVMGTLLMVALPFGLLMTG |
| Ga0182038_101017721 | 3300016445 | Soil | MRYGVPMRDLVADWKKWNRAERVLAVMGTLLMVALPFGLLITR |
| Ga0182038_104078591 | 3300016445 | Soil | MRDLVADWKKWSRAERVLAVTGTLLMVALPLGLLMTG |
| Ga0187818_100014817 | 3300017823 | Freshwater Sediment | MRDMVADWKRWSRAERVFAVLVTLLMVALPLGLMLAASVGV |
| Ga0187803_104745011 | 3300017934 | Freshwater Sediment | MRDMVADWKRWSRAERVFAVLVTLLMVALPLGLMVGV |
| Ga0187783_108225872 | 3300017970 | Tropical Peatland | MRDWVADWKKWSRRERVLAVFVTILMVALPLGLLLGA |
| Ga0187783_110873302 | 3300017970 | Tropical Peatland | MRDWAADWKKWTRGERVLAVFLAILIIGVPLGLLLTAKIGV |
| Ga0187781_105536231 | 3300017972 | Tropical Peatland | MRDWVADWKKWSRSERVLAVFVTILMVALPLGFLLGA |
| Ga0187766_114546291 | 3300018058 | Tropical Peatland | MRDWVADWKKWTRSERVLAVIVSLLMVALPLGLLLTA |
| Ga0184619_101703382 | 3300018061 | Groundwater Sediment | MRDWIADWNKWSRAERVLALLVTLILLALPLSLLISAKTGV |
| Ga0187784_104744812 | 3300018062 | Tropical Peatland | MVWAMRDWVADWKKWSRRERVLAVFVTILMVALPLGLLLSA |
| Ga0184629_102249512 | 3300018084 | Groundwater Sediment | MRDLVADWKRWSRTERVLAVVVTVLMVALPLGLLLTSRAGV |
| Ga0187771_101202762 | 3300018088 | Tropical Peatland | MRDFVADWKKWSRAERVLAVAVILAMAALPLGFLLTARAI |
| Ga0187771_118719351 | 3300018088 | Tropical Peatland | MNDWLADWKKWTPVERVFAVLIAVLMVALPLGFVLAATTGV |
| Ga0066655_107242592 | 3300018431 | Grasslands Soil | VRDWVADWNKWSRGERVLAVLVTVLLAALPFSLLISGRLAG |
| Ga0066667_122162372 | 3300018433 | Grasslands Soil | TTVWLMVVDMRDWIADWNKWSRAERVLALLVTLILLALPLSLLITAKTGV |
| Ga0066662_103806421 | 3300018468 | Grasslands Soil | MRDIVADWKKWSRAERMLAVMFTLLMVALPLGLLMTG |
| Ga0066662_118907772 | 3300018468 | Grasslands Soil | MRDFVADWKKWSRAERVLAVMIILLMVALPMGVLMTG |
| Ga0190274_101737692 | 3300018476 | Soil | MRDFVADWNRWSRAERVLAVLVTLMLVALPLGLLLTGKAGV |
| Ga0066669_106370581 | 3300018482 | Grasslands Soil | RWLEMRDWIADWNKWSRAERVLALLVTFMLLALPLGLLITGKAGV |
| Ga0066669_106652662 | 3300018482 | Grasslands Soil | MRDWIADWNKWSRAERVLALLVTFMLLALPLGLLMTGKAGV |
| Ga0066669_108548571 | 3300018482 | Grasslands Soil | MRDWVADWKKWNRAERILAVLVTFVLLALPLGLLITGKAGV |
| Ga0066669_110677351 | 3300018482 | Grasslands Soil | MRDLTADWKKWSRAERALAIVVTGMMIALPLGFLAGV |
| Ga0066669_110899061 | 3300018482 | Grasslands Soil | MRDWIADWNKWSRAERVLAFVVTLMLLALPLGLLISSKTGI |
| Ga0066669_114340002 | 3300018482 | Grasslands Soil | MRDIVADWKKWSRVERVFAVLVTFLMVALPLGLMLVATVGV |
| Ga0182025_11590481 | 3300019786 | Permafrost | DWKKWSRAERVFAVLVTALMVALPLGLMLAASVGV |
| Ga0193729_11295113 | 3300019887 | Soil | MRDWVADWNKWSRAERVLAVLVTFVLLALPLGLLITGKAGV |
| Ga0193751_10153012 | 3300019888 | Soil | MRDWIADWNKWSRAERLLALLVTFILLALPLSLLITGKAGI |
| Ga0193751_10375553 | 3300019888 | Soil | MRDLVADWKRWSLSERLLAVIVTVLMVAVPLGLLLTTHAGV |
| Ga0193751_11124583 | 3300019888 | Soil | MRDLVADWKRWSRTERVLAVIVTVLMVALPLGLLLTTHAGV |
| Ga0193743_10869023 | 3300019889 | Soil | MRDFMADWKKWSRAERVLAVVVTVMMVALPLGLLITGKAGI |
| Ga0197907_113661742 | 3300020069 | Corn, Switchgrass And Miscanthus Rhizosphere | GEFNNMRDWIADWRRWSRAERIFAIIVMVGMIALPLGLLLTGTAGV |
| Ga0179592_100950263 | 3300020199 | Vadose Zone Soil | MRDWIADWNKWSRAERVLALLVTFVLLALPLGLLLTGKAGV |
| Ga0210407_100667232 | 3300020579 | Soil | MQHGVPMRDLVADWKKWSRAERVLAVMGTLLVVALLIVALPLGLLMTG |
| Ga0210407_102408502 | 3300020579 | Soil | MRDLVGDWKKWSRAERVLAVMGTLLMVALPFGLLMTG |
| Ga0210407_103224792 | 3300020579 | Soil | MVNCERIQMQRGGPMRDFVADWKKWSRAERVLAGMVILLMVALPLGLLMTG |
| Ga0210403_100619511 | 3300020580 | Soil | FGEAVASGSMQHGVPMRDLVADWKKWSRAERVFALMGTFLMVALPLGLLMTG |
| Ga0210403_108115172 | 3300020580 | Soil | MQHGVPMRDLVADWKKWSRAERVLAVMGTLLMVAV |
| Ga0210403_111984172 | 3300020580 | Soil | MRDFVADWKKWSRAERVLAGMVILLMVALPLGLLM |
| Ga0210399_100513342 | 3300020581 | Soil | MRDLVPDWKKWSRAERVLAAMGTLLMVALPFGLLMTG |
| Ga0210399_103100691 | 3300020581 | Soil | MQHGVSMRDLVADWKKWSRAERVLAVMMTLLMVALPLGLLMNG |
| Ga0210401_104810551 | 3300020583 | Soil | PMRDFLADWKKWSRAERVLAGMVILLMIALPLGLLMTG |
| Ga0210404_101811583 | 3300021088 | Soil | MRDLVADWKKWSRAERVLAVMGTLLMVALPFGLLMVALPFGLLMTG |
| Ga0210400_100037343 | 3300021170 | Soil | MRDLVADWNKWSAAERVLAVIVTLLLVMVPLGLLMTGNSGI |
| Ga0210405_113986521 | 3300021171 | Soil | MRDWIADWKKWSRAERVFAVLVTALMLSLPLGLMLAASVGV |
| Ga0210388_110742181 | 3300021181 | Soil | MRDLVGDWKKWSRAERVLAVIGTLLMVALPFGLLMTG |
| Ga0193719_103842441 | 3300021344 | Soil | MRDWIADWNKWSRAERVLALLVTLILLALPLSLLITAKTGV |
| Ga0213873_100626302 | 3300021358 | Rhizosphere | MRDWIADWNKWSRAERVLALFVTFMLLALPLGILMTGKPGI |
| Ga0213881_103222851 | 3300021374 | Exposed Rock | MRDLVADWKKWSRAERVLAVTGTLLIVALPLGLLMTG |
| Ga0213874_100944251 | 3300021377 | Plant Roots | MRDLVADWKKWSRAERLLAVIMTLLMGAALPLGLLITG |
| Ga0213876_101453482 | 3300021384 | Plant Roots | MRDWVADWQKWSRAERVLAVLVTLTLVALPLGLMLTGHAGV |
| Ga0213875_100738842 | 3300021388 | Plant Roots | MRDCVADWKKWSVGERLLALVVAALLFGLPLGLLITGGGAHAGM |
| Ga0210393_103839193 | 3300021401 | Soil | DLVADWKKWSRAERVLAVMGTLLIVALLIVALPLGLLMTG |
| Ga0210397_112967042 | 3300021403 | Soil | MRDWIADWKRWSRAERVFAVLVAALMVALPLGMLAASVGV |
| Ga0210389_105564981 | 3300021404 | Soil | MQHGVPMRDLVADWKKWSRAERVLAVMGTLLIVALLIVALPLGLLMTG |
| Ga0210387_103672432 | 3300021405 | Soil | MQHGVPMRDLAADWKKWSRAERVLAVMGTLLMVALPLGLLMTG |
| Ga0210384_113198422 | 3300021432 | Soil | MRDWVADWNKWSRAERVLAVLVTFVLLALPLGLLITGKTGV |
| Ga0210384_116138391 | 3300021432 | Soil | MRDLVADWKKWSRAERVLAVIGTLLMVALPFGLLMTG |
| Ga0210402_103920902 | 3300021478 | Soil | MRDLVADWKKWSRAERVFALMGTFLMVALPLGLLMTG |
| Ga0210409_116922891 | 3300021559 | Soil | MQRGVPMRDFLADWKKWSRAERVLAGMVILLMIALPLGLLMTG |
| Ga0126371_100358893 | 3300021560 | Tropical Forest Soil | MRDMGVPMRDLVADWKKWSRAERVLAVMVTLLMAALPLGLLMTG |
| Ga0126371_107963933 | 3300021560 | Tropical Forest Soil | AVASRPMKHGVPMRDLVADWKKWSRAERVLAVMGTLLMVALPLGLLMTG |
| Ga0126371_108218313 | 3300021560 | Tropical Forest Soil | MSGSKFNMAWPMRDLVADWKKWSRAERMLAVVVTLLMVALPLRLLMTG |
| Ga0126371_109024942 | 3300021560 | Tropical Forest Soil | MQRGVPMRDFVADWKKWSRAERVLAVIIILLMVTLPVGVLMTG |
| Ga0126371_114811831 | 3300021560 | Tropical Forest Soil | MRDIVADWKKWSRTERVLAVMGTLLIVGLLIVALPLGLLMTG |
| Ga0126371_119563382 | 3300021560 | Tropical Forest Soil | DLVADWKKWSRAERVLAVMGTLLMVALPLGLLITR |
| Ga0126371_135480931 | 3300021560 | Tropical Forest Soil | PMRDLVADWKKWSRAERVLAVMGTLLMVALPLGLLMTG |
| Ga0213853_106878801 | 3300021861 | Watersheds | MRDWVADWKRWSRSERALAVFVTVLMVAVPLGLLLAAKAGV |
| Ga0213853_114883762 | 3300021861 | Watersheds | MRDVIADWKRWSRSERLLAVIVTVLMVALPLGLLFTARVGV |
| Ga0242655_101997172 | 3300022532 | Soil | MRDLVADWKTWSRAERVLAAMGTLLMVALPFGLLMTG |
| Ga0212123_1000074423 | 3300022557 | Iron-Sulfur Acid Spring | MRDWVADWKKWTRRERVLAVFVTILMVGLPIGLLLVASVGV |
| Ga0212123_1000104250 | 3300022557 | Iron-Sulfur Acid Spring | MRDWIADWNKWSRAERVLALVVTFVLLALPLGLLITGKAGV |
| Ga0212123_100284112 | 3300022557 | Iron-Sulfur Acid Spring | MRDWVADWNRWSRGERVLALLVATALFALPLGMLLTAAKAGV |
| Ga0212123_100688062 | 3300022557 | Iron-Sulfur Acid Spring | MRDWVSDWNRWSRGERLLALIVALSMFALPLSLLLTGAKPGI |
| Ga0242672_10176641 | 3300022720 | Soil | MRDLVADWKKWSRAERVLAVMGTLLMVASPLGLLMTG |
| Ga0242654_101197752 | 3300022726 | Soil | MQHGVPMRDLVADWKKWSRAERVLAVMVTLLMVASPLGLLMNG |
| Ga0247660_10962172 | 3300024317 | Soil | MQDWKADWNRWSRAERVLAVLMAFMLVALPLGFLLSS |
| Ga0137417_13748022 | 3300024330 | Vadose Zone Soil | MRDWIADWNKWSRAERVLALLVTFVLLALPLGLLLT |
| Ga0207684_105066154 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | EGRTMRDFVADWKKWSRAERVLAVVVTVLLLVAVPIGLR |
| Ga0207707_102803832 | 3300025912 | Corn Rhizosphere | MRDLLADWNRWSRTERVLAVLMMLMLAALPLGILLTGKTGV |
| Ga0207695_105599912 | 3300025913 | Corn Rhizosphere | MRDWIADWRRWSRAERIFAIIVMVGMIALPLGLLLTGTAGV |
| Ga0207695_109041451 | 3300025913 | Corn Rhizosphere | MQDFVADWKKWSRTERVLALVVTGTLLALPLSFLLSTKAGV |
| Ga0207693_103488423 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MRDWVADWKKWSRGERLLAVFVTGLMAAFPLGLLLAATVGV |
| Ga0207660_105969252 | 3300025917 | Corn Rhizosphere | MRDVVADWKKWSRTERVLAVMMTLMLVVLPLGLLLTGKAGV |
| Ga0207659_110299341 | 3300025926 | Miscanthus Rhizosphere | MQDWKADWNRWSRAERVLAVLMAFMLVALPLGFLLSSLRPGA |
| Ga0207701_108337582 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MRDFVADWNKWSRTERVLAVLVTLMLVALPLGMLLTGKTGV |
| Ga0207639_111901472 | 3300026041 | Corn Rhizosphere | ADWKKWSRTERVLAVLMTLMLVALPLGLLLTGKAGV |
| Ga0207702_113023452 | 3300026078 | Corn Rhizosphere | MRDFVADWKRWSRTERVLAVLVTLVLVALPLGLLVTAKGGV |
| Ga0209801_11076232 | 3300026326 | Soil | MRDWIADWNKWSRAERVLALLVTFMLLALPLGLLITGKAGV |
| Ga0209804_12241181 | 3300026335 | Soil | MRDWIADWNKWSRAERVLALLVTLILLALPLSLLITAK |
| Ga0257153_10530322 | 3300026490 | Soil | MLRHSVPGAAEGKTMRDLVADWKKWSRAERVLAVVVTVLLAAMPIGLR |
| Ga0179593_10211992 | 3300026555 | Vadose Zone Soil | MRDWVADWNRWSRGERVLALLVAVALFALPLSMVLTAAKAGV |
| Ga0209214_10096372 | 3300027071 | Forest Soil | MVWLMRDLVADWKKWSRAERVLAVMGTLLMVGLPFGLLITG |
| Ga0208092_1069552 | 3300027074 | Forest Soil | MVNCERIQMQRGGPMRDFVADWKKWSRAERVLAVMGTLLMVALPFGLLMTG |
| Ga0209527_11051291 | 3300027583 | Forest Soil | DWVADWNKWSRAERVLAVLVTFVLLALPLGLLITGKAGV |
| Ga0209625_11289311 | 3300027635 | Forest Soil | MQRGGPMRDFVADWKKWSRAERVLAGMVILLMVALPLGLLMTG |
| Ga0209009_10332162 | 3300027667 | Forest Soil | VRDWVADWNKWSRGERVLAIVVTFILAAVPLSLLITASPGG |
| Ga0209626_10178072 | 3300027684 | Forest Soil | MRDLVADWNKWSAAERVLAVIVTLLLAMVPLGLLMVGKSGI |
| Ga0209447_100651901 | 3300027701 | Bog Forest Soil | MPDLVADWKKWSRAERVLAVMGTLLMVALPLGLLMTG |
| Ga0209581_11200291 | 3300027706 | Surface Soil | MRDFAADWKRWSRFERLFAVLLALTLIALPLSLVLTAIPGS |
| Ga0209726_1000022645 | 3300027815 | Groundwater | MRDWVSDWKRWTRAERILALLVAALLVALPLSIVVTGSGV |
| Ga0209726_100165762 | 3300027815 | Groundwater | MSDWAADWKKWSQVERVLAVLIAVMLVAVPLGLLLTGVARV |
| Ga0209180_102246732 | 3300027846 | Vadose Zone Soil | MRDMVADWKKWSRAERVFAVLVTFLMVALPLGLMLVATVGV |
| Ga0209167_100986752 | 3300027867 | Surface Soil | MRDWVADWKKWSRSERALAVLVTGLMVALPLGLLLAA |
| Ga0209283_101612512 | 3300027875 | Vadose Zone Soil | MVADWKKWSRAERVFAVLVTFLMVALPLGLMLVATVGV |
| Ga0209283_104931241 | 3300027875 | Vadose Zone Soil | MRDIVADWKKWSRAERVFAVIVTFLMVALPLGLMLVATVGV |
| Ga0209283_107803141 | 3300027875 | Vadose Zone Soil | MRDLAADWKKWSRGERVLAVLVTLLMVGVPLGLLLAT |
| Ga0209590_100656742 | 3300027882 | Vadose Zone Soil | MRDMVADWKKWSRAERVSAVLVMIVMAAVPLGSMLAAVIGV |
| Ga0209590_109610481 | 3300027882 | Vadose Zone Soil | MRDMVADWKKWSRAERVFAVLVTFLMVALPLGLMLVATVGI |
| Ga0209275_104809472 | 3300027884 | Soil | VRDWVADWNKWSRGERVLAIVVTLVLAALPLSLAIAGGAGG |
| Ga0209488_101191864 | 3300027903 | Vadose Zone Soil | SCRKGGAPMRDLVADWNKWSAAERVLAVILTLLLAMVPLGLVMTRKSGI |
| Ga0209488_103855252 | 3300027903 | Vadose Zone Soil | VRDWVADWNKWSRAERVLAVVVTVLLAALPLSLLITGKLAG |
| Ga0209415_1000499615 | 3300027905 | Peatlands Soil | MRDLMADWKRWSRAERVFAVLVTLLMIALPLGLMLAASV |
| Ga0207428_111961802 | 3300027907 | Populus Rhizosphere | MRDFVADWKKWSRTERLLAVVMTLMLVALPLGLLLTGKAGV |
| Ga0209526_101602372 | 3300028047 | Forest Soil | MRDLVADWKKWSRAERVLAVMGTLLMVALPLGLLMTG |
| Ga0209526_105380022 | 3300028047 | Forest Soil | MRDLVADWNKWSAAERVLAVIVTLLLAMVPLGLLITGKSGI |
| Ga0209526_106564802 | 3300028047 | Forest Soil | MRDLVADWNKWSAAERVLAVIVTLLLAMVPLGLVVTGTSGT |
| Ga0308309_116295561 | 3300028906 | Soil | GLLWEMVNCERIQMQRGGPMRDFVADWKKWSRAERVLAGMVILLMVALPLGLLMTG |
| Ga0073997_122338522 | 3300030997 | Soil | SMRDWVADWNRWSRAERVLAIVVTLMLVALPLGLLITGRAGV |
| Ga0073996_124498952 | 3300030998 | Soil | MRDWIADWNKWSRTERVLALLVTFMLLAVPLGLLMTGKVGV |
| Ga0138301_12115892 | 3300031022 | Soil | AEGRVMRDLVADWKKWSRAERVLAVVVTVLLAAVPIGLR |
| Ga0073998_110201721 | 3300031023 | Soil | RDLVADWNKWSAAERVLAVIVTLLLAMVLLGLLMTGKSGI |
| Ga0073998_116494271 | 3300031023 | Soil | GWLEMRDWIADWNKWSRTERVLALLVTFVLLALPLSLLLTGKAGV |
| Ga0170834_1013874611 | 3300031057 | Forest Soil | MRDLIADWKRWSTSERVLAILVTFLMVGVTLGLLLAGHAV |
| Ga0170834_1116281553 | 3300031057 | Forest Soil | LRDWVADWNKWSRGERGLAVVVTVLLAALPLSLLIAGGPGG |
| Ga0170834_1131258402 | 3300031057 | Forest Soil | MRDLIADWKRWSTSERVLAVVVTALMVGVPLGLLLAGHAV |
| Ga0308189_100789933 | 3300031058 | Soil | LDMRDWVADWNKWSRAERVLALLVTLILLALPLSLLITAKTGV |
| Ga0170822_161142522 | 3300031122 | Forest Soil | MRDFVADWKKWSRAERVLAVVVTLLMVAVPLVLLMTRKVGV |
| Ga0170823_173113042 | 3300031128 | Forest Soil | MRDLIADWKRWSTSERVLAVVVTALMVGVPLGLLLAGQAV |
| Ga0170824_1038281522 | 3300031231 | Forest Soil | RDLVADWKKWSRAERVLAVMGTLLMVALPFGLLMTG |
| Ga0170824_1119902933 | 3300031231 | Forest Soil | MQHGVPMRDLVADWKKWSRAERVLAVMGTLLIVALPLGLLMTG |
| Ga0170824_1152243731 | 3300031231 | Forest Soil | MRDWIADWNKWSRAERVLALLVTFILLALPLSLLITGKAGI |
| Ga0170824_1167469611 | 3300031231 | Forest Soil | VSMRDLVADWKKWSRAERVLAVMVTLLMVALPLGFLMNG |
| Ga0308194_101713202 | 3300031421 | Soil | RDWVADWNKWSRAERVLALLVTLILLALPLSLLITAKTGV |
| Ga0170820_108739311 | 3300031446 | Forest Soil | MRDLVADWKKWSRAERVLAVMVTLLMVALPLGFLMNG |
| Ga0170820_124742932 | 3300031446 | Forest Soil | MRDLVADWKKWSRAERVLAVMGTLLIVALPLGLLMTG |
| Ga0170820_131523172 | 3300031446 | Forest Soil | MRDWIADWNKWSRTERVLAVLVTFVLLALPLSLLLTGKAGV |
| Ga0170820_170939092 | 3300031446 | Forest Soil | MPMRDLVADWKKWSRAERVLAVMGTLLMVALPFGLLMTG |
| Ga0170818_1027422611 | 3300031474 | Forest Soil | MRDLVADWKKWSRAERVLAVMGTLLVVALLIVALPLGLLMTG |
| Ga0318516_101590932 | 3300031543 | Soil | MYHGVPMRDLVADWKKWSRAERVIAVMGTLLMVALPLGLLMTG |
| Ga0318516_104615312 | 3300031543 | Soil | MRDLVADWKKWSRAERVLALMGTLLMVALPLGLLMTG |
| Ga0318516_104682521 | 3300031543 | Soil | LVADWKKWSRARRVLAVMGTLLMVALPLGLLMTGRPA |
| Ga0318534_107653491 | 3300031544 | Soil | MQHGAPMRDLVADWKKWSGAERVLAVMGTLLMVAL |
| Ga0318541_100274803 | 3300031545 | Soil | MRDLVADWKKWSRAERIFALMGTLLMAALPLGLLMTG |
| Ga0318541_100367872 | 3300031545 | Soil | MRYGVPMRDLVADWKKWNRAERVLAVMGTLLMVALPLGLLITR |
| Ga0318541_100520502 | 3300031545 | Soil | VPMRDLVADWKKWSRAERVIAVMGTLLMVALPLGLLMTG |
| Ga0318541_101990422 | 3300031545 | Soil | MQHGVPMRDLVADWKKWSRAERVLAVMGTLLMVALPFGLLMTG |
| Ga0318541_103223011 | 3300031545 | Soil | MQHGVLMRDLVADWKKWSRAEHVLAVMGTLLMVALPFGLLMTG |
| Ga0318541_104949282 | 3300031545 | Soil | MGVPMRDLVADWKKWSRAERVLAVMVTLLMVALPLGLLMTG |
| Ga0318541_107132312 | 3300031545 | Soil | MGDLVADWKKWSRAERVLAVMGTLLMVALPFGLLMTG |
| Ga0318538_104706762 | 3300031546 | Soil | MYHGVPMRDLVADWKKWSRAERVIAVMGTLLMVALPLGI |
| Ga0318538_106398822 | 3300031546 | Soil | MRYGVPMRDLVADWKKWNRAERVLAVMGTLLMVALP |
| Ga0318528_107583812 | 3300031561 | Soil | RSMQHGVLMRDLVADWKKWSRAERVLAVMGTLLMVALPFGLLMTG |
| Ga0318573_106623341 | 3300031564 | Soil | SMQHGVPMRDLVADWKKWSRAERVLAVMGTLLMVALPFGLLMTG |
| Ga0310915_100298083 | 3300031573 | Soil | MYHGVAMRDLVADWKKWSRAERVIAVMGTLLMVALPLGLLMTG |
| Ga0310915_103551751 | 3300031573 | Soil | PMRDLVADWKKWSRAERVIAVMGTLLMVALPLGLLMTG |
| Ga0310915_105461762 | 3300031573 | Soil | MSDLVADWKKWSRAQRVLAVMGTLLMVALPLGLLMTGRPA |
| Ga0310915_109842752 | 3300031573 | Soil | MQHGVPMRDLVADWKKWSRAERALAVMGTLLIVALPLGLLMTG |
| Ga0318555_104038081 | 3300031640 | Soil | MQHGVLMRDLVADWKKWSRAEHVLAVMGTLLMVAL |
| Ga0318561_102146851 | 3300031679 | Soil | MQHGVPMRDLVADWKKWSRAERVPAVMGTLLMVALPLGLLITR |
| Ga0318561_104386591 | 3300031679 | Soil | MYHGVRMRDLVADWKKWSRAERVIAVMGTLLMVALPLG |
| Ga0318561_105462412 | 3300031679 | Soil | AMRDLVADWKKWSRAERIFALMGTLLMAALPLGLLMTG |
| Ga0318574_108543862 | 3300031680 | Soil | MRDLVADWKKWSRAERVIAVMGTLLMVALPLGLLMTG |
| Ga0307474_104515791 | 3300031718 | Hardwood Forest Soil | AGGDLVADWKKWSRAERILAVVGTLLRVALPFGLLMTR |
| Ga0306917_104100531 | 3300031719 | Soil | MQHGVPIRDLVADWRKWSGAERVPAVMGTLLMVALPLGLLIT |
| Ga0306917_110328261 | 3300031719 | Soil | RDLVADWKKWSRAERVIAVMGTLLMVALPLGLLMTG |
| Ga0306917_113953042 | 3300031719 | Soil | MQHGVPMRDLVADWKKWSRAERILAVMGTLLMAALPLGLLMTG |
| Ga0307469_101513773 | 3300031720 | Hardwood Forest Soil | FAGRDLVADWKKWSRAERILAVVGTLLRVALPFGLLMTG |
| Ga0307469_115696041 | 3300031720 | Hardwood Forest Soil | DLVADWKKWSRAERVLAVMGTLLIVALPLGLLMTG |
| Ga0306918_100838312 | 3300031744 | Soil | MRDLVADWKKWSRAERILALMGTLLMAALPLGLLMTG |
| Ga0306918_102776373 | 3300031744 | Soil | CDPGVPMGDLVADWKKWSRAERVLAVMGTLLMVALPFGLLMTG |
| Ga0307477_111715281 | 3300031753 | Hardwood Forest Soil | MRDIVADWKKWSRAERVIALMGIVLMVALPLGLLMIG |
| Ga0307475_104370372 | 3300031754 | Hardwood Forest Soil | MRDWAGDWKRWSRGERILAVVVALTLFALPLSLMLTARAGV |
| Ga0318509_105732111 | 3300031768 | Soil | GEAVASGSMQHGVPMRDLVADWKKWSRAERVLALMGTLLMVALPLGLLMTG |
| Ga0318566_106629792 | 3300031779 | Soil | HGVPMSDLVADWKKWSRAQRVLAVMGTLLMVALPLGLLMTGRPA |
| Ga0318576_103163341 | 3300031796 | Soil | VASGSMQHGVTMRDLVADWKKWSRAERILALMGTLLMAALTFGLLM |
| Ga0318568_105199042 | 3300031819 | Soil | MQHGVPMRDLVVDWKKWSLAERVLAVMGTLLMVALPLGLLMTG |
| Ga0307473_107879272 | 3300031820 | Hardwood Forest Soil | MQHGVPMRDLVADWKKWCRAERVLAVMGTLLMVVLPFGLLMTG |
| Ga0307478_110893821 | 3300031823 | Hardwood Forest Soil | MQHGVPMRDIVADWKKWSRAERVIALMGIVLMVALPLGLLMIG |
| Ga0318511_101158284 | 3300031845 | Soil | QHGVPMRDLVADWKKWSRAERVLAVMGTLLMVALPLGLLMTG |
| Ga0318495_102748322 | 3300031860 | Soil | MRDLVADWEKWSRAERVLAVMGTFLMVALPLGLLITR |
| Ga0306919_100101764 | 3300031879 | Soil | MQHGVLMRDLVADWKKWSRAERVLAVMGTLLMVALPFGLLMTG |
| Ga0306919_106072282 | 3300031879 | Soil | MQYGVPMRDLVADWKKWSRAERVLAVMGTLLTVALPLGLPITR |
| Ga0306919_112271962 | 3300031879 | Soil | MRDLVADWKKWSRAERVLAVMGTLLMVALPVGLLMTG |
| Ga0318544_100581903 | 3300031880 | Soil | MQHGVPMRDLVADWKKWSRAERVLALMGTLLMVALPLGLLMTG |
| Ga0318544_103925611 | 3300031880 | Soil | MYHGVPMRDLVADWKKWSRAERVIAVMGTLLMVALPLGIADDRLD |
| Ga0306925_104706561 | 3300031890 | Soil | TVCERSRMQRGVPMRDFVADWKKWSRAERVLAVIIILLMVTLPVGVLMTG |
| Ga0318536_105970801 | 3300031893 | Soil | VASGSMQHGVPMRDLVADWKKWSRAERVLALMGTLLMVALPLGLLMTG |
| Ga0318520_106929841 | 3300031897 | Soil | YHGVPMRDLVADWKKWSRAERVIAVMGTLLMVALPLGLLMTG |
| Ga0306923_118044542 | 3300031910 | Soil | MKHGVPMRDLVADWKKWSRAERVLAVMGTLLMVALPFGLLITR |
| Ga0306921_102973842 | 3300031912 | Soil | DLVVDWKKWSLAERVLAVMGTLLMVALPLGLLMTG |
| Ga0306921_105703512 | 3300031912 | Soil | LPDLLPMRDWAADWKRWSRAERVLALVVALSLFALPLSLLLTARVGV |
| Ga0306921_107531653 | 3300031912 | Soil | MQYGVPMRDLVADWKKWSRAERVLAVMGTLLMVALPLGLLITR |
| Ga0306921_120195761 | 3300031912 | Soil | MYHGVRMRDLVADWKKWSRAERVIAVMGTLLMVALPLGLLMTG |
| Ga0306921_126223711 | 3300031912 | Soil | MRDWAADWKRWSRAERVLALVVALSLFALPLSLLLTARVG |
| Ga0310916_109843361 | 3300031942 | Soil | MQHGAPMRDLVADWKKWSCAERVLAVMGTLLMVALPLGLLITR |
| Ga0310910_105790352 | 3300031946 | Soil | GVPVRDLVADWNKWSRAERVLAVMGTLLMVALPLGLLMTG |
| Ga0310910_112301941 | 3300031946 | Soil | MRDLVADWKKWSHAERALAVMLTLLMAALPIGLLMTG |
| Ga0310909_101875103 | 3300031947 | Soil | GKWIHATWRAMRDLVADWKKWSRAERILALMGTLLMAALPLGLLMTG |
| Ga0306926_104971062 | 3300031954 | Soil | MQHGVTMRDLVADWKKWSRAERILALMGTLLMAALTFGLLMTG |
| Ga0306926_109455382 | 3300031954 | Soil | MKHGVPMRDLVADWKKWSRAERVLAVMGTLLMVALPLGLLITR |
| Ga0306926_130241232 | 3300031954 | Soil | IHATWRAMRDLVADWKKWSRAERIFALMGTLLMAALPLGLLMTG |
| Ga0307479_104578642 | 3300031962 | Hardwood Forest Soil | MRDMVADWKKWSRAERVFAVLVTVLMVALPLGLMLAASVGV |
| Ga0307479_105237312 | 3300031962 | Hardwood Forest Soil | MRDLTADWKKWSRGERLLAVIVTALMFALPLGLLLAGKVGV |
| Ga0326597_100174693 | 3300031965 | Soil | MRDWLADWRKWSRSERVLAVFVTSVLVALPLGLLLAAKAGV |
| Ga0326597_103119283 | 3300031965 | Soil | VWSMRDLVADWKRWSRTERVLAVVVTVLMVALPLGLLLTGKTGT |
| Ga0318531_102557251 | 3300031981 | Soil | MRDLVADWKKWSRAERILALMGTLLMAALTFGLLMTG |
| Ga0306922_112860681 | 3300032001 | Soil | MYHGVRMRDLVADWKKWSRAERVIAVMGTLLMVALPLGL |
| Ga0318545_100317011 | 3300032042 | Soil | TMQHGVPIRDLVADWRKWSGAERVPAVMGTLLMVALPLGLLITR |
| Ga0318545_102903931 | 3300032042 | Soil | GEGSRERSMQHGVPMRDLVADWKKWSRAERVLAVMGTLLMVALPFGLLMTG |
| Ga0318558_101159922 | 3300032044 | Soil | MRDLVADWEKWSRAERVLAVMGTFLMVALPLGLLMTG |
| Ga0318506_102055631 | 3300032052 | Soil | GVPMRDLVADWKKWSRAERVIAVMGTLLMVALPLGLLMTG |
| Ga0318533_111738432 | 3300032059 | Soil | MQHGVLMRDLVADWKKWNRAERVLAVMGTLLMVALPLGLLMTG |
| Ga0308173_113110661 | 3300032074 | Soil | MRDWIADWNKWSRAERVLALLVTLILLALPLSLLVTAKTGV |
| Ga0306924_106422592 | 3300032076 | Soil | VASGSMQHGVTMRDLVADWKKWSRAERILALMGTLLMAALTFGLLMTG |
| Ga0306924_108634431 | 3300032076 | Soil | VQHGVPMRDLVADWKKWSRAERVLAVMGTLLMVALPLGLLITR |
| Ga0306924_109386453 | 3300032076 | Soil | VCERSRMQRGVPMRDFVADWKKWSRAERVLAVIIILLMVTLPVGVLMTG |
| Ga0318518_101486381 | 3300032090 | Soil | MQHGVPMRDLVADWKKWSRAERVLAVMGTLLMVALPFGLLMT |
| Ga0318518_104084762 | 3300032090 | Soil | MQHGVLMRDLVADWKKWSRAERVLAVMGTLLMVALPFG |
| Ga0318518_106749501 | 3300032090 | Soil | MQHGVPMRDLVADWKKWSRAERVLAVMGTFLMVALPLGLLITR |
| Ga0311301_129496011 | 3300032160 | Peatlands Soil | MRDLVADWKRWSRAERVFAVFVTLLMVALPLGLMLAASV |
| Ga0307471_1034489382 | 3300032180 | Hardwood Forest Soil | MRDWVADWNRWSRAERVFAVLVTFLMVALPLGLMVRV |
| Ga0307472_1014160031 | 3300032205 | Hardwood Forest Soil | MRDLVADWKKWSRAERVLAVMGTLLMVALPFGLLMTG |
| Ga0306920_1010386824 | 3300032261 | Soil | QHGVLMRDLVADWKKWSRAEHVLAVMGTLLMVALPFGLLMTG |
| Ga0306920_1013493963 | 3300032261 | Soil | MRDFVADWKKWSRAERVLAVMGTLLMVALPLGLLMTG |
| Ga0306920_1016360163 | 3300032261 | Soil | MRDWAADWKRWSRAERVLALVVALSLFALPLSLLLTARV |
| Ga0306920_1019553591 | 3300032261 | Soil | MRDLVADWKKWSGAERVLAVMGTLLMVALPLGLLMTG |
| Ga0306920_1039244713 | 3300032261 | Soil | MQHGAPMRDLVADWKKWSCAERVLAVMGTLLMVALP |
| Ga0335081_110579632 | 3300032892 | Soil | MRDWAADWKRWSRGERVLAVLVAGLMVALPLGFLAGS |
| Ga0334722_109550261 | 3300033233 | Sediment | MRDLIADWKRWSRTERVLAVFVTVLMVALPLGLLLTAKMGT |
| Ga0310914_100118414 | 3300033289 | Soil | MQHGVPMRDLVADWKKWSRAERVLAVMGTLLMVALPLGLLMTG |
| ⦗Top⦘ |