


| Basic Information | |
|---|---|
| Family ID | F003953 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 460 |
| Average Sequence Length | 39 residues |
| Representative Sequence | MDKINKIIYDLKTDIDNNTSKYIIILGVLFVISIIL |
| Number of Associated Samples | 230 |
| Number of Associated Scaffolds | 460 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 45.55 % |
| % of genes near scaffold ends (potentially truncated) | 44.35 % |
| % of genes from short scaffolds (< 2000 bps) | 80.22 % |
| Associated GOLD sequencing projects | 183 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.43 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (60.435 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (31.522 % of family members) |
| Environment Ontology (ENVO) | Unclassified (83.478 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (88.913 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 53.12% β-sheet: 0.00% Coil/Unstructured: 46.88% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.43 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 460 Family Scaffolds |
|---|---|---|
| PF08291 | Peptidase_M15_3 | 1.09 |
| PF13759 | 2OG-FeII_Oxy_5 | 0.65 |
| PF13884 | Peptidase_S74 | 0.43 |
| PF00622 | SPRY | 0.22 |
| PF13385 | Laminin_G_3 | 0.22 |
| PF02867 | Ribonuc_red_lgC | 0.22 |
| PF00386 | C1q | 0.22 |
| PF09636 | XkdW | 0.22 |
| COG ID | Name | Functional Category | % Frequency in 460 Family Scaffolds |
|---|---|---|---|
| COG0209 | Ribonucleotide reductase alpha subunit | Nucleotide transport and metabolism [F] | 0.22 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 60.43 % |
| All Organisms | root | All Organisms | 38.04 % |
| unclassified Hyphomonas | no rank | unclassified Hyphomonas | 1.52 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000101|DelMOSum2010_c10008112 | Not Available | 7048 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10009298 | Not Available | 6469 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10011383 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 5681 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10012605 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 5324 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10024398 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 3451 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10040399 | Not Available | 2444 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10087862 | Not Available | 1344 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10106372 | Not Available | 1147 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10108174 | Not Available | 1131 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10111234 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 1105 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10113162 | Not Available | 1090 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10190047 | Not Available | 701 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10201165 | Not Available | 668 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10231099 | Not Available | 596 | Open in IMG/M |
| 3300000115|DelMOSum2011_c10076200 | All Organisms → Viruses | 1184 | Open in IMG/M |
| 3300000115|DelMOSum2011_c10079163 | All Organisms → Viruses → Predicted Viral | 1148 | Open in IMG/M |
| 3300000115|DelMOSum2011_c10090626 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 1031 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10039028 | All Organisms → Viruses → Predicted Viral | 2155 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10092969 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 1158 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10105037 | Not Available | 1055 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10132893 | Not Available | 879 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10213147 | Not Available | 611 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10226527 | Not Available | 583 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10270190 | All Organisms → Viruses | 509 | Open in IMG/M |
| 3300000117|DelMOWin2010_c10048336 | All Organisms → Viruses → Predicted Viral | 1898 | Open in IMG/M |
| 3300000117|DelMOWin2010_c10144470 | Not Available | 795 | Open in IMG/M |
| 3300000117|DelMOWin2010_c10212427 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 588 | Open in IMG/M |
| 3300001450|JGI24006J15134_10024131 | All Organisms → cellular organisms → Bacteria | 2754 | Open in IMG/M |
| 3300001450|JGI24006J15134_10027964 | All Organisms → Viruses → Predicted Viral | 2508 | Open in IMG/M |
| 3300001450|JGI24006J15134_10084009 | All Organisms → cellular organisms → Bacteria | 1183 | Open in IMG/M |
| 3300001450|JGI24006J15134_10084475 | All Organisms → Viruses → Predicted Viral | 1178 | Open in IMG/M |
| 3300001450|JGI24006J15134_10086164 | Not Available | 1161 | Open in IMG/M |
| 3300001450|JGI24006J15134_10126242 | Not Available | 874 | Open in IMG/M |
| 3300001460|JGI24003J15210_10008836 | Not Available | 4154 | Open in IMG/M |
| 3300001460|JGI24003J15210_10021385 | All Organisms → cellular organisms → Bacteria | 2456 | Open in IMG/M |
| 3300001460|JGI24003J15210_10035344 | Not Available | 1785 | Open in IMG/M |
| 3300001460|JGI24003J15210_10036450 | All Organisms → cellular organisms → Bacteria | 1749 | Open in IMG/M |
| 3300001460|JGI24003J15210_10041677 | All Organisms → Viruses → Predicted Viral | 1588 | Open in IMG/M |
| 3300001460|JGI24003J15210_10048017 | All Organisms → Viruses → Predicted Viral | 1439 | Open in IMG/M |
| 3300001460|JGI24003J15210_10054631 | Not Available | 1315 | Open in IMG/M |
| 3300001460|JGI24003J15210_10055106 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 1308 | Open in IMG/M |
| 3300001460|JGI24003J15210_10060435 | All Organisms → Viruses | 1222 | Open in IMG/M |
| 3300001460|JGI24003J15210_10077146 | Not Available | 1020 | Open in IMG/M |
| 3300001460|JGI24003J15210_10101898 | All Organisms → cellular organisms → Bacteria | 820 | Open in IMG/M |
| 3300001472|JGI24004J15324_10021092 | All Organisms → Viruses → Predicted Viral | 2207 | Open in IMG/M |
| 3300001472|JGI24004J15324_10028467 | All Organisms → Viruses | 1838 | Open in IMG/M |
| 3300001472|JGI24004J15324_10153859 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 528 | Open in IMG/M |
| 3300001589|JGI24005J15628_10055707 | Not Available | 1499 | Open in IMG/M |
| 3300001589|JGI24005J15628_10061712 | All Organisms → Viruses → Predicted Viral | 1395 | Open in IMG/M |
| 3300001589|JGI24005J15628_10062486 | All Organisms → Viruses | 1382 | Open in IMG/M |
| 3300001589|JGI24005J15628_10078986 | Not Available | 1163 | Open in IMG/M |
| 3300001589|JGI24005J15628_10176973 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 620 | Open in IMG/M |
| 3300001947|GOS2218_1025521 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 1505 | Open in IMG/M |
| 3300002231|KVRMV2_101453789 | Not Available | 808 | Open in IMG/M |
| 3300002242|KVWGV2_10328655 | Not Available | 8029 | Open in IMG/M |
| 3300002483|JGI25132J35274_1024109 | All Organisms → Viruses → Predicted Viral | 1417 | Open in IMG/M |
| 3300005239|Ga0073579_1092471 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 2147 | Open in IMG/M |
| 3300005837|Ga0078893_10011311 | Not Available | 895 | Open in IMG/M |
| 3300005912|Ga0075109_1097619 | Not Available | 1011 | Open in IMG/M |
| 3300005913|Ga0075108_10278133 | Not Available | 559 | Open in IMG/M |
| 3300005913|Ga0075108_10278173 | Not Available | 559 | Open in IMG/M |
| 3300005931|Ga0075119_1047316 | Not Available | 1090 | Open in IMG/M |
| 3300005931|Ga0075119_1089811 | Not Available | 687 | Open in IMG/M |
| 3300005931|Ga0075119_1108747 | Not Available | 599 | Open in IMG/M |
| 3300005931|Ga0075119_1113864 | Not Available | 580 | Open in IMG/M |
| 3300005935|Ga0075125_10289247 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 652 | Open in IMG/M |
| 3300006027|Ga0075462_10002186 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 6359 | Open in IMG/M |
| 3300006027|Ga0075462_10015405 | All Organisms → cellular organisms → Bacteria | 2464 | Open in IMG/M |
| 3300006027|Ga0075462_10070790 | Not Available | 1097 | Open in IMG/M |
| 3300006027|Ga0075462_10196388 | Not Available | 608 | Open in IMG/M |
| 3300006029|Ga0075466_1016838 | All Organisms → Viruses → Predicted Viral | 2414 | Open in IMG/M |
| 3300006029|Ga0075466_1036768 | All Organisms → Viruses → Predicted Viral | 1500 | Open in IMG/M |
| 3300006029|Ga0075466_1038160 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 1465 | Open in IMG/M |
| 3300006029|Ga0075466_1062504 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 1070 | Open in IMG/M |
| 3300006029|Ga0075466_1155422 | Not Available | 586 | Open in IMG/M |
| 3300006029|Ga0075466_1179111 | Not Available | 533 | Open in IMG/M |
| 3300006164|Ga0075441_10053162 | Not Available | 1603 | Open in IMG/M |
| 3300006164|Ga0075441_10061705 | All Organisms → cellular organisms → Bacteria | 1471 | Open in IMG/M |
| 3300006164|Ga0075441_10112252 | All Organisms → Viruses → Predicted Viral | 1041 | Open in IMG/M |
| 3300006164|Ga0075441_10188071 | Not Available | 771 | Open in IMG/M |
| 3300006164|Ga0075441_10206597 | Not Available | 730 | Open in IMG/M |
| 3300006164|Ga0075441_10342439 | Not Available | 543 | Open in IMG/M |
| 3300006165|Ga0075443_10003786 | Not Available | 5668 | Open in IMG/M |
| 3300006165|Ga0075443_10025064 | Not Available | 1997 | Open in IMG/M |
| 3300006165|Ga0075443_10258234 | Not Available | 633 | Open in IMG/M |
| 3300006190|Ga0075446_10070440 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 1054 | Open in IMG/M |
| 3300006193|Ga0075445_10098575 | All Organisms → Viruses → Predicted Viral | 1092 | Open in IMG/M |
| 3300006193|Ga0075445_10246687 | Not Available | 612 | Open in IMG/M |
| 3300006735|Ga0098038_1038506 | All Organisms → Viruses → Predicted Viral | 1760 | Open in IMG/M |
| 3300006735|Ga0098038_1051793 | All Organisms → cellular organisms → Bacteria | 1481 | Open in IMG/M |
| 3300006735|Ga0098038_1079696 | All Organisms → cellular organisms → Bacteria | 1149 | Open in IMG/M |
| 3300006735|Ga0098038_1103072 | All Organisms → Viruses | 982 | Open in IMG/M |
| 3300006735|Ga0098038_1193629 | Not Available | 661 | Open in IMG/M |
| 3300006735|Ga0098038_1195348 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 657 | Open in IMG/M |
| 3300006737|Ga0098037_1006866 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4593 | Open in IMG/M |
| 3300006737|Ga0098037_1044847 | All Organisms → Viruses → Predicted Viral | 1601 | Open in IMG/M |
| 3300006737|Ga0098037_1101293 | Not Available | 997 | Open in IMG/M |
| 3300006737|Ga0098037_1121711 | Not Available | 892 | Open in IMG/M |
| 3300006737|Ga0098037_1125162 | Not Available | 877 | Open in IMG/M |
| 3300006737|Ga0098037_1286508 | Not Available | 522 | Open in IMG/M |
| 3300006749|Ga0098042_1081434 | All Organisms → cellular organisms → Bacteria | 837 | Open in IMG/M |
| 3300006752|Ga0098048_1057569 | Not Available | 1211 | Open in IMG/M |
| 3300006752|Ga0098048_1096383 | Not Available | 896 | Open in IMG/M |
| 3300006752|Ga0098048_1155075 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 682 | Open in IMG/M |
| 3300006789|Ga0098054_1023590 | All Organisms → Viruses | 2437 | Open in IMG/M |
| 3300006789|Ga0098054_1092164 | Not Available | 1137 | Open in IMG/M |
| 3300006789|Ga0098054_1150871 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 858 | Open in IMG/M |
| 3300006793|Ga0098055_1035143 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 2065 | Open in IMG/M |
| 3300006793|Ga0098055_1100447 | Not Available | 1130 | Open in IMG/M |
| 3300006793|Ga0098055_1319793 | All Organisms → Viruses | 579 | Open in IMG/M |
| 3300006793|Ga0098055_1355641 | Not Available | 544 | Open in IMG/M |
| 3300006793|Ga0098055_1374445 | Not Available | 528 | Open in IMG/M |
| 3300006802|Ga0070749_10127325 | unclassified Hyphomonas → Hyphomonas sp. | 1493 | Open in IMG/M |
| 3300006803|Ga0075467_10177908 | Not Available | 1200 | Open in IMG/M |
| 3300006803|Ga0075467_10721657 | Not Available | 507 | Open in IMG/M |
| 3300006810|Ga0070754_10054254 | All Organisms → cellular organisms → Bacteria | 2104 | Open in IMG/M |
| 3300006810|Ga0070754_10126357 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Aequorivita → unclassified Aequorivita → Aequorivita sp. | 1241 | Open in IMG/M |
| 3300006810|Ga0070754_10150190 | Not Available | 1114 | Open in IMG/M |
| 3300006810|Ga0070754_10193011 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-AD10-C281 | 952 | Open in IMG/M |
| 3300006916|Ga0070750_10019071 | Not Available | 3500 | Open in IMG/M |
| 3300006916|Ga0070750_10092801 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 1406 | Open in IMG/M |
| 3300006916|Ga0070750_10378393 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-AD10-C281 | 594 | Open in IMG/M |
| 3300006920|Ga0070748_1090291 | All Organisms → Viruses → Predicted Viral | 1174 | Open in IMG/M |
| 3300006920|Ga0070748_1272032 | Not Available | 606 | Open in IMG/M |
| 3300006920|Ga0070748_1357444 | Not Available | 514 | Open in IMG/M |
| 3300006920|Ga0070748_1373768 | Not Available | 500 | Open in IMG/M |
| 3300006921|Ga0098060_1199608 | Not Available | 547 | Open in IMG/M |
| 3300006921|Ga0098060_1203377 | Not Available | 541 | Open in IMG/M |
| 3300006922|Ga0098045_1009256 | All Organisms → cellular organisms → Bacteria | 2838 | Open in IMG/M |
| 3300006925|Ga0098050_1154785 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300006929|Ga0098036_1081170 | All Organisms → cellular organisms → Bacteria | 999 | Open in IMG/M |
| 3300006947|Ga0075444_10107765 | All Organisms → Viruses → Predicted Viral | 1210 | Open in IMG/M |
| 3300006947|Ga0075444_10167352 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 910 | Open in IMG/M |
| 3300006947|Ga0075444_10213747 | Not Available | 773 | Open in IMG/M |
| 3300006947|Ga0075444_10323816 | Not Available | 591 | Open in IMG/M |
| 3300006990|Ga0098046_1041137 | All Organisms → cellular organisms → Bacteria | 1102 | Open in IMG/M |
| 3300006990|Ga0098046_1098404 | Not Available | 651 | Open in IMG/M |
| 3300007229|Ga0075468_10019060 | Not Available | 2554 | Open in IMG/M |
| 3300007229|Ga0075468_10049880 | Not Available | 1427 | Open in IMG/M |
| 3300007229|Ga0075468_10071207 | Not Available | 1141 | Open in IMG/M |
| 3300007229|Ga0075468_10201076 | Not Available | 581 | Open in IMG/M |
| 3300007276|Ga0070747_1027990 | All Organisms → Viruses → Predicted Viral | 2255 | Open in IMG/M |
| 3300007276|Ga0070747_1090115 | Not Available | 1138 | Open in IMG/M |
| 3300007276|Ga0070747_1124844 | Not Available | 936 | Open in IMG/M |
| 3300007276|Ga0070747_1126752 | Not Available | 928 | Open in IMG/M |
| 3300007276|Ga0070747_1140397 | Not Available | 873 | Open in IMG/M |
| 3300007276|Ga0070747_1254211 | Not Available | 610 | Open in IMG/M |
| 3300007344|Ga0070745_1115502 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 1038 | Open in IMG/M |
| 3300007345|Ga0070752_1181239 | Not Available | 849 | Open in IMG/M |
| 3300007345|Ga0070752_1343946 | Not Available | 561 | Open in IMG/M |
| 3300007346|Ga0070753_1239641 | Not Available | 661 | Open in IMG/M |
| 3300007548|Ga0102877_1233347 | All Organisms → Viruses | 518 | Open in IMG/M |
| 3300007640|Ga0070751_1166723 | Not Available | 872 | Open in IMG/M |
| 3300007863|Ga0105744_1010936 | Not Available | 2334 | Open in IMG/M |
| 3300008012|Ga0075480_10059999 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2205 | Open in IMG/M |
| 3300008221|Ga0114916_1017582 | Not Available | 2525 | Open in IMG/M |
| 3300008221|Ga0114916_1158376 | Not Available | 500 | Open in IMG/M |
| 3300009051|Ga0102864_1114410 | Not Available | 737 | Open in IMG/M |
| 3300009071|Ga0115566_10227585 | All Organisms → Viruses → Predicted Viral | 1126 | Open in IMG/M |
| 3300009071|Ga0115566_10373245 | Not Available | 827 | Open in IMG/M |
| 3300009077|Ga0115552_1235517 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 742 | Open in IMG/M |
| 3300009077|Ga0115552_1385885 | Not Available | 553 | Open in IMG/M |
| 3300009079|Ga0102814_10737470 | Not Available | 542 | Open in IMG/M |
| 3300009149|Ga0114918_10362327 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Aequorivita → unclassified Aequorivita → Aequorivita sp. | 797 | Open in IMG/M |
| 3300009172|Ga0114995_10050088 | Not Available | 2387 | Open in IMG/M |
| 3300009173|Ga0114996_10310626 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 1231 | Open in IMG/M |
| 3300009409|Ga0114993_11314466 | Not Available | 506 | Open in IMG/M |
| 3300009420|Ga0114994_10329534 | Not Available | 1015 | Open in IMG/M |
| 3300009420|Ga0114994_10508097 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 794 | Open in IMG/M |
| 3300009422|Ga0114998_10228697 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 879 | Open in IMG/M |
| 3300009423|Ga0115548_1150250 | Not Available | 735 | Open in IMG/M |
| 3300009425|Ga0114997_10012820 | Not Available | 5887 | Open in IMG/M |
| 3300009425|Ga0114997_10055777 | Not Available | 2522 | Open in IMG/M |
| 3300009425|Ga0114997_10458762 | All Organisms → Viruses | 683 | Open in IMG/M |
| 3300009426|Ga0115547_1299828 | Not Available | 501 | Open in IMG/M |
| 3300009428|Ga0114915_1122537 | Not Available | 756 | Open in IMG/M |
| 3300009428|Ga0114915_1163854 | Not Available | 626 | Open in IMG/M |
| 3300009428|Ga0114915_1175560 | All Organisms → Viruses | 598 | Open in IMG/M |
| 3300009428|Ga0114915_1210654 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 532 | Open in IMG/M |
| 3300009428|Ga0114915_1220501 | Not Available | 517 | Open in IMG/M |
| 3300009435|Ga0115546_1012786 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3788 | Open in IMG/M |
| 3300009435|Ga0115546_1151878 | Not Available | 816 | Open in IMG/M |
| 3300009435|Ga0115546_1161817 | Not Available | 785 | Open in IMG/M |
| 3300009435|Ga0115546_1336484 | Not Available | 514 | Open in IMG/M |
| 3300009435|Ga0115546_1337999 | Not Available | 512 | Open in IMG/M |
| 3300009436|Ga0115008_10934694 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| 3300009441|Ga0115007_11089671 | Not Available | 552 | Open in IMG/M |
| 3300009481|Ga0114932_10005925 | Not Available | 10634 | Open in IMG/M |
| 3300009481|Ga0114932_10012528 | Not Available | 6320 | Open in IMG/M |
| 3300009507|Ga0115572_10236466 | Not Available | 1048 | Open in IMG/M |
| 3300009512|Ga0115003_10344538 | Not Available | 879 | Open in IMG/M |
| 3300009526|Ga0115004_10182654 | Not Available | 1260 | Open in IMG/M |
| 3300009550|Ga0115013_10069099 | All Organisms → Viruses → Predicted Viral | 1964 | Open in IMG/M |
| 3300009593|Ga0115011_10019751 | All Organisms → Viruses → Predicted Viral | 4490 | Open in IMG/M |
| 3300009593|Ga0115011_10152494 | unclassified Hyphomonas → Hyphomonas sp. | 1677 | Open in IMG/M |
| 3300009593|Ga0115011_12239819 | Not Available | 505 | Open in IMG/M |
| 3300009703|Ga0114933_10075188 | All Organisms → Viruses → Predicted Viral | 2412 | Open in IMG/M |
| 3300009703|Ga0114933_10555212 | Not Available | 743 | Open in IMG/M |
| 3300009705|Ga0115000_10024005 | Not Available | 4340 | Open in IMG/M |
| 3300009786|Ga0114999_10298974 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 1296 | Open in IMG/M |
| 3300009786|Ga0114999_10503538 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 934 | Open in IMG/M |
| 3300009790|Ga0115012_10044172 | All Organisms → Viruses → Predicted Viral | 2951 | Open in IMG/M |
| 3300009790|Ga0115012_12041756 | Not Available | 509 | Open in IMG/M |
| 3300010148|Ga0098043_1019576 | All Organisms → Viruses → Predicted Viral | 2182 | Open in IMG/M |
| 3300010150|Ga0098056_1086229 | Not Available | 1073 | Open in IMG/M |
| 3300010151|Ga0098061_1346617 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 505 | Open in IMG/M |
| 3300010153|Ga0098059_1216779 | Not Available | 743 | Open in IMG/M |
| 3300010300|Ga0129351_1349475 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 555 | Open in IMG/M |
| 3300010368|Ga0129324_10218211 | Not Available | 769 | Open in IMG/M |
| 3300011013|Ga0114934_10168945 | Not Available | 1025 | Open in IMG/M |
| 3300011252|Ga0151674_1018732 | Not Available | 582 | Open in IMG/M |
| 3300011253|Ga0151671_1034970 | Not Available | 1486 | Open in IMG/M |
| 3300011258|Ga0151677_1011575 | Not Available | 1705 | Open in IMG/M |
| 3300012920|Ga0160423_10023256 | Not Available | 4635 | Open in IMG/M |
| 3300012952|Ga0163180_11060857 | All Organisms → Viruses | 653 | Open in IMG/M |
| 3300013010|Ga0129327_10729034 | Not Available | 557 | Open in IMG/M |
| 3300017697|Ga0180120_10128964 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 1083 | Open in IMG/M |
| 3300017697|Ga0180120_10190440 | Not Available | 854 | Open in IMG/M |
| 3300017697|Ga0180120_10336384 | Not Available | 599 | Open in IMG/M |
| 3300017706|Ga0181377_1088558 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 544 | Open in IMG/M |
| 3300017708|Ga0181369_1000301 | Not Available | 13955 | Open in IMG/M |
| 3300017708|Ga0181369_1017416 | unclassified Hyphomonas → Hyphomonas sp. | 1774 | Open in IMG/M |
| 3300017713|Ga0181391_1032379 | All Organisms → Viruses → Predicted Viral | 1271 | Open in IMG/M |
| 3300017713|Ga0181391_1057748 | Not Available | 907 | Open in IMG/M |
| 3300017714|Ga0181412_1146461 | Not Available | 533 | Open in IMG/M |
| 3300017717|Ga0181404_1013410 | All Organisms → Viruses | 2144 | Open in IMG/M |
| 3300017717|Ga0181404_1017546 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 1859 | Open in IMG/M |
| 3300017719|Ga0181390_1133813 | Not Available | 637 | Open in IMG/M |
| 3300017726|Ga0181381_1029561 | Not Available | 1232 | Open in IMG/M |
| 3300017726|Ga0181381_1068561 | Not Available | 764 | Open in IMG/M |
| 3300017728|Ga0181419_1051959 | Not Available | 1067 | Open in IMG/M |
| 3300017729|Ga0181396_1030153 | All Organisms → Viruses → Predicted Viral | 1081 | Open in IMG/M |
| 3300017729|Ga0181396_1093762 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 611 | Open in IMG/M |
| 3300017731|Ga0181416_1121766 | Not Available | 627 | Open in IMG/M |
| 3300017734|Ga0187222_1096049 | Not Available | 671 | Open in IMG/M |
| 3300017740|Ga0181418_1165930 | Not Available | 529 | Open in IMG/M |
| 3300017741|Ga0181421_1004818 | All Organisms → Viruses → Predicted Viral | 3857 | Open in IMG/M |
| 3300017741|Ga0181421_1010567 | Not Available | 2564 | Open in IMG/M |
| 3300017741|Ga0181421_1086252 | Not Available | 820 | Open in IMG/M |
| 3300017742|Ga0181399_1044753 | Not Available | 1167 | Open in IMG/M |
| 3300017743|Ga0181402_1112443 | Not Available | 700 | Open in IMG/M |
| 3300017749|Ga0181392_1006507 | Not Available | 3970 | Open in IMG/M |
| 3300017749|Ga0181392_1075137 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 1021 | Open in IMG/M |
| 3300017749|Ga0181392_1246616 | All Organisms → Viruses | 503 | Open in IMG/M |
| 3300017750|Ga0181405_1033170 | Not Available | 1398 | Open in IMG/M |
| 3300017750|Ga0181405_1079563 | Not Available | 838 | Open in IMG/M |
| 3300017751|Ga0187219_1227351 | Not Available | 508 | Open in IMG/M |
| 3300017752|Ga0181400_1074917 | Not Available | 1017 | Open in IMG/M |
| 3300017753|Ga0181407_1088206 | Not Available | 788 | Open in IMG/M |
| 3300017753|Ga0181407_1140611 | All Organisms → Viruses | 598 | Open in IMG/M |
| 3300017755|Ga0181411_1038243 | Not Available | 1505 | Open in IMG/M |
| 3300017755|Ga0181411_1040260 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 1461 | Open in IMG/M |
| 3300017755|Ga0181411_1073734 | Not Available | 1029 | Open in IMG/M |
| 3300017755|Ga0181411_1104347 | Not Available | 836 | Open in IMG/M |
| 3300017756|Ga0181382_1140561 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 635 | Open in IMG/M |
| 3300017757|Ga0181420_1054428 | All Organisms → Viruses → Predicted Viral | 1278 | Open in IMG/M |
| 3300017758|Ga0181409_1112532 | Not Available | 807 | Open in IMG/M |
| 3300017758|Ga0181409_1129761 | Not Available | 742 | Open in IMG/M |
| 3300017759|Ga0181414_1004315 | Not Available | 4104 | Open in IMG/M |
| 3300017759|Ga0181414_1142790 | Not Available | 626 | Open in IMG/M |
| 3300017760|Ga0181408_1155879 | All Organisms → Viruses | 588 | Open in IMG/M |
| 3300017762|Ga0181422_1070993 | Not Available | 1103 | Open in IMG/M |
| 3300017764|Ga0181385_1097084 | Not Available | 903 | Open in IMG/M |
| 3300017765|Ga0181413_1008008 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 3288 | Open in IMG/M |
| 3300017765|Ga0181413_1012737 | All Organisms → cellular organisms → Bacteria | 2619 | Open in IMG/M |
| 3300017767|Ga0181406_1126716 | Not Available | 769 | Open in IMG/M |
| 3300017769|Ga0187221_1230521 | Not Available | 528 | Open in IMG/M |
| 3300017770|Ga0187217_1073964 | Not Available | 1172 | Open in IMG/M |
| 3300017770|Ga0187217_1295450 | Not Available | 522 | Open in IMG/M |
| 3300017781|Ga0181423_1389403 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 504 | Open in IMG/M |
| 3300017782|Ga0181380_1179564 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 714 | Open in IMG/M |
| 3300017782|Ga0181380_1291403 | Not Available | 535 | Open in IMG/M |
| 3300017783|Ga0181379_1070903 | All Organisms → Viruses → Predicted Viral | 1304 | Open in IMG/M |
| 3300017786|Ga0181424_10471778 | Not Available | 505 | Open in IMG/M |
| 3300018041|Ga0181601_10117631 | All Organisms → Viruses → Predicted Viral | 1684 | Open in IMG/M |
| 3300019459|Ga0181562_10118858 | Not Available | 1476 | Open in IMG/M |
| 3300019459|Ga0181562_10359065 | Not Available | 711 | Open in IMG/M |
| 3300020253|Ga0211685_1041664 | Not Available | 659 | Open in IMG/M |
| 3300020372|Ga0211683_10019227 | Not Available | 2346 | Open in IMG/M |
| 3300020372|Ga0211683_10028334 | Not Available | 1891 | Open in IMG/M |
| 3300020372|Ga0211683_10055799 | All Organisms → Viruses | 1296 | Open in IMG/M |
| 3300020372|Ga0211683_10059415 | Not Available | 1251 | Open in IMG/M |
| 3300020372|Ga0211683_10247931 | Not Available | 561 | Open in IMG/M |
| 3300020388|Ga0211678_10400212 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 545 | Open in IMG/M |
| 3300020392|Ga0211666_10029498 | All Organisms → Viruses | 2484 | Open in IMG/M |
| 3300020403|Ga0211532_10078576 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 1460 | Open in IMG/M |
| 3300020417|Ga0211528_10403912 | All Organisms → Viruses | 501 | Open in IMG/M |
| 3300020440|Ga0211518_10032817 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 3125 | Open in IMG/M |
| 3300020450|Ga0211641_10004851 | Not Available | 8328 | Open in IMG/M |
| 3300020452|Ga0211545_10058198 | All Organisms → Viruses → Predicted Viral | 1854 | Open in IMG/M |
| 3300020459|Ga0211514_10462181 | All Organisms → Viruses | 624 | Open in IMG/M |
| 3300020463|Ga0211676_10375030 | Not Available | 786 | Open in IMG/M |
| 3300020469|Ga0211577_10678373 | Not Available | 606 | Open in IMG/M |
| 3300020474|Ga0211547_10584356 | unclassified Hyphomonas → Hyphomonas sp. | 554 | Open in IMG/M |
| 3300021347|Ga0213862_10187444 | Not Available | 728 | Open in IMG/M |
| 3300021375|Ga0213869_10023093 | Not Available | 3483 | Open in IMG/M |
| 3300021375|Ga0213869_10096591 | Not Available | 1445 | Open in IMG/M |
| 3300021378|Ga0213861_10079224 | Not Available | 2014 | Open in IMG/M |
| 3300021957|Ga0222717_10312332 | Not Available | 894 | Open in IMG/M |
| 3300021958|Ga0222718_10252627 | Not Available | 936 | Open in IMG/M |
| 3300021959|Ga0222716_10026127 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4297 | Open in IMG/M |
| 3300021959|Ga0222716_10077916 | Not Available | 2282 | Open in IMG/M |
| 3300022053|Ga0212030_1024760 | Not Available | 821 | Open in IMG/M |
| 3300022053|Ga0212030_1064899 | Not Available | 520 | Open in IMG/M |
| 3300022061|Ga0212023_1051075 | Not Available | 574 | Open in IMG/M |
| 3300022061|Ga0212023_1058231 | Not Available | 536 | Open in IMG/M |
| 3300022065|Ga0212024_1018884 | Not Available | 1110 | Open in IMG/M |
| 3300022068|Ga0212021_1011405 | unclassified Hyphomonas → Hyphomonas sp. | 1524 | Open in IMG/M |
| 3300022068|Ga0212021_1019417 | Not Available | 1257 | Open in IMG/M |
| 3300022072|Ga0196889_1036387 | Not Available | 983 | Open in IMG/M |
| 3300022072|Ga0196889_1041348 | Not Available | 911 | Open in IMG/M |
| 3300022178|Ga0196887_1052276 | All Organisms → Viruses → Predicted Viral | 1037 | Open in IMG/M |
| 3300022178|Ga0196887_1056599 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-AD10-C281 | 981 | Open in IMG/M |
| 3300022183|Ga0196891_1014254 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 1543 | Open in IMG/M |
| 3300022183|Ga0196891_1031971 | Not Available | 987 | Open in IMG/M |
| 3300022187|Ga0196899_1100519 | Not Available | 857 | Open in IMG/M |
| 3300022187|Ga0196899_1154798 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-AD10-C281 | 635 | Open in IMG/M |
| 3300022822|Ga0222646_101969 | Not Available | 4568 | Open in IMG/M |
| 3300022848|Ga0222674_1078111 | Not Available | 517 | Open in IMG/M |
| 3300022853|Ga0222652_1028544 | Not Available | 891 | Open in IMG/M |
| 3300022925|Ga0255773_10114416 | Not Available | 1386 | Open in IMG/M |
| 3300022925|Ga0255773_10351747 | Not Available | 578 | Open in IMG/M |
| (restricted) 3300022931|Ga0233433_10000914 | Not Available | 30195 | Open in IMG/M |
| 3300023293|Ga0222688_1019578 | Not Available | 896 | Open in IMG/M |
| 3300023294|Ga0222670_1038902 | Not Available | 763 | Open in IMG/M |
| 3300023685|Ga0228686_1050754 | Not Available | 571 | Open in IMG/M |
| (restricted) 3300024255|Ga0233438_10035403 | Not Available | 2724 | Open in IMG/M |
| (restricted) 3300024264|Ga0233444_10097115 | Not Available | 1553 | Open in IMG/M |
| 3300024344|Ga0209992_10002842 | Not Available | 15288 | Open in IMG/M |
| (restricted) 3300024518|Ga0255048_10227552 | Not Available | 908 | Open in IMG/M |
| (restricted) 3300024518|Ga0255048_10252619 | Not Available | 857 | Open in IMG/M |
| 3300025048|Ga0207905_1018506 | Not Available | 1168 | Open in IMG/M |
| 3300025048|Ga0207905_1031655 | All Organisms → Viruses | 856 | Open in IMG/M |
| 3300025070|Ga0208667_1007986 | Not Available | 2599 | Open in IMG/M |
| 3300025070|Ga0208667_1023686 | Not Available | 1165 | Open in IMG/M |
| 3300025071|Ga0207896_1001448 | unclassified Hyphomonas → Hyphomonas sp. | 4580 | Open in IMG/M |
| 3300025071|Ga0207896_1015587 | All Organisms → Viruses → Predicted Viral | 1338 | Open in IMG/M |
| 3300025071|Ga0207896_1032869 | Not Available | 878 | Open in IMG/M |
| 3300025079|Ga0207890_1008078 | All Organisms → Viruses → Predicted Viral | 2294 | Open in IMG/M |
| 3300025083|Ga0208791_1015262 | All Organisms → cellular organisms → Bacteria | 1675 | Open in IMG/M |
| 3300025084|Ga0208298_1033298 | Not Available | 1069 | Open in IMG/M |
| 3300025084|Ga0208298_1076015 | Not Available | 628 | Open in IMG/M |
| 3300025084|Ga0208298_1076636 | All Organisms → Viruses | 625 | Open in IMG/M |
| 3300025085|Ga0208792_1013285 | Not Available | 1822 | Open in IMG/M |
| 3300025085|Ga0208792_1022838 | Not Available | 1287 | Open in IMG/M |
| 3300025085|Ga0208792_1055807 | Not Available | 734 | Open in IMG/M |
| 3300025086|Ga0208157_1007339 | Not Available | 3828 | Open in IMG/M |
| 3300025086|Ga0208157_1032935 | All Organisms → Viruses → Predicted Viral | 1484 | Open in IMG/M |
| 3300025086|Ga0208157_1046784 | Not Available | 1177 | Open in IMG/M |
| 3300025086|Ga0208157_1051419 | Not Available | 1106 | Open in IMG/M |
| 3300025086|Ga0208157_1108149 | All Organisms → Viruses | 660 | Open in IMG/M |
| 3300025103|Ga0208013_1031854 | Not Available | 1502 | Open in IMG/M |
| 3300025120|Ga0209535_1002660 | Not Available | 11627 | Open in IMG/M |
| 3300025120|Ga0209535_1003941 | Not Available | 9362 | Open in IMG/M |
| 3300025120|Ga0209535_1004729 | Not Available | 8462 | Open in IMG/M |
| 3300025120|Ga0209535_1014395 | All Organisms → Viruses → Predicted Viral | 4256 | Open in IMG/M |
| 3300025120|Ga0209535_1030689 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 2545 | Open in IMG/M |
| 3300025120|Ga0209535_1038729 | All Organisms → Viruses → Predicted Viral | 2156 | Open in IMG/M |
| 3300025120|Ga0209535_1091557 | All Organisms → Viruses → Predicted Viral | 1117 | Open in IMG/M |
| 3300025120|Ga0209535_1092926 | Not Available | 1104 | Open in IMG/M |
| 3300025120|Ga0209535_1095788 | All Organisms → Viruses | 1077 | Open in IMG/M |
| 3300025120|Ga0209535_1123020 | All Organisms → Viruses | 878 | Open in IMG/M |
| 3300025120|Ga0209535_1143339 | Not Available | 767 | Open in IMG/M |
| 3300025120|Ga0209535_1173223 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 646 | Open in IMG/M |
| 3300025128|Ga0208919_1037343 | Not Available | 1723 | Open in IMG/M |
| 3300025128|Ga0208919_1042840 | All Organisms → Viruses → Predicted Viral | 1582 | Open in IMG/M |
| 3300025128|Ga0208919_1198743 | Not Available | 602 | Open in IMG/M |
| 3300025132|Ga0209232_1144278 | All Organisms → Viruses | 765 | Open in IMG/M |
| 3300025132|Ga0209232_1152696 | Not Available | 736 | Open in IMG/M |
| 3300025137|Ga0209336_10002815 | Not Available | 8158 | Open in IMG/M |
| 3300025137|Ga0209336_10004843 | All Organisms → cellular organisms → Bacteria | 6010 | Open in IMG/M |
| 3300025137|Ga0209336_10017369 | All Organisms → Viruses → Predicted Viral | 2646 | Open in IMG/M |
| 3300025137|Ga0209336_10018384 | All Organisms → Viruses → Predicted Viral | 2546 | Open in IMG/M |
| 3300025137|Ga0209336_10043586 | All Organisms → Viruses → Predicted Viral | 1429 | Open in IMG/M |
| 3300025137|Ga0209336_10139037 | All Organisms → Viruses | 651 | Open in IMG/M |
| 3300025138|Ga0209634_1068525 | All Organisms → Viruses → Predicted Viral | 1677 | Open in IMG/M |
| 3300025138|Ga0209634_1083486 | All Organisms → Viruses → Predicted Viral | 1460 | Open in IMG/M |
| 3300025138|Ga0209634_1141044 | All Organisms → cellular organisms → Bacteria | 998 | Open in IMG/M |
| 3300025138|Ga0209634_1148307 | Not Available | 961 | Open in IMG/M |
| 3300025151|Ga0209645_1118279 | Not Available | 843 | Open in IMG/M |
| 3300025237|Ga0208031_1026208 | All Organisms → cellular organisms → Bacteria | 775 | Open in IMG/M |
| 3300025266|Ga0208032_1006334 | Not Available | 4095 | Open in IMG/M |
| 3300025266|Ga0208032_1021436 | Not Available | 1852 | Open in IMG/M |
| 3300025266|Ga0208032_1041864 | Not Available | 1131 | Open in IMG/M |
| 3300025276|Ga0208814_1003010 | Not Available | 7046 | Open in IMG/M |
| 3300025276|Ga0208814_1022837 | Not Available | 2068 | Open in IMG/M |
| 3300025276|Ga0208814_1055811 | All Organisms → Viruses → Predicted Viral | 1131 | Open in IMG/M |
| 3300025276|Ga0208814_1088366 | Not Available | 806 | Open in IMG/M |
| 3300025276|Ga0208814_1109561 | Not Available | 680 | Open in IMG/M |
| 3300025502|Ga0208903_1060021 | Not Available | 927 | Open in IMG/M |
| 3300025502|Ga0208903_1116399 | Not Available | 583 | Open in IMG/M |
| 3300025508|Ga0208148_1032903 | Not Available | 1381 | Open in IMG/M |
| 3300025508|Ga0208148_1043583 | Not Available | 1141 | Open in IMG/M |
| 3300025508|Ga0208148_1078704 | Not Available | 748 | Open in IMG/M |
| 3300025543|Ga0208303_1018895 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 1986 | Open in IMG/M |
| 3300025543|Ga0208303_1120528 | Not Available | 529 | Open in IMG/M |
| 3300025632|Ga0209194_1045249 | Not Available | 1293 | Open in IMG/M |
| 3300025632|Ga0209194_1055178 | Not Available | 1121 | Open in IMG/M |
| 3300025645|Ga0208643_1047522 | Not Available | 1331 | Open in IMG/M |
| 3300025652|Ga0208134_1020786 | All Organisms → Viruses → Predicted Viral | 2460 | Open in IMG/M |
| 3300025652|Ga0208134_1060228 | All Organisms → Viruses → Predicted Viral | 1165 | Open in IMG/M |
| 3300025652|Ga0208134_1124932 | Not Available | 678 | Open in IMG/M |
| 3300025671|Ga0208898_1100465 | Not Available | 880 | Open in IMG/M |
| 3300025674|Ga0208162_1014997 | All Organisms → Viruses | 3118 | Open in IMG/M |
| 3300025674|Ga0208162_1102686 | Not Available | 848 | Open in IMG/M |
| 3300025759|Ga0208899_1021392 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 3224 | Open in IMG/M |
| 3300025759|Ga0208899_1040496 | Not Available | 2083 | Open in IMG/M |
| 3300025803|Ga0208425_1001110 | Not Available | 9078 | Open in IMG/M |
| 3300025803|Ga0208425_1097144 | Not Available | 690 | Open in IMG/M |
| 3300025806|Ga0208545_1047824 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Aequorivita → unclassified Aequorivita → Aequorivita sp. | 1281 | Open in IMG/M |
| 3300025806|Ga0208545_1161573 | Not Available | 526 | Open in IMG/M |
| 3300025816|Ga0209193_1008847 | Not Available | 3661 | Open in IMG/M |
| 3300025853|Ga0208645_1133468 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-AD10-C281 | 970 | Open in IMG/M |
| 3300025869|Ga0209308_10291813 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-AD10-C281 | 684 | Open in IMG/M |
| 3300025890|Ga0209631_10044187 | Not Available | 2992 | Open in IMG/M |
| 3300025894|Ga0209335_10347286 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-AD10-C281 | 616 | Open in IMG/M |
| 3300027081|Ga0208954_1008339 | Not Available | 1494 | Open in IMG/M |
| 3300027522|Ga0209384_1000804 | Not Available | 18049 | Open in IMG/M |
| 3300027668|Ga0209482_1082511 | All Organisms → Viruses → Predicted Viral | 1072 | Open in IMG/M |
| 3300027668|Ga0209482_1096773 | Not Available | 954 | Open in IMG/M |
| 3300027704|Ga0209816_1081823 | All Organisms → Viruses → Predicted Viral | 1317 | Open in IMG/M |
| 3300027714|Ga0209815_1140598 | Not Available | 777 | Open in IMG/M |
| 3300027752|Ga0209192_10250982 | All Organisms → Viruses | 654 | Open in IMG/M |
| 3300027779|Ga0209709_10016311 | Not Available | 5034 | Open in IMG/M |
| 3300027779|Ga0209709_10078992 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1789 | Open in IMG/M |
| 3300027779|Ga0209709_10092952 | Not Available | 1601 | Open in IMG/M |
| 3300027801|Ga0209091_10518396 | Not Available | 514 | Open in IMG/M |
| 3300027813|Ga0209090_10189737 | Not Available | 1065 | Open in IMG/M |
| 3300027813|Ga0209090_10229942 | Not Available | 945 | Open in IMG/M |
| 3300027847|Ga0209402_10425930 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 793 | Open in IMG/M |
| 3300027859|Ga0209503_10028937 | Not Available | 2487 | Open in IMG/M |
| 3300027906|Ga0209404_10009854 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 5246 | Open in IMG/M |
| 3300028125|Ga0256368_1015501 | Not Available | 1322 | Open in IMG/M |
| 3300028125|Ga0256368_1022450 | Not Available | 1117 | Open in IMG/M |
| 3300028125|Ga0256368_1042098 | Not Available | 811 | Open in IMG/M |
| 3300028125|Ga0256368_1054900 | Not Available | 697 | Open in IMG/M |
| 3300028125|Ga0256368_1060042 | Not Available | 661 | Open in IMG/M |
| 3300028198|Ga0257121_1058401 | Not Available | 1549 | Open in IMG/M |
| 3300028600|Ga0265303_11880451 | Not Available | 501 | Open in IMG/M |
| 3300029309|Ga0183683_1033930 | All Organisms → Viruses | 862 | Open in IMG/M |
| 3300029448|Ga0183755_1051031 | Not Available | 1040 | Open in IMG/M |
| 3300029787|Ga0183757_1022882 | All Organisms → Viruses → Predicted Viral | 1451 | Open in IMG/M |
| 3300029787|Ga0183757_1069936 | unclassified Hyphomonas → Hyphomonas sp. | 524 | Open in IMG/M |
| 3300031167|Ga0308023_1028871 | Not Available | 1107 | Open in IMG/M |
| 3300031519|Ga0307488_10022424 | Not Available | 5080 | Open in IMG/M |
| 3300031519|Ga0307488_10193932 | All Organisms → Viruses → Predicted Viral | 1382 | Open in IMG/M |
| 3300031519|Ga0307488_10235170 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 1217 | Open in IMG/M |
| 3300031519|Ga0307488_10438021 | Not Available | 797 | Open in IMG/M |
| 3300031519|Ga0307488_10818864 | Not Available | 513 | Open in IMG/M |
| 3300031644|Ga0308001_10335362 | Not Available | 560 | Open in IMG/M |
| 3300031659|Ga0307986_10128635 | All Organisms → Viruses → Predicted Viral | 1198 | Open in IMG/M |
| 3300031659|Ga0307986_10185753 | Not Available | 941 | Open in IMG/M |
| 3300032277|Ga0316202_10484355 | Not Available | 581 | Open in IMG/M |
| 3300032277|Ga0316202_10608383 | All Organisms → Viruses | 515 | Open in IMG/M |
| 3300033742|Ga0314858_034086 | Not Available | 1188 | Open in IMG/M |
| 3300033742|Ga0314858_162429 | All Organisms → Viruses | 574 | Open in IMG/M |
| 3300033742|Ga0314858_179197 | Not Available | 544 | Open in IMG/M |
| 3300034374|Ga0348335_077438 | Not Available | 1134 | Open in IMG/M |
| 3300034375|Ga0348336_015164 | Not Available | 4296 | Open in IMG/M |
| 3300034418|Ga0348337_130186 | Not Available | 752 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 31.52% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 16.74% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 11.30% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 9.13% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 5.87% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 3.48% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 3.48% |
| Saline Lake | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake | 2.17% |
| Sea-Ice Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine | 1.74% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 1.30% |
| Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 1.30% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 1.09% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 1.09% |
| Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 1.09% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 1.09% |
| Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 1.09% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.87% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.87% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.65% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.65% |
| Microbial Mat | Environmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat | 0.43% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.43% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 0.43% |
| Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 0.43% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.22% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.22% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 0.22% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 0.22% |
| Marine | Environmental → Aquatic → Marine → Inlet → Unclassified → Marine | 0.22% |
| Marine Surface Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine Surface Water | 0.22% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.22% |
| Sediment | Environmental → Aquatic → Marine → Subtidal Zone → Sediment → Sediment | 0.22% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
| 3300000115 | Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011 | Environmental | Open in IMG/M |
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
| 3300001450 | Marine viral communities from the Pacific Ocean - LP-53 | Environmental | Open in IMG/M |
| 3300001460 | Marine viral communities from the Pacific Ocean - LP-28 | Environmental | Open in IMG/M |
| 3300001472 | Marine viral communities from the Pacific Ocean - LP-32 | Environmental | Open in IMG/M |
| 3300001589 | Marine viral communities from the Pacific Ocean - LP-40 | Environmental | Open in IMG/M |
| 3300001947 | Marine microbial communities from the Gulf of Maine, Canada - GS002 | Environmental | Open in IMG/M |
| 3300002231 | Marine sediment microbial communities from Santorini caldera mats, Greece - red mat | Environmental | Open in IMG/M |
| 3300002242 | Marine sediment microbial communities from Kolumbo Volcano mats, Greece - white/grey mat | Environmental | Open in IMG/M |
| 3300002483 | Marine viral communities from the Pacific Ocean - ETNP_6_30 | Environmental | Open in IMG/M |
| 3300005239 | Environmental Genome Shotgun Sequencing: Ocean Microbial Populations from the Gulf of Maine | Environmental | Open in IMG/M |
| 3300005837 | Exploring phylogenetic diversity in Port Hacking ocean in Sydney, Australia - Port Hacking PH4 TJ4-TJ18 | Environmental | Open in IMG/M |
| 3300005912 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKD | Environmental | Open in IMG/M |
| 3300005913 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UK1 | Environmental | Open in IMG/M |
| 3300005931 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UK9 | Environmental | Open in IMG/M |
| 3300005935 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKN | Environmental | Open in IMG/M |
| 3300006027 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006029 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006164 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNA | Environmental | Open in IMG/M |
| 3300006165 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG006-DNA | Environmental | Open in IMG/M |
| 3300006190 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG058-DNA | Environmental | Open in IMG/M |
| 3300006193 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG029-DNA | Environmental | Open in IMG/M |
| 3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
| 3300006737 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG | Environmental | Open in IMG/M |
| 3300006749 | Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006789 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG | Environmental | Open in IMG/M |
| 3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300006921 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG | Environmental | Open in IMG/M |
| 3300006922 | Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG | Environmental | Open in IMG/M |
| 3300006925 | Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG | Environmental | Open in IMG/M |
| 3300006929 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG | Environmental | Open in IMG/M |
| 3300006947 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNA | Environmental | Open in IMG/M |
| 3300006990 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG | Environmental | Open in IMG/M |
| 3300007229 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007276 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 | Environmental | Open in IMG/M |
| 3300007344 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 | Environmental | Open in IMG/M |
| 3300007345 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 | Environmental | Open in IMG/M |
| 3300007346 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 | Environmental | Open in IMG/M |
| 3300007548 | Estuarine microbial communities from the Columbia River estuary - metaG 1548B-3 | Environmental | Open in IMG/M |
| 3300007640 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 | Environmental | Open in IMG/M |
| 3300007863 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1459B_0.2um | Environmental | Open in IMG/M |
| 3300008012 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300008221 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_66 | Environmental | Open in IMG/M |
| 3300009051 | Estuarine microbial communities from the Columbia River estuary - metaG 1449B-02 | Environmental | Open in IMG/M |
| 3300009071 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 | Environmental | Open in IMG/M |
| 3300009077 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328 | Environmental | Open in IMG/M |
| 3300009079 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741 | Environmental | Open in IMG/M |
| 3300009149 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG | Environmental | Open in IMG/M |
| 3300009172 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 | Environmental | Open in IMG/M |
| 3300009173 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_134 | Environmental | Open in IMG/M |
| 3300009409 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_150 | Environmental | Open in IMG/M |
| 3300009420 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 | Environmental | Open in IMG/M |
| 3300009422 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138 | Environmental | Open in IMG/M |
| 3300009423 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100423 | Environmental | Open in IMG/M |
| 3300009425 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 | Environmental | Open in IMG/M |
| 3300009426 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100420 | Environmental | Open in IMG/M |
| 3300009428 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 | Environmental | Open in IMG/M |
| 3300009435 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413 | Environmental | Open in IMG/M |
| 3300009436 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome | Environmental | Open in IMG/M |
| 3300009441 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M Metagenome | Environmental | Open in IMG/M |
| 3300009481 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG | Environmental | Open in IMG/M |
| 3300009507 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 | Environmental | Open in IMG/M |
| 3300009512 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 | Environmental | Open in IMG/M |
| 3300009526 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90 | Environmental | Open in IMG/M |
| 3300009550 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 Metagenome | Environmental | Open in IMG/M |
| 3300009593 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome | Environmental | Open in IMG/M |
| 3300009703 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV12_W25 metaG | Environmental | Open in IMG/M |
| 3300009705 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128 | Environmental | Open in IMG/M |
| 3300009786 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_126 | Environmental | Open in IMG/M |
| 3300009790 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT10 Metagenome | Environmental | Open in IMG/M |
| 3300010148 | Marine viral communities from the Subarctic Pacific Ocean - 9B_ETSP_OMZ_AT15188_CsCl metaG | Environmental | Open in IMG/M |
| 3300010150 | Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaG | Environmental | Open in IMG/M |
| 3300010151 | Marine viral communities from the Subarctic Pacific Ocean - 22_ETSP_OMZ_AT15343 metaG | Environmental | Open in IMG/M |
| 3300010153 | Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaG | Environmental | Open in IMG/M |
| 3300010300 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNA | Environmental | Open in IMG/M |
| 3300010368 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300011013 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV10_white metaG | Environmental | Open in IMG/M |
| 3300011252 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_4, permeate | Environmental | Open in IMG/M |
| 3300011253 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_2, permeate | Environmental | Open in IMG/M |
| 3300011258 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_1, permeate | Environmental | Open in IMG/M |
| 3300012920 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaG | Environmental | Open in IMG/M |
| 3300012952 | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 4 Metagenome | Environmental | Open in IMG/M |
| 3300013010 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_DNA | Environmental | Open in IMG/M |
| 3300017697 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2) | Environmental | Open in IMG/M |
| 3300017706 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_13 viral metaG | Environmental | Open in IMG/M |
| 3300017708 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_04 viral metaG | Environmental | Open in IMG/M |
| 3300017713 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 | Environmental | Open in IMG/M |
| 3300017714 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15 | Environmental | Open in IMG/M |
| 3300017717 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 27 SPOT_SRF_2011-10-25 | Environmental | Open in IMG/M |
| 3300017719 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 | Environmental | Open in IMG/M |
| 3300017726 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24 | Environmental | Open in IMG/M |
| 3300017728 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 42 SPOT_SRF_2013-04-24 | Environmental | Open in IMG/M |
| 3300017729 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 19 SPOT_SRF_2011-01-11 | Environmental | Open in IMG/M |
| 3300017731 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 39 SPOT_SRF_2013-01-16 | Environmental | Open in IMG/M |
| 3300017734 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24 (version 2) | Environmental | Open in IMG/M |
| 3300017740 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 41 SPOT_SRF_2013-03-13 | Environmental | Open in IMG/M |
| 3300017741 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 44 SPOT_SRF_2013-06-19 | Environmental | Open in IMG/M |
| 3300017742 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 22 SPOT_SRF_2011-05-21 | Environmental | Open in IMG/M |
| 3300017743 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 25 SPOT_SRF_2011-08-17 | Environmental | Open in IMG/M |
| 3300017749 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 | Environmental | Open in IMG/M |
| 3300017750 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 28 SPOT_SRF_2011-11-29 | Environmental | Open in IMG/M |
| 3300017751 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 (version 2) | Environmental | Open in IMG/M |
| 3300017752 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 23 SPOT_SRF_2011-06-22 | Environmental | Open in IMG/M |
| 3300017753 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 30 SPOT_SRF_2012-01-26 | Environmental | Open in IMG/M |
| 3300017755 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 34 SPOT_SRF_2012-07-09 | Environmental | Open in IMG/M |
| 3300017756 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 | Environmental | Open in IMG/M |
| 3300017757 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 43 SPOT_SRF_2013-05-22 | Environmental | Open in IMG/M |
| 3300017758 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 32 SPOT_SRF_2012-05-30 | Environmental | Open in IMG/M |
| 3300017759 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 37 SPOT_SRF_2012-11-28 | Environmental | Open in IMG/M |
| 3300017760 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 31 SPOT_SRF_2012-02-16 | Environmental | Open in IMG/M |
| 3300017762 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 45 SPOT_SRF_2013-07-18 | Environmental | Open in IMG/M |
| 3300017764 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 8 SPOT_SRF_2010-02-11 | Environmental | Open in IMG/M |
| 3300017765 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 36 SPOT_SRF_2012-09-28 | Environmental | Open in IMG/M |
| 3300017767 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 29 SPOT_SRF_2011-12-20 | Environmental | Open in IMG/M |
| 3300017769 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 (version 2) | Environmental | Open in IMG/M |
| 3300017770 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 (version 2) | Environmental | Open in IMG/M |
| 3300017781 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14 | Environmental | Open in IMG/M |
| 3300017782 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19 | Environmental | Open in IMG/M |
| 3300017783 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 2 SPOT_SRF_2009-07-10 | Environmental | Open in IMG/M |
| 3300017786 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18 | Environmental | Open in IMG/M |
| 3300018041 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041407BS metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019459 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011511BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300020253 | Marine microbial communities from Tara Oceans - TARA_B100000780 (ERX555982-ERR598945) | Environmental | Open in IMG/M |
| 3300020372 | Marine microbial communities from Tara Oceans - TARA_B100000787 (ERX556133-ERR599090) | Environmental | Open in IMG/M |
| 3300020388 | Marine microbial communities from Tara Oceans - TARA_B100001063 (ERX555965-ERR599064) | Environmental | Open in IMG/M |
| 3300020392 | Marine microbial communities from Tara Oceans - TARA_B100000963 (ERX555916-ERR599163) | Environmental | Open in IMG/M |
| 3300020403 | Marine microbial communities from Tara Oceans - TARA_B100000085 (ERX556015-ERR599145) | Environmental | Open in IMG/M |
| 3300020417 | Marine microbial communities from Tara Oceans - TARA_B100000073 (ERX556034-ERR599082) | Environmental | Open in IMG/M |
| 3300020440 | Marine microbial communities from Tara Oceans - TARA_E500000178 (ERX555952-ERR599043) | Environmental | Open in IMG/M |
| 3300020450 | Marine microbial communities from Tara Oceans - TARA_B100000575 (ERX555933-ERR599077) | Environmental | Open in IMG/M |
| 3300020452 | Marine microbial communities from Tara Oceans - TARA_B100001173 (ERX556054-ERR599078) | Environmental | Open in IMG/M |
| 3300020459 | Marine microbial communities from Tara Oceans - TARA_X000000368 (ERX555913-ERR599095) | Environmental | Open in IMG/M |
| 3300020463 | Marine microbial communities from Tara Oceans - TARA_B100001057 (ERX555988-ERR599050) | Environmental | Open in IMG/M |
| 3300020469 | Marine microbial communities from Tara Oceans - TARA_B100001093 (ERX555967-ERR599052) | Environmental | Open in IMG/M |
| 3300020474 | Marine prokaryotic communities collected during Tara Oceans survey from station TARA_151 - TARA_B100001564 (ERX555957-ERR598976) | Environmental | Open in IMG/M |
| 3300021347 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO266 | Environmental | Open in IMG/M |
| 3300021375 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO132 | Environmental | Open in IMG/M |
| 3300021378 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO131 | Environmental | Open in IMG/M |
| 3300021957 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18D | Environmental | Open in IMG/M |
| 3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
| 3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
| 3300022053 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v2) | Environmental | Open in IMG/M |
| 3300022061 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v2) | Environmental | Open in IMG/M |
| 3300022065 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v2) | Environmental | Open in IMG/M |
| 3300022068 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (v2) | Environmental | Open in IMG/M |
| 3300022072 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v3) | Environmental | Open in IMG/M |
| 3300022178 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v3) | Environmental | Open in IMG/M |
| 3300022183 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v3) | Environmental | Open in IMG/M |
| 3300022187 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3) | Environmental | Open in IMG/M |
| 3300022822 | Saline water microbial communities from Ace Lake, Antarctica - #293 | Environmental | Open in IMG/M |
| 3300022848 | Saline water microbial communities from Ace Lake, Antarctica - #866 | Environmental | Open in IMG/M |
| 3300022853 | Saline water microbial communities from Ace Lake, Antarctica - #371 | Environmental | Open in IMG/M |
| 3300022925 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG | Environmental | Open in IMG/M |
| 3300022931 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_100_MG | Environmental | Open in IMG/M |
| 3300023293 | Saline water microbial communities from Ace Lake, Antarctica - #1165 | Environmental | Open in IMG/M |
| 3300023294 | Saline water microbial communities from Ace Lake, Antarctica - #732 | Environmental | Open in IMG/M |
| 3300023685 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 50R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024255 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_123_September2016_10_MG | Environmental | Open in IMG/M |
| 3300024264 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_124_October2016_10_MG | Environmental | Open in IMG/M |
| 3300024344 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300024518 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_2 | Environmental | Open in IMG/M |
| 3300025048 | Marine viral communities from the Subarctic Pacific Ocean - LP-49 (SPAdes) | Environmental | Open in IMG/M |
| 3300025070 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025071 | Marine viral communities from the Pacific Ocean - LP-36 (SPAdes) | Environmental | Open in IMG/M |
| 3300025079 | Marine viral communities from the Pacific Ocean - LP-48 (SPAdes) | Environmental | Open in IMG/M |
| 3300025083 | Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025084 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025085 | Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025086 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025103 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025120 | Marine viral communities from the Pacific Ocean - LP-28 (SPAdes) | Environmental | Open in IMG/M |
| 3300025128 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025132 | Marine viral communities from the Pacific Ocean - ETNP_2_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300025137 | Marine viral communities from the Pacific Ocean - LP-32 (SPAdes) | Environmental | Open in IMG/M |
| 3300025138 | Marine viral communities from the Pacific Ocean - LP-40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025151 | Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025237 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_38 (SPAdes) | Environmental | Open in IMG/M |
| 3300025266 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_66 (SPAdes) | Environmental | Open in IMG/M |
| 3300025276 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 (SPAdes) | Environmental | Open in IMG/M |
| 3300025502 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKJ (SPAdes) | Environmental | Open in IMG/M |
| 3300025508 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025543 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025632 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413 (SPAdes) | Environmental | Open in IMG/M |
| 3300025645 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300025652 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (SPAdes) | Environmental | Open in IMG/M |
| 3300025671 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes) | Environmental | Open in IMG/M |
| 3300025674 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025759 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes) | Environmental | Open in IMG/M |
| 3300025803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025806 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025816 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 (SPAdes) | Environmental | Open in IMG/M |
| 3300025853 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes) | Environmental | Open in IMG/M |
| 3300025869 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 (SPAdes) | Environmental | Open in IMG/M |
| 3300025890 | Pelagic Microbial community sample from North Sea - COGITO 998_met_08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025894 | Pelagic Microbial community sample from North Sea - COGITO 998_met_09 (SPAdes) | Environmental | Open in IMG/M |
| 3300027081 | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - C0912_C33A6_35 (SPAdes) | Environmental | Open in IMG/M |
| 3300027522 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG058-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027668 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG104-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027704 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027714 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027752 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300027779 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300027801 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300027813 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300027847 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_126 (SPAdes) | Environmental | Open in IMG/M |
| 3300027859 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300027906 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300028125 | Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - SB | Environmental | Open in IMG/M |
| 3300028198 | Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI106_100 | Environmental | Open in IMG/M |
| 3300028600 | Marine sediment microbial communities from subtidal zone of North Sea - Hel_20160317 (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300029309 | Marine viral communities collected during Tara Oceans survey from station TARA_100 - TARA_R100001440 | Environmental | Open in IMG/M |
| 3300029448 | Marine viral communities collected during Tara Oceans survey from station TARA_023 - TARA_E500000082 | Environmental | Open in IMG/M |
| 3300029787 | Marine viral communities collected during Tara Oceans survey from station TARA_018 - TARA_A100000172 | Environmental | Open in IMG/M |
| 3300031167 | Marine microbial communities from water near the shore, Antarctic Ocean - #418 | Environmental | Open in IMG/M |
| 3300031519 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2 | Environmental | Open in IMG/M |
| 3300031644 | Marine microbial communities from water near the shore, Antarctic Ocean - #5 | Environmental | Open in IMG/M |
| 3300031659 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #82 | Environmental | Open in IMG/M |
| 3300032277 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month pyrrhotite | Environmental | Open in IMG/M |
| 3300033742 | Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - 2018 seawater | Environmental | Open in IMG/M |
| 3300034374 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4) | Environmental | Open in IMG/M |
| 3300034375 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v4) | Environmental | Open in IMG/M |
| 3300034418 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v4) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2010_100081124 | 3300000101 | Marine | MNKINKIIYDIKTDIDNNTSKYIIILGVLFVISIII* |
| DelMOSum2010_100092984 | 3300000101 | Marine | MDKINKIIYDIKTDIDNNTSKYIIILGVLFVISIII* |
| DelMOSum2010_100113836 | 3300000101 | Marine | MDKIKKIIYDVKTDIDNNTSKYIIILGVLFVISIIL* |
| DelMOSum2010_100126052 | 3300000101 | Marine | MDKIRKIIYDLKTDIDNNTSKYIIILGVLFVISIIL* |
| DelMOSum2010_100243983 | 3300000101 | Marine | MNKINKLIYDLKTDIDNNTSKYIIILGILFIISIIS* |
| DelMOSum2010_100403995 | 3300000101 | Marine | MDKINKLIYDLKTDIDNNTSKYIIILGVLFVISIIL* |
| DelMOSum2010_100878622 | 3300000101 | Marine | MDKINKIIYDLKTDIDNNTSKYIXILGLLFVISIIS* |
| DelMOSum2010_101063722 | 3300000101 | Marine | MDKIRKLIYDLKTDIDNNTSKYIIILGVLFVISIIL* |
| DelMOSum2010_101081742 | 3300000101 | Marine | MDKINKIIYDLKTDIDNNTSKYIVILGVLFIISIIL* |
| DelMOSum2010_101112341 | 3300000101 | Marine | MDKINKIIYDLKTDIDNNTSKYIIILGVLFVISIIS* |
| DelMOSum2010_101131622 | 3300000101 | Marine | MDKIRKLIYDVKTDIDNNTSKYIIILGVLFVISIIS* |
| DelMOSum2010_101900472 | 3300000101 | Marine | IIMDKINKIIYDLKTDIDNNTSKYIIILGVLFVISIII* |
| DelMOSum2010_102011652 | 3300000101 | Marine | MDKINKIIYDLKTDIDNNTSKYIIILGVLFVISIIL* |
| DelMOSum2010_102310991 | 3300000101 | Marine | IIMDKINKIIYDLKTDIDNNTSKYIIILGVLFVMSIIL* |
| DelMOSum2011_100762002 | 3300000115 | Marine | MNKINKIIYDIKTDIDNNTSKYIIILGVLFVISIIA* |
| DelMOSum2011_100791631 | 3300000115 | Marine | DKINKIIYDLKTDIDNNTSKYIIILGVLFVISIIS* |
| DelMOSum2011_100906261 | 3300000115 | Marine | IIMDKINKIIYDLKTDIDNNTSKYIIILGVLFIISIIL* |
| DelMOSpr2010_100390284 | 3300000116 | Marine | MDKINKIIYDLKTDIDNNTSKYIIILGVLFIISIIL* |
| DelMOSpr2010_100929692 | 3300000116 | Marine | MDKINKIIYDLKTDIDNNTSKYIVILGMLFIISIIS* |
| DelMOSpr2010_101050372 | 3300000116 | Marine | MDKINKIIYDLKTDIDNNTSKYIIILGVLFVMSIIL* |
| DelMOSpr2010_101328932 | 3300000116 | Marine | MDKINKIIYDLKTDIDNNTSKYILVLFGLFIISVII* |
| DelMOSpr2010_102131471 | 3300000116 | Marine | RWSRWIIRRTIIMDKINKIIYDLKTDIDNNTSKYIFILGLLFVISIIS* |
| DelMOSpr2010_102265272 | 3300000116 | Marine | MDKINKIIYDLKTDIDNNTSKYIFILGLLFVISIIS* |
| DelMOSpr2010_102701902 | 3300000116 | Marine | MNKINKLIYDLKTDIDNNTTKYIVILGVLFVISIIL* |
| DelMOWin2010_100483363 | 3300000117 | Marine | MDKINKIIYDLKTDIDNNTSKYIIILGALFVISIIL* |
| DelMOWin2010_101444702 | 3300000117 | Marine | DKIKKIIYDVKTDIDNNTSKYIIILGVLFVISIIL* |
| DelMOWin2010_102124271 | 3300000117 | Marine | MDKIKKIIYDVKTDIDNNTSKYIIILGVLFVISIIS* |
| JGI24006J15134_100241313 | 3300001450 | Marine | MNKINKLIYDIKTDIDNNTSKYIIILGVLFVISIIL* |
| JGI24006J15134_100279644 | 3300001450 | Marine | MDKINKLIYDLKTDIDNNTTKYIVILGVLFVISIIL* |
| JGI24006J15134_100840094 | 3300001450 | Marine | MNKINKLIYDLKTDIDNNTSKYIIILGVLFVISIIL* |
| JGI24006J15134_100844752 | 3300001450 | Marine | MDKIKKLIYDVKTDIDNNTSKYIIILGVLFVISIIL* |
| JGI24006J15134_100861644 | 3300001450 | Marine | MDKINKLIYDLKTDIDNNTSKYIIGLGVLFVISIIL* |
| JGI24006J15134_101262421 | 3300001450 | Marine | CFNWWWFRIIRRTIIMDKINKIIYDLKTDIDNNTSKYIIILGVLFVISIIL* |
| JGI24003J15210_100088364 | 3300001460 | Marine | MNKINKIIYDFKTDIDNNTSKYIIILGVLFIISIIS* |
| JGI24003J15210_100213852 | 3300001460 | Marine | MNKIKKLIYDLKTDIDNNTSKYIIILGVLFVISIIS* |
| JGI24003J15210_100353444 | 3300001460 | Marine | MDKIRKLIYDLKTDIDNNTSKYIIILGVLFVISIIS* |
| JGI24003J15210_100364502 | 3300001460 | Marine | MDKINKIIYDLKTDIDNNTTKYIIILGVLFVISIII* |
| JGI24003J15210_100416773 | 3300001460 | Marine | MNKINKIIYDLKTDIDNNTSKYIIILGVLFVVSIIL* |
| JGI24003J15210_100480171 | 3300001460 | Marine | IRRTIIMDKINKIIYDLKTDIDNNTSKYIIILGVLFVISIIL* |
| JGI24003J15210_100546311 | 3300001460 | Marine | MDKINKIIYDLKTDIDNNTTKYIIILGVLFIVSIIL* |
| JGI24003J15210_100551061 | 3300001460 | Marine | MDKINKIIYDLKTDIDNNTSKYIIILGVLLVISIIL* |
| JGI24003J15210_100604353 | 3300001460 | Marine | MDKINKIIYDLKTDINSNTSKYIIILGVLFVVSIIL* |
| JGI24003J15210_100771461 | 3300001460 | Marine | MDKINKLIYDLKTDIDNNTSKYIIILGILFIISIIS* |
| JGI24003J15210_101018982 | 3300001460 | Marine | MDKINKIIYDLKTDIDNNTTKYXIILGVLFVISIIL* |
| JGI24004J15324_100210923 | 3300001472 | Marine | MNKINKLIYDLKTDIDNNTSKYIIILGGLFVISIIL* |
| JGI24004J15324_100284673 | 3300001472 | Marine | MDKINKLIYDLKTDIDNNTSKYIIGLGVLFVISIII* |
| JGI24004J15324_101538591 | 3300001472 | Marine | RRTIIMDKIRKLIYDLKTDIDNNTSKYIIILGVLFVISIIS* |
| JGI24005J15628_100557072 | 3300001589 | Marine | MDKINKIIYDLKTDIDNNTSKYIFILGVLFVISIIS* |
| JGI24005J15628_100617121 | 3300001589 | Marine | KINKIIYDLKTDIDNNTSKYIIILGVLFVISIIL* |
| JGI24005J15628_100624861 | 3300001589 | Marine | MDKINKIIYDLKTEIDNNTSKYIIILGVLFVISIII* |
| JGI24005J15628_100789862 | 3300001589 | Marine | MDKINKIIYDLKTDIDNNTSKYIVILGVLFVISIIL* |
| JGI24005J15628_101769732 | 3300001589 | Marine | RTIIMDKINKIIYDLKTDIDNNTSKYIIILGVLFVVSIIL* |
| GOS2218_10255213 | 3300001947 | Marine | TWRISIMNKINKLIYDLKTDIDNNTSKYIIILGILFIISIIS* |
| KVRMV2_1014537892 | 3300002231 | Marine Sediment | SIIMDKIKKLIYDVKTDIDSNTSKYIIILGVLFVISIIL* |
| KVWGV2_103286559 | 3300002242 | Marine Sediment | MDKINKIIYDLKTDIDSNTSKYIIILGVLFVVAIII* |
| JGI25132J35274_10241091 | 3300002483 | Marine | IRRTIIMNKINKLIYDLKTDIDNNTSKYIIILGVLFVVSIIL* |
| Ga0073579_10924711 | 3300005239 | Marine | RRIIIMDKINKLIYDLKTDIDNNTSKYIIILGVLFVISIII* |
| Ga0078893_100113112 | 3300005837 | Marine Surface Water | IIMDKIKKIIYDVKTDIDNNTSKYIIILSVLFVISIIL* |
| Ga0075109_10976192 | 3300005912 | Saline Lake | RWSFIMDKINKIIYDLKTDIDNNTSKYIFILGVLFVISIIS* |
| Ga0075108_102781332 | 3300005913 | Saline Lake | LRWSFIMDKINKIIYDLKTDIDNNTSKYILVLFGLFIISIIL* |
| Ga0075108_102781732 | 3300005913 | Saline Lake | MDKINKIIYDLKTDIDNNTSKYIIILGVLFAILIIL* |
| Ga0075119_10473163 | 3300005931 | Saline Lake | IMDKINKIIYDLKTDIDNNTSKYILVLFGLFIISIIL* |
| Ga0075119_10898111 | 3300005931 | Saline Lake | RLLRWSFIMDKINKIIYDLKTDIDNNTSKYILVLFGLFIISIIL* |
| Ga0075119_11087471 | 3300005931 | Saline Lake | MDKINKIIYDLKTDIDNNTSKYILVLFGLFIISII |
| Ga0075119_11138642 | 3300005931 | Saline Lake | MDKINKIIYDLKTDIDNNTSKYIIILGVLFVILIIL* |
| Ga0075125_102892472 | 3300005935 | Saline Lake | MDKINKIIYDLKTDIDNNTSKYILVLFGLFIISIII* |
| Ga0075462_100021864 | 3300006027 | Aqueous | MDKINKLIYDLKTDIDNNTSKYIIILGALFVISIIL* |
| Ga0075462_100154053 | 3300006027 | Aqueous | MNKINKIIYDIKTDIDNNTSKYIIILGVLFVVSIIL* |
| Ga0075462_100707901 | 3300006027 | Aqueous | CCCRWTIRRTIIMDKINKLIYDLKTDIDNNTSKYIIILGVLFVISIIV* |
| Ga0075462_101963881 | 3300006027 | Aqueous | IIRRTIIMDKINKIIYDLKTDIDNNTSKYIVILGVLFIISIIL* |
| Ga0075466_10168383 | 3300006029 | Aqueous | MDKIKKVIYDIKTDIDNNTSKYIIILGVLFVISIIS* |
| Ga0075466_10367682 | 3300006029 | Aqueous | MDKINKLIYDLKTDIDNNTSKYIIILGVLFVISIIV* |
| Ga0075466_10381601 | 3300006029 | Aqueous | MDKIRKLIYDLKTDIDNNTSKYIIILGVLFLISIIS* |
| Ga0075466_10625041 | 3300006029 | Aqueous | SRWIIRRTIIMDKINKIIYDLKTDIDNNTSKYIIILGVLFIISIIL* |
| Ga0075466_11554222 | 3300006029 | Aqueous | KINKIIYDLKTDIDNNTSKYIIILGVLFVISIIS* |
| Ga0075466_11791111 | 3300006029 | Aqueous | RWIIRRTIIMDKINKIIYDLKTDIDNNTSKYIIILGVLFLISIIL* |
| Ga0075441_100531622 | 3300006164 | Marine | MDKINKIIYDLKTEINNNTSKYIIILGALFIISIII* |
| Ga0075441_100617052 | 3300006164 | Marine | MDKINKIIYDLKADIDNNTSKYIIILGVLFVISIIL* |
| Ga0075441_101122522 | 3300006164 | Marine | SNWWCIIRRTIIMDKINKIIYDLKADIDNNTSKYIIILGVLFIVSIIL* |
| Ga0075441_101880712 | 3300006164 | Marine | MDKINKIIYDLKTDIDNNTSKYIVILGVLFVISIIS* |
| Ga0075441_102065971 | 3300006164 | Marine | FIMDKINKIIYDLKTDIDNNTSKYILVLFGLFIISIIL* |
| Ga0075441_103424392 | 3300006164 | Marine | MDKINKIIYDLKTDIDNNTSKYIVILGVLFLISIIS* |
| Ga0075443_100037867 | 3300006165 | Marine | MDKIHKIIYDIKTDIDQNTSKYIIGLIIFCIISIIL* |
| Ga0075443_100250644 | 3300006165 | Marine | MDKINKIIYDIKRDIDHNTSKYIIIIGVLFVISIIL* |
| Ga0075443_102582343 | 3300006165 | Marine | MDKINKIIYDLKTDIDNNTSKYIVILGVLFIISIIS* |
| Ga0075446_100704401 | 3300006190 | Marine | WNGCCWWCFSWIIRRTIIMDKINKIIYDLKTDIDNNTSKYIVILGVLFIISIIL* |
| Ga0075445_100985751 | 3300006193 | Marine | CIIRRTIIMDKINKIIYDLKADIDNNTSKYIIILGVLFIVSIIL* |
| Ga0075445_102466871 | 3300006193 | Marine | IRRTIIMDKINKIIYDLKTDIDNNTSKYIVILGVLFIISIIL* |
| Ga0098038_10385061 | 3300006735 | Marine | KMDKINKIIYDFKTDIDNNTSKYIIILGVLFVISIIT* |
| Ga0098038_10517933 | 3300006735 | Marine | MKKINKLIYDLKTDIDNNTSKYIIILGVLFVISIIA* |
| Ga0098038_10796962 | 3300006735 | Marine | MEKINKIIYDLKTDIDNNTSKYIIILGILFVISIIA* |
| Ga0098038_11030722 | 3300006735 | Marine | MNKINKLIYDLKTDIDNNTSKYIIILGVLFVVSIIL* |
| Ga0098038_11936291 | 3300006735 | Marine | MDKINKIIYDIKTDIDNNTSKYIIILGVLFVISIIA* |
| Ga0098038_11953482 | 3300006735 | Marine | MNKINKLIYDLKTDIDNNTSKYILILGVLFVISIIA* |
| Ga0098037_10068665 | 3300006737 | Marine | MNKINKIIYNLKTDIDNNTSKYIFILGILFVVSIIL* |
| Ga0098037_10448473 | 3300006737 | Marine | CRWTIRRTIIMNKINKLIYDLKTDIDNNTSKYIIILGVLFVVSIIL* |
| Ga0098037_11012932 | 3300006737 | Marine | MEKINKIIYDLKTDIDNNTSKYIIILGVLFVVSIIL* |
| Ga0098037_11217112 | 3300006737 | Marine | MDKINKIIYDLKTDIDNNTSKYIIILGVLFIVSIIL* |
| Ga0098037_11251621 | 3300006737 | Marine | SRCYSWWYRWIIRRTIIMDKINKIIYDLKTDIDNNTSKYIIILGVLFVISIIL* |
| Ga0098037_12865082 | 3300006737 | Marine | IRRTIIMNKINKLIYDLKTDIDNNTSKYIIILGVLFVISIIA* |
| Ga0098042_10814342 | 3300006749 | Marine | MDKINKLIYDFKTDIDNNTSKYIIILGVLFVISIIA* |
| Ga0098048_10575692 | 3300006752 | Marine | YRWNWWFIRRTIIMDKIRKLIYDVKTDIDNNTSKYIIILGVLFVISIIL* |
| Ga0098048_10963833 | 3300006752 | Marine | MDKINKIIYDIKTDIDNNTSKYIIILSVLFLVSIIL* |
| Ga0098048_11550752 | 3300006752 | Marine | WSSRCINRWWFRIIRRTIIMDKIRKLIYDVKTDIDNNTSKYIIILGVLFVISIIL* |
| Ga0098054_10235901 | 3300006789 | Marine | MDKINKIIYDLKTDIDNNTSKYIIILGVLFVISIII* |
| Ga0098054_10921642 | 3300006789 | Marine | IRRTIIMDKIRKLIYDVKTDIDNNTSKYIIILGVLFVISIIL* |
| Ga0098054_11508712 | 3300006789 | Marine | MDKIRKLVYDLKTDIDNNTSKYIIILGVLFLISIIS* |
| Ga0098055_10351433 | 3300006793 | Marine | MDKINKIIYDIKTDIDNNTSKYIIILGVLFVISIIS* |
| Ga0098055_11004474 | 3300006793 | Marine | MDKINKIIYDIKTDIDNNTSKYIIILGVLFVVSIIL* |
| Ga0098055_13197931 | 3300006793 | Marine | MNKINKLIYDLKTDIDNNTSKYIIILGVLFVISIIA* |
| Ga0098055_13556413 | 3300006793 | Marine | MDKINKIIYDLKTDIDNNTSKYIIILSVLFLVSIIL* |
| Ga0098055_13744452 | 3300006793 | Marine | MQKIKKIIYNLKTDIDNNTSKYIFILGILFVVSII |
| Ga0070749_101273252 | 3300006802 | Aqueous | MDKINKLIYDLKTDIDNNTSKYIIILGVLFVISIIT* |
| Ga0075467_101779081 | 3300006803 | Aqueous | YRWNWWFIRRTIIMDKIKKIIYDVKTDIDNNTSKYIIILGVLFVISIIL* |
| Ga0075467_107216572 | 3300006803 | Aqueous | WIIRRTIIMDKINKIIYDLKTDIDNNTSKYIIILGVLFIISIIL* |
| Ga0070754_100542543 | 3300006810 | Aqueous | MNKINKLIYDLKTDIDNNTSKYIIILGFLFVVSIIL* |
| Ga0070754_101263571 | 3300006810 | Aqueous | TIIMDKINKIIYDLKTDIDNNTSKYIIILGVLFVMSIIL* |
| Ga0070754_101501902 | 3300006810 | Aqueous | MDKINKIIYDLKTDIDNNTSKYIIILSVLFVISIIL* |
| Ga0070754_101930112 | 3300006810 | Aqueous | IIRRTIIMDKINKIIYDLKTDIDNNTSKYIIILGVLFVISIII* |
| Ga0070750_100190713 | 3300006916 | Aqueous | MDKINKIIYDLKTDIDNNTSKYIIILSVLFVISVIV* |
| Ga0070750_100928011 | 3300006916 | Aqueous | IRRTIIMNKINKIIYDIKTDIDNNTSKYIIILGVLFVVSIIL* |
| Ga0070750_103783932 | 3300006916 | Aqueous | IRRTIIMDKINKIIYDLKTDIDNNTSKYIIILGVLFVISIII* |
| Ga0070748_10902911 | 3300006920 | Aqueous | IMDKINKIIYDLKTDIDNNTSKYIIILGVLFVISIIS* |
| Ga0070748_12720322 | 3300006920 | Aqueous | FIIMDKINKIIYDLKTDIDNNTSKYIIILGVLFVISIII* |
| Ga0070748_13574442 | 3300006920 | Aqueous | RTIIMDKINKIIYDLKTDIDNNTSKYIIILGVLFLISIIL* |
| Ga0070748_13737681 | 3300006920 | Aqueous | WRTFIMNKINKLIYDLKTDIDNNTSKYIIILGILFIISIIS* |
| Ga0098060_11996082 | 3300006921 | Marine | CIRRTIIMDKINKIIYDIKTDIDNNTSKYIIILGVLFVISIIA* |
| Ga0098060_12033772 | 3300006921 | Marine | IRRTIIMDKINKIIYDIKTDIDNNTSKYIIILGVLFVISIIA* |
| Ga0098045_10092563 | 3300006922 | Marine | MDKINKIIYDIKTDIDNNTSKYIIILGVLFLVSIIL* |
| Ga0098050_11547852 | 3300006925 | Marine | MDKINKIIYDLKTDIDNNTSKYIIILGVLFVISIIA* |
| Ga0098036_10811702 | 3300006929 | Marine | MDKINKLIYDLKTDIDNNTSKYIIGLGVLFVISIIV* |
| Ga0075444_101077652 | 3300006947 | Marine | WSNWWCIIRRTIIMDKINKIIYDLKADIDNNTSKYIIILGVLFIVSIIL* |
| Ga0075444_101673522 | 3300006947 | Marine | MDKINKIIYDLKADINNNTSKYIIILSGLFVISIIL* |
| Ga0075444_102137472 | 3300006947 | Marine | DKIHKIIYDIKTDIDHNTSKYIIILGVLFVISIIL* |
| Ga0075444_103238162 | 3300006947 | Marine | WSFIMDKINKIIYDLKTDIDNNTSKYILVLFGLFIISIIL* |
| Ga0098046_10411372 | 3300006990 | Marine | MNKINKIIYDLKTDIDNNTSKYIIILGVLFVISIIL* |
| Ga0098046_10984042 | 3300006990 | Marine | MDKINKLIYDLKTDIDNNTSKYIIILGVLFVVSIIL* |
| Ga0075468_100190601 | 3300007229 | Aqueous | MNKIRKLIYDFKTDIDNNTSKYIIILGVLFVISIIS* |
| Ga0075468_100498801 | 3300007229 | Aqueous | RRTIIMDKIKKIIYDVKTDIDNNTSKYIIILGVLFVISIIL* |
| Ga0075468_100712072 | 3300007229 | Aqueous | WWSRWIIRRTIIMDKINKIIYDLKTDIDNNTSKYIIILGVLFIISIIL* |
| Ga0075468_102010762 | 3300007229 | Aqueous | IIRRTIIMDKINKIIYDLKTDIDNNTSKYIIILGVLFVISIIL* |
| Ga0070747_10279902 | 3300007276 | Aqueous | MDKINKIIYDLKTDIDNNTSKYIIILSILFVISIIL* |
| Ga0070747_10901151 | 3300007276 | Aqueous | INRWWSRILRRVIIMNKINKLIYDLKTDIDNNTSKYIIILGVLFVISIIL* |
| Ga0070747_11248442 | 3300007276 | Aqueous | MNKIKKIIYDFKTDIDNNTSKYIIILGVLFLISIIS* |
| Ga0070747_11267522 | 3300007276 | Aqueous | RRTIIMDKINKIIYDLKTDIDNNTSKYIIILGVLFVISIIL* |
| Ga0070747_11403972 | 3300007276 | Aqueous | MDKINKIIYDLKTDIDNNTSKYIIILGVLFLISIIL* |
| Ga0070747_12542112 | 3300007276 | Aqueous | RRTIIMDKINKIIYDLKTDIDNNTSKYIIILGVLFVISIIS* |
| Ga0070745_11155022 | 3300007344 | Aqueous | LMDKINKIIYDLKTDIDNNTSKYIVILGVLFIISIIL* |
| Ga0070752_11812392 | 3300007345 | Aqueous | RTIIMDKINKIIYDLKTDIDNNTSKYIIILGVLFVISIIL* |
| Ga0070752_13439462 | 3300007345 | Aqueous | WWFRLLRRTIIMDKINKIIYDLKTDIDNNTSKYIIILGVLFVMSIIL* |
| Ga0070753_12396412 | 3300007346 | Aqueous | MDKIRKLIYDVKTDIDNNTSKYIVILGVLFVISIIS* |
| Ga0102877_12333472 | 3300007548 | Estuarine | MDKINKIIYDLKTDIDNNTTKYIIILGVLFVISIIL* |
| Ga0070751_11667231 | 3300007640 | Aqueous | RIIRRTIIMDKINKIIYDLKTDIDNNTSKYIIILGVLFVISIIL* |
| Ga0105744_10109363 | 3300007863 | Estuary Water | MDKINKLIYDLKTDIDNNTSKYIIILGVLFLISIIL* |
| Ga0075480_100599993 | 3300008012 | Aqueous | WIIRRTIIMDKINKIIYDLKTDIDNNTSKYIVILGVLFVISIIS* |
| Ga0114916_10175822 | 3300008221 | Deep Ocean | MDKINKIIYDLKTDIDHNASKYIIILGVLFIISIII* |
| Ga0114916_11583761 | 3300008221 | Deep Ocean | IIIMDKINKIIYDIKRDIDHNTSKYIIIIGVLFVISIIL* |
| Ga0102864_11144101 | 3300009051 | Estuarine | WNTRSFNRCIIWRTFIMDKINKLIYDLKTDIDNNTSKYIIILGVLFLISIIL* |
| Ga0115566_102275852 | 3300009071 | Pelagic Marine | IMDKIRKLIYDVKTDIDNNTSKYIIILGVLFVISIIL* |
| Ga0115566_103732452 | 3300009071 | Pelagic Marine | IIMDKIRKLIYDVKTDIDNNTSKYIIILAVLFVISIIS* |
| Ga0115552_12355172 | 3300009077 | Pelagic Marine | MNKIRKLIYDVKTDIDNNTSKYIIILGVLFVISIIS* |
| Ga0115552_13858852 | 3300009077 | Pelagic Marine | MDKIRKLIYDFKTDIDNNTSKYIIILGVLFLISIIS* |
| Ga0102814_107374702 | 3300009079 | Estuarine | DKINKLVYDLKTDIDNNTSKYIIILGVLFVISIIL* |
| Ga0114918_103623272 | 3300009149 | Deep Subsurface | MDKINKIIYDLKTDIDNNTSKYIIILGILFVMSIIL* |
| Ga0114995_100500886 | 3300009172 | Marine | MDKINKIIYDLKTDIDNNTSKYIVILYVLFVVSIIL* |
| Ga0114996_103106262 | 3300009173 | Marine | MDKINKIIYDLKTDIDNNTSKYILILFALFIITIIL* |
| Ga0114993_113144662 | 3300009409 | Marine | IMDKINKIIYDLKTDIDNNTSKYIIILGVLFVISIIL* |
| Ga0114994_103295341 | 3300009420 | Marine | MDKINKIIYDLKTDIDNNTSKYILVLFGLFIITIIL* |
| Ga0114994_105080971 | 3300009420 | Marine | SFIMDKINKIIYDLKTDINNNTSKYILVLFALFIITIIL* |
| Ga0114998_102286972 | 3300009422 | Marine | IIMDKINKIIYDLKTDIDNNTSKYIIVLGALFIISIII* |
| Ga0115548_11502502 | 3300009423 | Pelagic Marine | MDKINKIIYDFKTDIDNNTSKYIIILGVLFLISIIL* |
| Ga0114997_100128205 | 3300009425 | Marine | MDKINKIIYDLKTDIDNNTSKYIIVLGALFIISIII* |
| Ga0114997_100557775 | 3300009425 | Marine | MDKINKIIYDLKTDIDNNTSKYILVLFGLFIISIIL* |
| Ga0114997_104587622 | 3300009425 | Marine | MNKINKIIYDLKTDIDNNTSKYIIILGMLFVISIIL* |
| Ga0115547_12998282 | 3300009426 | Pelagic Marine | RCINRWWFRIIRRTIIMDKIRKLIYDFKTDIDNNTSKYIIILGVLFVISIIS* |
| Ga0114915_11225372 | 3300009428 | Deep Ocean | WCFNRWWFRLLRRTIIMDKINKIIYDLKTDIDNNTSKYIVILGVLFIISIIL* |
| Ga0114915_11638542 | 3300009428 | Deep Ocean | MDKINKIIYDIKRDIDHNTSKYIIILGVLFVISIIL* |
| Ga0114915_11755602 | 3300009428 | Deep Ocean | MNKINKIIYDLKADIDNNTSKYIIILGVLFLISIIL* |
| Ga0114915_12106542 | 3300009428 | Deep Ocean | MDKINKIIYDLKADINNNTSKYIIILGGLFVISIIL* |
| Ga0114915_12205011 | 3300009428 | Deep Ocean | IIIMDKIHKIIYDIRTDIDQNTSKYIIGLIIFCIISIIL* |
| Ga0115546_10127861 | 3300009435 | Pelagic Marine | KINKIIYDFKTDIDNNTSKYIIILGILFLISIIL* |
| Ga0115546_11518781 | 3300009435 | Pelagic Marine | RCYHWWSRWIIRRTIIMDKINKIIYDLKTDIDNNTSKYIIILGVLFVISIIL* |
| Ga0115546_11618172 | 3300009435 | Pelagic Marine | IIMDKINKIIYDLKTDIDNNTSKYIIILGVLFVISIIL* |
| Ga0115546_13364842 | 3300009435 | Pelagic Marine | MNKIRKLIYDIKTDIDNNTSKYIIILGVLFVISIIS* |
| Ga0115546_13379993 | 3300009435 | Pelagic Marine | MDKINKIIYDLKTDIDNNTSKYIIGLGVLFVISIIV* |
| Ga0115008_109346941 | 3300009436 | Marine | MDKINKIIYDLKTDIDNNTSKYIIILGVLFVISII |
| Ga0115007_110896712 | 3300009441 | Marine | MDKINKIIYDLKTDIDNNTSKYIVILYVQFVVSIIL* |
| Ga0114932_100059253 | 3300009481 | Deep Subsurface | MDKIKKIIYDVKTDIDSNTSKYIIILGVLFVISIIL* |
| Ga0114932_100125286 | 3300009481 | Deep Subsurface | MDKINKLIYDLKTDIDNNTSKYIIILGVLFVISIIA* |
| Ga0115572_102364661 | 3300009507 | Pelagic Marine | MNKIKKLIYDVKTDIDNNTSKYIIILGVLFVISIIL* |
| Ga0115003_103445382 | 3300009512 | Marine | RTIIMDKINKIIYDLKTDIDNNTSKYILVLFGLFIISIIL* |
| Ga0115004_101826542 | 3300009526 | Marine | MNKINKIIYDLKTDIDNNTSKYIIILGVLFILSIII* |
| Ga0115013_100690993 | 3300009550 | Marine | MDKIRKLIYDAKTDIDNNTSKYIIILGVLFVISIIL* |
| Ga0115011_100197515 | 3300009593 | Marine | MDKINKIIYDLKTDIDNNTSKYIIILGVLFVISIIV* |
| Ga0115011_101524942 | 3300009593 | Marine | MQKIKKIIYNLKTDIDNNTSKYIFILGILFVVSIIL* |
| Ga0115011_122398191 | 3300009593 | Marine | MDKINKIIYDFKTDIDRNTSKYIIILGVLFVVSIIL* |
| Ga0114933_100751881 | 3300009703 | Deep Subsurface | IIMDKIKKIIYDVKTDIDSNTSKYIIILGVLFVISIIL* |
| Ga0114933_105552121 | 3300009703 | Deep Subsurface | MDKINKLIYDLKTDIDNNTSKYIIILGVLFVISII |
| Ga0115000_100240057 | 3300009705 | Marine | MNKINKIIYDLKTDIDNNTSKYIIVLGVLFILSIII* |
| Ga0114999_102989743 | 3300009786 | Marine | WWSRILRWSFIMDKINKIIYDLKTDINNNTSKYILVLFALFIITIIL* |
| Ga0114999_105035382 | 3300009786 | Marine | DKINKIIYDLKTDIDNNTSKYILVLFGLFIISVII* |
| Ga0115012_100441724 | 3300009790 | Marine | RWTIRRTIIMDKINKIIYDLKTDIDNNTSKYIIILGVLFVISIIV* |
| Ga0115012_120417561 | 3300009790 | Marine | KINKIIYDLKTDIDNNTSKYIIILGVLFVISIIV* |
| Ga0098043_10195763 | 3300010148 | Marine | MDKINKIIYDIKRDIDNNTSKYIMGLGVLFIISIIL* |
| Ga0098056_10862291 | 3300010150 | Marine | IMNKINKLIYDLKTDIDNNTSKYIIILGVLFVISIIA* |
| Ga0098061_13466171 | 3300010151 | Marine | MDKINKIIYDFKTDIDNNTSKYVIILGVLFLISIIL* |
| Ga0098059_12167792 | 3300010153 | Marine | IIMDKIRKLIYDLKTDIDNNTSKYIIILGVLFLISIIS* |
| Ga0129351_13494752 | 3300010300 | Freshwater To Marine Saline Gradient | MDKIKKVIYDLKTDIDNNTSKYIIILGVLFVISIIS* |
| Ga0129324_102182111 | 3300010368 | Freshwater To Marine Saline Gradient | LRRTIIMDKINKIIYDLKTDIDNNTSKYIIILGVLFVMSIIL* |
| Ga0114934_101689452 | 3300011013 | Deep Subsurface | MNKINKLIYDLRTDIDNNTSKYIIILGVLFIVSIIV* |
| Ga0151674_10187321 | 3300011252 | Marine | IIRRTIIMDKIRKLIYDLKTDIDNNTSKYIIILGVLFVISIIS* |
| Ga0151671_10349701 | 3300011253 | Marine | MDKINKIIYDFKTDIDNNTSKYIMILGVLFLISIIL* |
| Ga0151677_10115751 | 3300011258 | Marine | MEKINKIIYDLKTDIDNNTSKYIIILGVLFVISIIL* |
| Ga0160423_100232567 | 3300012920 | Surface Seawater | MDKINKLIYDFKTDIDKNTSKYIIILGVLFVISIIL* |
| Ga0163180_110608572 | 3300012952 | Seawater | MDKINKIIYDFKTDIDKNTSKYIIILGVLFVVSIIL* |
| Ga0129327_107290342 | 3300013010 | Freshwater To Marine Saline Gradient | MDKIKKLIYDVKTDIDNNTSKYIIILGVLFVISIIS* |
| Ga0180120_101289642 | 3300017697 | Freshwater To Marine Saline Gradient | HWWSRWIIRRTIIMDKINKIIYDLKTDIDNNTSKYIIILGVLFIISIIL |
| Ga0180120_101904402 | 3300017697 | Freshwater To Marine Saline Gradient | IRRTIIMDKINKIIYDLKTDIDNNTSKYIIILGVLFVISIII |
| Ga0180120_103363842 | 3300017697 | Freshwater To Marine Saline Gradient | TIIMDKINKIIYDLKTDIDNNTSKYIIILGVLFVISIIS |
| Ga0181377_10885582 | 3300017706 | Marine | IRRTIIMDKIRKLIYDVKTDIDNNTSKYIIILGVLFVISIIS |
| Ga0181369_100030117 | 3300017708 | Marine | MNKINKLIYDLKTDIDNNTSKYIIILGVLFVISIIA |
| Ga0181369_10174163 | 3300017708 | Marine | IRRTIIMNKINKLIYDLKTDIDNNTSKYIIILGVLFVISIIV |
| Ga0181391_10323792 | 3300017713 | Seawater | MDKINKIIYDLRTDIDNNTSKYIIILGVLFVISIIL |
| Ga0181391_10577482 | 3300017713 | Seawater | MNKINKIIYDIKTDINSNTSKYIIILGVLFVVSIIL |
| Ga0181412_11464612 | 3300017714 | Seawater | MDKIRKLIYDFKTDIDNNTSKYIIILGVLFVISIIS |
| Ga0181404_10134104 | 3300017717 | Seawater | MDKINKIIYDLKTDINSNTSKYIIILGVLFVVSIIL |
| Ga0181404_10175463 | 3300017717 | Seawater | MDKINKIIYDLKTDIDNNTSKYIIGLGVLFVISIIV |
| Ga0181390_11338131 | 3300017719 | Seawater | RGCYWWSIIRRSIIMDKINKIIYDLKTDIDNNTTKYIIILGVLFVISIIA |
| Ga0181381_10295611 | 3300017726 | Seawater | MDKIRKLIYDLKTDIDNNTSKYIIILGVLFLISIIL |
| Ga0181381_10685612 | 3300017726 | Seawater | MDKIKKIIYDFKTDIDNNTSKYIIILGVLFVISIIS |
| Ga0181419_10519592 | 3300017728 | Seawater | FMDKINKIIYDIKTDIDNNTSKYIIILGVLFVILIIL |
| Ga0181396_10301533 | 3300017729 | Seawater | MDKINKIIYDLRTDIDNNTSKYIIILGVLFVISIII |
| Ga0181396_10937621 | 3300017729 | Seawater | IIRRTIIMDKIRKLIYDVKTDIDNNTSKYIIILGVLFVISIIS |
| Ga0181416_11217662 | 3300017731 | Seawater | MEKINKIIYDLKTDIDNNTSKYIIILGVLFVISIII |
| Ga0187222_10960491 | 3300017734 | Seawater | RCNDRWWSRILRRIIIMNKINKIIYDLKTDIDNNTSKYIIILGVLFVVSIIL |
| Ga0181418_11659301 | 3300017740 | Seawater | IMDKINKIIYDIKTDIDNNTSKYIIILGVLFIVSIIL |
| Ga0181421_10048181 | 3300017741 | Seawater | MDKINKIIYDLKTDIDNNTSKYIIILGVLFVVSIIL |
| Ga0181421_10105675 | 3300017741 | Seawater | MEKINKIIYDLKTDIDNNTSKYIIILVVLFVVSIIL |
| Ga0181421_10862522 | 3300017741 | Seawater | TTWRIFIMDKINKLVYDLKTDIDNNTSKYIIILGILFIVSIIF |
| Ga0181399_10447532 | 3300017742 | Seawater | IRRTIIMDKIRKLIYDLKTDIDNNTSKYIIILGVLFVISIIS |
| Ga0181402_11124431 | 3300017743 | Seawater | FYNKMDKINKIIYDLKTDIDNNTSKYIIILGVLFVISIII |
| Ga0181392_10065071 | 3300017749 | Seawater | WSRWIIRRTIIMDKINKIIYDLRTDIDNNTSKYIIILGVLFVISIIL |
| Ga0181392_10751371 | 3300017749 | Seawater | DKIRKLIYDLKTDIDNNTSKYIIILGVLFVISIIS |
| Ga0181392_12466162 | 3300017749 | Seawater | MNKINKLIYDLKTDIDNNTSKYIIGLGVLFVISIIV |
| Ga0181405_10331702 | 3300017750 | Seawater | MNKIKKLIYDLKTDIDNNTSKYIIILGVLFVISIIA |
| Ga0181405_10795632 | 3300017750 | Seawater | MEKINKIIYDLKTDIDNNTSKYIIILGALFVVSIIL |
| Ga0187219_12273512 | 3300017751 | Seawater | ISRWWFRIIRRTIIMDKIKKLIYDVKTDIDNNTSKYIIILGVLFVISIIS |
| Ga0181400_10749171 | 3300017752 | Seawater | IMDKIRKLIYDLKTDIDNNTSKYIIILGVLFVISIIS |
| Ga0181407_10882061 | 3300017753 | Seawater | SNWWSIIRRFIIMDKINKLIYDLKTDIDNNTSKYIIILGILFIVSIIF |
| Ga0181407_11406111 | 3300017753 | Seawater | MDKINKLIYELKTDIDNNTSKYINILGVLFVISIII |
| Ga0181411_10382431 | 3300017755 | Seawater | EKINKIIYDLKTDIDNNTSKYIIILGVLFVVSIIL |
| Ga0181411_10402602 | 3300017755 | Seawater | MDKINKIIYDIKTDINSNTSKYIIILGVLFVVSIIL |
| Ga0181411_10737341 | 3300017755 | Seawater | FYNKMDKINKIIYDLKTDIDNNTSKYIIILGVLFVISIIA |
| Ga0181411_11043472 | 3300017755 | Seawater | MNKIKKLIYDLKTDIDNNTSKYIIILGVLFVVSIIL |
| Ga0181382_11405612 | 3300017756 | Seawater | MDKIKKIIYDFKTDIDNNTSKYIIILGVLFVISIIL |
| Ga0181420_10544281 | 3300017757 | Seawater | RTIIMDKIKKLIYDVKTDIDNNTSKYIIILGVLFVISIIS |
| Ga0181409_11125321 | 3300017758 | Seawater | WWITWRIFIMNKIKKLIYDLKTDIDNNTSKYIIILGVLFVVSIIL |
| Ga0181409_11297612 | 3300017758 | Seawater | MDKIRKLIYDFKTDIDNNTSKYIIILGVLFVISIIL |
| Ga0181414_10043155 | 3300017759 | Seawater | WIIRRTIIMDKINKIIYDLKTDIDNNTSKYIIILGVLFVISIII |
| Ga0181414_11427902 | 3300017759 | Seawater | WIIRRTIIMDKINKIIYDLKTDIDNNTSKYIIILGVLFVISIIL |
| Ga0181408_11558791 | 3300017760 | Seawater | MNKINKLIYDLKTDIDNNTSKYIIILGVLFVISIIS |
| Ga0181422_10709932 | 3300017762 | Seawater | IMDKIKKLIYDVKTDIDNNTSKYIIILGVLFVISIIS |
| Ga0181385_10970842 | 3300017764 | Seawater | IIMDKIRKLIYDVKTDIDNNTSKYIIILGVLFVISIIS |
| Ga0181413_10080082 | 3300017765 | Seawater | MNKINKIIYNLKTDIDNNTSKYIIILGVLFVISIIL |
| Ga0181413_10127373 | 3300017765 | Seawater | MDKINKIIYDLKKDIDNNTSKYIIILGVLFVISIIS |
| Ga0181406_11267161 | 3300017767 | Seawater | DKINKLIYDLKTDIDNNTSKYIIILGVLFVISIII |
| Ga0187221_12305211 | 3300017769 | Seawater | TFIMDKINKLIYDLKTDIDNNTSKYIIILGVLFVISIIS |
| Ga0187217_10739642 | 3300017770 | Seawater | DKINKIIYDLKTDIDNNTSKYIIILGVLFVISIIA |
| Ga0187217_12954502 | 3300017770 | Seawater | NKMDKINKIIYDLKTDIDNNTSKYIIILGVLFVVSIIL |
| Ga0181423_13894031 | 3300017781 | Seawater | IFIIDKINKLIYYLKTDIDNNTSKYIIILGILFVISIIS |
| Ga0181380_11795641 | 3300017782 | Seawater | NKMDKINKIIYDIKTDINSNTSKYIIILGVLFVVSIIL |
| Ga0181380_12914032 | 3300017782 | Seawater | MDKINKIIYDIKTDIDNNTSKYILIIGVLFVISIIS |
| Ga0181379_10709031 | 3300017783 | Seawater | RTIIMDKIKKIIYDFKTDIDNNTSKYIIILGVLFLISIIS |
| Ga0181424_104717781 | 3300017786 | Seawater | RCYHWWSRWIIRRTIIMDKINKIIYDLKTDIDNNTSKYIIILGVLFVISIIL |
| Ga0181601_101176312 | 3300018041 | Salt Marsh | MNKINKLIYDLKTDIDNNTSKYIIILGVLFVVSIII |
| Ga0181562_101188582 | 3300019459 | Salt Marsh | MNKINKLIYDLKTDIDNNTSKYIIILGVLFVVSIIL |
| Ga0181562_103590652 | 3300019459 | Salt Marsh | YYWCINRWWSRILRRVIIMNKINKLIYDLKTDIDNNTSKYIIILGVLFVISIIL |
| Ga0211685_10416641 | 3300020253 | Marine | FRILRRIIIMDKINKIIYDLKADIDNNTSKYIIILGVLIVISIIL |
| Ga0211683_100192274 | 3300020372 | Marine | MDKIHKIIYDIKTDIDHNTSKYIIILGVLFVISIIL |
| Ga0211683_100283342 | 3300020372 | Marine | MDKINKIIYDIKRDIDHNTSKYIIIIGVLFVIAIIL |
| Ga0211683_100557992 | 3300020372 | Marine | MDKINKIIYDLKADIDNNTSKYIIILGVLIVISIIL |
| Ga0211683_100594153 | 3300020372 | Marine | RTIIMDKINKIIYDLKADIDNNTSKYIIILGVLFVISIIL |
| Ga0211683_102479311 | 3300020372 | Marine | NIMDKINKIIYDLKTDIDHNASKYIIILGVLFIISIII |
| Ga0211678_104002121 | 3300020388 | Marine | MDKIRKLIYDVKTDIDNNTSKYIIILGVLFVISIIS |
| Ga0211666_100294982 | 3300020392 | Marine | MDKINKLIYDLKTDIDNNTSKYIMILGGLFIVSIIF |
| Ga0211532_100785763 | 3300020403 | Marine | MEKIRKIIFDLQTDIDRNTSKYIIGLLVLSVLGIIL |
| Ga0211528_104039123 | 3300020417 | Marine | MEKINKLIYDLKTDINKNTSKYIFILGVLFVISIIV |
| Ga0211518_100328172 | 3300020440 | Marine | MNKINKLIYDLRTDIDNNTSKYIIILGVLFIVSIIL |
| Ga0211641_100048515 | 3300020450 | Marine | MDKINKIIYDLKRDIDNNTSKYIMGLGVLFIISIIL |
| Ga0211545_100581982 | 3300020452 | Marine | MNKINKIIYDIKTDIDNNTSKYIIILGVLFVVSIIL |
| Ga0211514_104621813 | 3300020459 | Marine | MDKINKIIYDFKTDIDKNTSKYIIILGVLFVVSIIL |
| Ga0211676_103750301 | 3300020463 | Marine | MDKINKLIYDLKTDIDNNTSKYIIILGVLFVISIIA |
| Ga0211577_106783731 | 3300020469 | Marine | RTIIMDKINKIIYDLKTDIDNNTSKYIIILGVLFVISIIL |
| Ga0211547_105843561 | 3300020474 | Marine | MDKINKLIYDLKTDIDNNTSKYIIGLGVLFVISIIV |
| Ga0213862_101874441 | 3300021347 | Seawater | IMNKINKLIYDLKTDIDNNTSKYIIILGVLFVVSIII |
| Ga0213869_100230932 | 3300021375 | Seawater | MDKINKIIYDLKTDIDNNTSKYIIILGALFVISIIL |
| Ga0213869_100965912 | 3300021375 | Seawater | MDKIKKIIYDVKTDIDNNTSKYIIILGVLFVISIIL |
| Ga0213861_100792242 | 3300021378 | Seawater | MDKINKIIYDLKTDIDNNTSKYIIILGVLFVMSIIL |
| Ga0222717_103123322 | 3300021957 | Estuarine Water | MDKINKIIYDLKTDIDNNTTKYIIILGVLFVISIIL |
| Ga0222718_102526272 | 3300021958 | Estuarine Water | MNKINKLIYDLKTDIDNNTSKYIIILGFLFVVSIIL |
| Ga0222716_100261274 | 3300021959 | Estuarine Water | MDKINKIIYDLKTDIDNNTTKYIIILGVLFVVSIIL |
| Ga0222716_100779166 | 3300021959 | Estuarine Water | MDKINKIIYDLKTDIDNNTTKYIIILGVLFIVSIIL |
| Ga0212030_10247602 | 3300022053 | Aqueous | MDKINKIIYDLKTDIDNNTSKYIIILGVLFIISIIL |
| Ga0212030_10648992 | 3300022053 | Aqueous | MDKINKIIYDLKTDIDNNTSKYIIILGVLFVISIIL |
| Ga0212023_10510752 | 3300022061 | Aqueous | MDKIKKVIYDIKTDIDNNTSKYIIILGVLFVISIIS |
| Ga0212023_10582312 | 3300022061 | Aqueous | MDKINKLIYDLKTDIDNNTSKYIIILGALFVISIIL |
| Ga0212024_10188842 | 3300022065 | Aqueous | RWTIRRTIIMDKINKLIYDLKTDIDNNTSKYIIILGVLFVISIIV |
| Ga0212021_10114052 | 3300022068 | Aqueous | MDKINKLIYDLKTDIDNNTSKYIIILGVLFVISIIV |
| Ga0212021_10194171 | 3300022068 | Aqueous | MDKIKKLIYDVKTDIDNNTSKYIIILGVLFVISIIS |
| Ga0196889_10363872 | 3300022072 | Aqueous | RNIIMDKIRKLIYDVKTDIDNNTSKYIIILGVLFVISIIS |
| Ga0196889_10413482 | 3300022072 | Aqueous | MDKINKIIYDLKTDIDNNTSKYIIILGVLFLISIIL |
| Ga0196887_10522762 | 3300022178 | Aqueous | MDKIRKLIYDLKTDIDNNTSKYIIILGVLFVISIIL |
| Ga0196887_10565992 | 3300022178 | Aqueous | FRIIRRTIIMDKINKIIYDLKTDIDNNTSKYIIILGVLFVISIII |
| Ga0196891_10142543 | 3300022183 | Aqueous | TIIMDKINKIIYDLKTDIDNNTSKYIVILGVLFVISIIL |
| Ga0196891_10319712 | 3300022183 | Aqueous | MNKINKIIYDIKTDIDNNTSKYIIILGVLFVISIIL |
| Ga0196899_11005192 | 3300022187 | Aqueous | IIMDKINKIIYDLKTDIDNNTSKYIIILGVLFLISIIL |
| Ga0196899_11547982 | 3300022187 | Aqueous | WFFIIMDKINKIIYDLKTDIDNNTSKYIIILGVLFVISIII |
| Ga0222646_1019695 | 3300022822 | Saline Water | MDQINKIIYDLKTDIDNNTSKYILVLFGLFIISVII |
| Ga0222674_10781112 | 3300022848 | Saline Water | LRWSFIMDKINKIIYDLKTDIDNNTSKYIIILGVLFVILIIL |
| Ga0222652_10285442 | 3300022853 | Saline Water | SFIMDKINKIIYDLKTDIDNNTSKYILVLFGLFIISIIL |
| Ga0255773_101144161 | 3300022925 | Salt Marsh | ILRRVIIMNKINKLIYDLKTDIDNNTSKYIIILGVLFVVSIII |
| Ga0255773_103517472 | 3300022925 | Salt Marsh | WWSRILRRVIIMNKINKLIYDLKTDIDNNTSKYIIILGVLFVISIIL |
| (restricted) Ga0233433_1000091456 | 3300022931 | Seawater | MDKIKKVIYDIKTDIDNNTSKYIIILGILFVISIIS |
| Ga0222688_10195781 | 3300023293 | Saline Water | RWSFIMDQINKIIYDLKTDIDNNTSKYILVLFGLFIISIIL |
| Ga0222670_10389021 | 3300023294 | Saline Water | IMDKINKIIYDLKTDIDNNTSKYILVLFGLFIISIIL |
| Ga0228686_10507542 | 3300023685 | Seawater | MDKINKIIYDLKTDIDNNTSKYIIILGVLFVISIIA |
| (restricted) Ga0233438_100354032 | 3300024255 | Seawater | MDKIKKIIYDFKTDIDNNTSKYIIILGVLFLISIIS |
| (restricted) Ga0233444_100971152 | 3300024264 | Seawater | MDKINKIIYDLKTDIDNNTTKYIVILGVLFVISIIL |
| Ga0209992_1000284220 | 3300024344 | Deep Subsurface | MDKIKKIIYDVKTDIDSNTSKYIIILGVLFVISIIL |
| (restricted) Ga0255048_102275522 | 3300024518 | Seawater | MDKIKKIIYDVKTDIDNNTSKYIIILGVLFVISIIS |
| (restricted) Ga0255048_102526192 | 3300024518 | Seawater | MDKINKIIYDLKTDIDNNTSKYIVILGVLFIMSIIL |
| Ga0207905_10185062 | 3300025048 | Marine | MDKINKIIYDLKTDIDNNTSKYIVILGVLFIISIIL |
| Ga0207905_10316552 | 3300025048 | Marine | MDKINKIIYDLKTDIDNNTSKYIIILGVLFVISIII |
| Ga0208667_10079862 | 3300025070 | Marine | MDKIRKLIYDVKTDIDNNTSKYIIILGVLFVISIIL |
| Ga0208667_10236861 | 3300025070 | Marine | RTIIMDKIRKLIYDVKTDIDNNTSKYIIILGVLFVISIIL |
| Ga0207896_10014485 | 3300025071 | Marine | MDKINKIIYDLKTDIDNNTSKYIVILGVLFVISIIS |
| Ga0207896_10155872 | 3300025071 | Marine | MDKINKIIYDLKTEIDNNTSKYIIILGVLFVISIII |
| Ga0207896_10328692 | 3300025071 | Marine | MDKINKIIYDLKTDIDNNTSKYIIILGVLFIVSIIL |
| Ga0207890_10080782 | 3300025079 | Marine | MDKIKKLIYDVKTDIDNNTSKYIIILGVLFVISIIL |
| Ga0208791_10152622 | 3300025083 | Marine | MDKINKIIYDIKTDIDNNTSKYIIILGVLFVVSIIL |
| Ga0208298_10332982 | 3300025084 | Marine | MDKINKIIYDLKTDIDNNTSKYIIILSVLFLVSIIL |
| Ga0208298_10760151 | 3300025084 | Marine | IRRTIIMDKIRKLIYDVKTDIDNNTSKYIIILGVLFVISIIL |
| Ga0208298_10766362 | 3300025084 | Marine | MEKINKIIYDLKTDIDNNTSKYIIILGILFVISIIA |
| Ga0208792_10132851 | 3300025085 | Marine | MDKINKIIYDIKTDIDNNTSKYIIILGVLFVISIIA |
| Ga0208792_10228382 | 3300025085 | Marine | MDKINKIIYDIKTDIDNNTSKYIIILGVLFVISIIS |
| Ga0208792_10558071 | 3300025085 | Marine | RWCCCRWTIRRTIIMNKINKLIYDLKTDIDNNTSKYIIILGVLFVVSIIL |
| Ga0208157_10073393 | 3300025086 | Marine | MKKINKLIYDLKTDIDNNTSKYIIILGVLFVISIIA |
| Ga0208157_10329353 | 3300025086 | Marine | IIMNKINKLIYDLKTDIDNNTSKYIIILGVLFVVSIIL |
| Ga0208157_10467841 | 3300025086 | Marine | FYNKMDKINKIIYDFKTDIDNNTSKYVIILGVLFLISIIL |
| Ga0208157_10514191 | 3300025086 | Marine | FYNKMDKINKLIYDLKTDIDNNTSKYIIILGVLFVISIIT |
| Ga0208157_11081492 | 3300025086 | Marine | MEKINKIIYDLKTDIDNNTSKYIIILGVLFVISIIT |
| Ga0208013_10318541 | 3300025103 | Marine | IMEKINKIIYDLKTDIDNNTSKYIIILGILFVISIIA |
| Ga0209535_10026604 | 3300025120 | Marine | MDKINKLIYDLKTDIDNNTSKYIIILGVLFLISIIL |
| Ga0209535_10039415 | 3300025120 | Marine | MNKINKIIYDLKTDIDNNTSKYIIILGVLFVVSIIL |
| Ga0209535_10047296 | 3300025120 | Marine | MDKIRKLIYDLKTDIDNNTSKYIIILGVLFVISIIS |
| Ga0209535_10143953 | 3300025120 | Marine | MNKIKKLIYDLKTDIDNNTSKYIIILGVLFVISIIS |
| Ga0209535_10306891 | 3300025120 | Marine | IRWSIIRRTIIMDKINKIIYDLKTDIDNNTSKYIIILGVLFVISIIL |
| Ga0209535_10387293 | 3300025120 | Marine | MDKINKLIYDLKTDIDNNTTKYIVILGVLFVISIIL |
| Ga0209535_10915572 | 3300025120 | Marine | DKINKIIYDLKTDIDNNTSKYIIILGVLFVISIII |
| Ga0209535_10929262 | 3300025120 | Marine | MDKINKLIYDLKTDIDNNTSKYIIILGILFIISIIS |
| Ga0209535_10957882 | 3300025120 | Marine | MNKINKLIYDLKTDIDNNTSKYIIILGILFIISIIS |
| Ga0209535_11230202 | 3300025120 | Marine | MDKINKIIYDLKTDIDNNTTKYIIILGVLFVISIII |
| Ga0209535_11433392 | 3300025120 | Marine | MNKINKLIYDIKTDIDNNTSKYIIILGVLFVISIIL |
| Ga0209535_11732231 | 3300025120 | Marine | MDKINKLIYDLKTDIDNNTSKYIIGLGVLFVISIIL |
| Ga0208919_10373433 | 3300025128 | Marine | FIRRTIIMDKIRKLIYDVKTDIDNNTSKYIIILGVLFVISIIL |
| Ga0208919_10428402 | 3300025128 | Marine | MDKINKIIYDIKRDIDNNTSKYIMGLGVLFVISIIL |
| Ga0208919_11987431 | 3300025128 | Marine | KKINKLIYDLKTDIDNNTSKYIIILGVLFVISIIA |
| Ga0209232_11442782 | 3300025132 | Marine | MDKINKLIYDFKTDIDNNTSKYIIILGVLFVISIIA |
| Ga0209232_11526962 | 3300025132 | Marine | MNKINKIIYDFKMDIDRNTSKYIIILGVLFVVSIIL |
| Ga0209336_100028153 | 3300025137 | Marine | MNKINKLIYDLKTDIDNNTSKYIIILGGLFVISIIL |
| Ga0209336_100048436 | 3300025137 | Marine | MDKINKLIYDLKTDIDNNTSKYIIILGVLFVVSIIL |
| Ga0209336_100173693 | 3300025137 | Marine | MNKIKKLIYDLKTDIDNNTSKYIIILGVLFVISIII |
| Ga0209336_100183844 | 3300025137 | Marine | RRTIIMDKIRKLIYDLKTDIDNNTSKYIIILGVLFVISIIS |
| Ga0209336_100435861 | 3300025137 | Marine | RRTIIMDKINKIIYDLKTDIDNNTSKYIIILGVLFVISIIL |
| Ga0209336_101390372 | 3300025137 | Marine | MDKINKLIYDLKTDIDNNTSKYIIGLGVLFVISIII |
| Ga0209634_10685253 | 3300025138 | Marine | RWSIRWSIIRRTIIMDKINKIIYDLKTDIDNNTSKYIIILGVLFVISIIL |
| Ga0209634_10834862 | 3300025138 | Marine | MDKINKIIYDLKTDIDNNTSKYIIILGILFVISIIL |
| Ga0209634_11410443 | 3300025138 | Marine | MDKINKIIYDLKTDIDNNTSKYIIILGVLFIISII |
| Ga0209634_11483072 | 3300025138 | Marine | MDKINKIIYDLKTDIDNNTSKYIIILGVLLVISIIL |
| Ga0209645_11182791 | 3300025151 | Marine | IMNKINKLIYDLKTDIDNNTSKYIIILGVLFVVSIIL |
| Ga0208031_10262081 | 3300025237 | Deep Ocean | MDKINKIIYDLKADIDNNTSKYIIILGVLFVISII |
| Ga0208032_10063342 | 3300025266 | Deep Ocean | MDKINKIIYDLKTEINNNTSKYIIILGALFIISIII |
| Ga0208032_10214363 | 3300025266 | Deep Ocean | MDKINKIIYDIKRDIDHNTSKYIIIIGVLFVISIIL |
| Ga0208032_10418642 | 3300025266 | Deep Ocean | MDKINKIIYDLKTDIDNNTSKYIVILGVLFLISIIS |
| Ga0208814_10030102 | 3300025276 | Deep Ocean | MDKINKIIYDLKADINNNTSKYIIILSGLFVISIIL |
| Ga0208814_10228372 | 3300025276 | Deep Ocean | MDKINKIIYDLKADIDNNTSKYIIILGVLFVISIIL |
| Ga0208814_10558111 | 3300025276 | Deep Ocean | IRRTIIMDKINKIIYDLKADIDNNTSKYIIILGVLFIVSIIL |
| Ga0208814_10883662 | 3300025276 | Deep Ocean | MDKINKIIYDLKTDIDNNTSKYIIILGVLFVISIIS |
| Ga0208814_11095611 | 3300025276 | Deep Ocean | IMDKIHKIIYDIRTDIDQNTSKYIIGLIIFCIISIIL |
| Ga0208903_10600212 | 3300025502 | Saline Lake | MDKINKIIYDLKTDIDNNTSKYIIILGVLFAILIIL |
| Ga0208903_11163992 | 3300025502 | Saline Lake | FIMDKINKIIYDLKTDIDNNTSKYILVLFGLFIISIIL |
| Ga0208148_10329033 | 3300025508 | Aqueous | YHWWSRWIIRRTIIMDKINKIIYDLKTDIDNNTSKYIIILGVLFIISIIL |
| Ga0208148_10435833 | 3300025508 | Aqueous | MNKIRKLIYDFKTDIDNNTSKYIIILGVLFVISIIS |
| Ga0208148_10787041 | 3300025508 | Aqueous | IIRRTIIMDKINKIIYDLKTDIDNNTSKYIIILGVLFVISIIL |
| Ga0208303_10188954 | 3300025543 | Aqueous | IIRRTIIMDKINKIIYDLKTDIDNNTSKYIIILGVLFVISIII |
| Ga0208303_11205281 | 3300025543 | Aqueous | DKINKIIYDLKTDIDNNTSKYIIILGVLFIISIIL |
| Ga0209194_10452492 | 3300025632 | Pelagic Marine | MNKIRKLIYDVKTDIDNNTSKYIIILGVLFVISIIS |
| Ga0209194_10551782 | 3300025632 | Pelagic Marine | IRRTIIMDKIRKLIYDLKTDIDNNTSKYIIILGVLFLISIIS |
| Ga0208643_10475223 | 3300025645 | Aqueous | IIRRTIIMDKINKIIYDLKTDIDNNTSKYIIILGVLFIISIIL |
| Ga0208134_10207863 | 3300025652 | Aqueous | MDKINKIIYDLKTDIDNNTSKYIIILSILFVISIIL |
| Ga0208134_10602282 | 3300025652 | Aqueous | IRRTIIMDKINKIIYDLKTDIDNNTSKYIIILGVLFVISIIS |
| Ga0208134_11249321 | 3300025652 | Aqueous | YHWWSRWIIRRTIIMDKINKIIYDLKTDIDNNTSKYIIILGVLFVISIIL |
| Ga0208898_11004652 | 3300025671 | Aqueous | WWSWLFRRTNLMDKINKIIYDLKTDIDNNTSKYIVILGVLFIISIIL |
| Ga0208162_10149972 | 3300025674 | Aqueous | MDKINKLIYDLKTDIDNNTSKYIIILGVLFVISIIT |
| Ga0208162_11026861 | 3300025674 | Aqueous | RWIIRRTIIMDKINKIIYDLKTDIDNNTSKYIIILGVLFIISIIL |
| Ga0208899_10213922 | 3300025759 | Aqueous | MDKINKLIYDLKTDIDNNTSKYIIILGVLFVISIIL |
| Ga0208899_10404961 | 3300025759 | Aqueous | RWIIRRTIIMDKINKIIYDLKTDIDNNTSKYIIILGVLFVISIIL |
| Ga0208425_100111016 | 3300025803 | Aqueous | WWFRLLRRTIIMDKINKIIYDLKTDIDNNTSKYIIILGVLFVMSIIL |
| Ga0208425_10971441 | 3300025803 | Aqueous | IIMDKINKIIYDLKTDIDNNTSKYIIILGVLFVISIIL |
| Ga0208545_10478243 | 3300025806 | Aqueous | IIMDKINKIIYDLKTDIDNNTSKYIIILGVLFVMSIIL |
| Ga0208545_11615731 | 3300025806 | Aqueous | RWIIRRTIIMDKINKIIYDLKTDIDNNTSKYIIILGVLFLISIIL |
| Ga0209193_10088473 | 3300025816 | Pelagic Marine | MDKINKIIYDFKTDIDNNTSKYIIILGVLFLISIIL |
| Ga0208645_11334681 | 3300025853 | Aqueous | YHWWSRWIIRRTIIMDKINKIIYDLKTDIDNNTSKYIIILGVLFVISIII |
| Ga0209308_102918131 | 3300025869 | Pelagic Marine | NWWWFRIIRRTIIMDKINKIIYDLKTDIDNNTSKYIIILGVLFVISIII |
| Ga0209631_100441874 | 3300025890 | Pelagic Marine | MDKINKIIYDFKTDIDNNTSKYIIILGILFLISIIL |
| Ga0209335_103472861 | 3300025894 | Pelagic Marine | CSIRWSRWIIRRTIIMDKINKIIYDLKTDIDNNTSKYIIILGVLFVISIII |
| Ga0208954_10083392 | 3300027081 | Marine | MNKINKIIYDLKTDIDNNTSKYIIILGVLFIVSIIL |
| Ga0209384_100080422 | 3300027522 | Marine | MDKIHKIIYDIKTDIDQNTSKYIIGLIIFCIISIIL |
| Ga0209482_10825111 | 3300027668 | Marine | CIIRRTIIMDKINKIIYDLKADIDNNTSKYIIILGVLFIVSIIL |
| Ga0209482_10967732 | 3300027668 | Marine | MDKINKIIYDLKTDIDHNASKYIIILGVLFIISIII |
| Ga0209816_10818232 | 3300027704 | Marine | MDKINKIIYDLKADIDNNTSKYIIILGVLFIVSIIL |
| Ga0209815_11405982 | 3300027714 | Marine | MDKINKIIYDLKTDIDNNTSKYIVILGVLFIISIIS |
| Ga0209192_102509822 | 3300027752 | Marine | MDKINKIIYDLKTDIDNNTSKYIVILYVLFVVSIIL |
| Ga0209709_100163113 | 3300027779 | Marine | MNKINKIIYDLKTDIDNNTSKYIIILGVLFVISIIL |
| Ga0209709_100789922 | 3300027779 | Marine | MNKINKIIYDLKTDIDNNTSKYIIILGVLFILSIII |
| Ga0209709_100929522 | 3300027779 | Marine | MDKINKIIYDLKTDIDNNTSKYIIVLGALFIISIII |
| Ga0209091_105183961 | 3300027801 | Marine | IMNKINKIIYDLKTDIDNNTSKYIIVLGVLFILSIII |
| Ga0209090_101897371 | 3300027813 | Marine | FIIMDKINKIIYDLKTDIDNNTSKYILVLFGLFIISIIL |
| Ga0209090_102299421 | 3300027813 | Marine | MDKINKIIYDLKTDIDNNTSKYIVILGVLFVMSIIL |
| Ga0209402_104259302 | 3300027847 | Marine | MDKINKIIYDLKTDINNNTSKYILVLFGLFIITIIL |
| Ga0209503_100289372 | 3300027859 | Marine | MDKIRKLIYDAKTDIDNNTSKYIIILGVLFVISIIL |
| Ga0209404_100098544 | 3300027906 | Marine | MDKINKIIYDLKTDIDNNTSKYIIILGVLFVISIIV |
| Ga0256368_10155013 | 3300028125 | Sea-Ice Brine | MNKINKIIYDLKTDIDNNTTKYIIILGVLFVISIIL |
| Ga0256368_10224502 | 3300028125 | Sea-Ice Brine | MDQINKIIYDLKTDIDNNTSKYILFLFGLFIISIIL |
| Ga0256368_10420982 | 3300028125 | Sea-Ice Brine | MDKINKIIYDLKTDIDNNTSKYIVILGLLFVISIIS |
| Ga0256368_10549002 | 3300028125 | Sea-Ice Brine | MDKIKKVIYDIKTDIDNNTSKYIIILGVLFIISIIS |
| Ga0256368_10600421 | 3300028125 | Sea-Ice Brine | DKIKKVIYDIKTDIDNNTSKYIIILGVLFVISIIS |
| Ga0257121_10584011 | 3300028198 | Marine | RRTIIMDKIKKLIYDVKTDIDNNTSKYIIILGVLFVISIIS |
| Ga0265303_118804512 | 3300028600 | Sediment | MDKIRKLIYDLKTDIDNNTSKYIIILGVLFLISIIS |
| Ga0183683_10339302 | 3300029309 | Marine | MDKINKIIYDIKTDIDSNTSKYIIILGVLFVVSIIL |
| Ga0183755_10510311 | 3300029448 | Marine | SIRWSRWIIRRTIIMDKINKIIYDLKTDIDNNTSKYIIILGVLFLISIIL |
| Ga0183757_10228822 | 3300029787 | Marine | MNKINKLIYDLRTDIDNNTSKYIIGLGVLFVISIIT |
| Ga0183757_10699361 | 3300029787 | Marine | RSINRWRFRLFRRVIIMNKINKLIYDLRTDIDNNTSKYIIILGVLFIVSIIL |
| Ga0308023_10288712 | 3300031167 | Marine | RITLMDKINKIIYDLKTDIDNNTSKYIVILGVLFLISIIS |
| Ga0307488_100224246 | 3300031519 | Sackhole Brine | MDKINKIIYDLKTDIDNNTSKYIIILGVLFIISIIS |
| Ga0307488_101939321 | 3300031519 | Sackhole Brine | WCINRWWYRIIRRTIIMDKINKIIYDLKTDIDNNTSKYIIILGILFVISIIL |
| Ga0307488_102351702 | 3300031519 | Sackhole Brine | MDKINKIIYDLKTDIDNNTSKYIIILAVLFVISIIL |
| Ga0307488_104380212 | 3300031519 | Sackhole Brine | TIIMDKIKKVIYDIKTDIDNNTSKYIIILGVLFIISIIS |
| Ga0307488_108188642 | 3300031519 | Sackhole Brine | MDKINKIIYDLKTDIDNNTSKYIIILSVLFVISIIL |
| Ga0308001_103353622 | 3300031644 | Marine | DKINKIIYDLKTDIDNNTSKYIVILGVLFIISIIL |
| Ga0307986_101286352 | 3300031659 | Marine | WFRLFRWSFIMDKINKIIYDLKTDIDNNTSKYIVILGVLFVMSIIL |
| Ga0307986_101857531 | 3300031659 | Marine | YGCFIRWRSWIIKWFFIIMDKINKIIYDLKTDIDNNTSKYILVLFGLFIISVII |
| Ga0316202_104843552 | 3300032277 | Microbial Mat | MDKINKIIYDLKTDIDNNTSKYIVILGVLFVISIII |
| Ga0316202_106083831 | 3300032277 | Microbial Mat | MNKINKIIYDIKTDIDNNTSKYIIILGVLFVVSII |
| Ga0314858_034086_3_143 | 3300033742 | Sea-Ice Brine | WSRLLRWSFIMDQINKIIYDLKTDIDNNTSKYILFLFGLFIISIIL |
| Ga0314858_162429_468_572 | 3300033742 | Sea-Ice Brine | MDKINKIIYDLKTEIDNNTSKYIIILGVLFVISII |
| Ga0314858_179197_91_201 | 3300033742 | Sea-Ice Brine | MDKINKIIYDLKTEIDNNTSKYILVLFGLFIISIIL |
| Ga0348335_077438_1009_1134 | 3300034374 | Aqueous | RRTIIMDKINKIIYDLKTDIDNNTSKYIIILGVLFIISIIL |
| Ga0348336_015164_2_145 | 3300034375 | Aqueous | WSRWIIRRTIIMDKINKIIYDLKTDIDNNTSKYIIILGVLFLISIIL |
| Ga0348337_130186_633_752 | 3300034418 | Aqueous | TIIMDKINKIIYDLKTDIDNNTSKYIIILGVLFVISIIL |
| ⦗Top⦘ |