


| Basic Information | |
|---|---|
| Family ID | F003756 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 470 |
| Average Sequence Length | 42 residues |
| Representative Sequence | RTFEVKELSVPVSKAEELKKFYRIIASDERNTAVLKPAH |
| Number of Associated Samples | 343 |
| Number of Associated Scaffolds | 470 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 4.04 % |
| % of genes near scaffold ends (potentially truncated) | 91.06 % |
| % of genes from short scaffolds (< 2000 bps) | 88.94 % |
| Associated GOLD sequencing projects | 317 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.46 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (92.766 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (18.723 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.809 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (48.085 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 29.85% β-sheet: 0.00% Coil/Unstructured: 70.15% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 470 Family Scaffolds |
|---|---|---|
| PF07681 | DoxX | 18.94 |
| PF09424 | YqeY | 7.66 |
| PF02416 | TatA_B_E | 2.34 |
| PF00902 | TatC | 1.70 |
| PF06964 | Alpha-L-AF_C | 1.49 |
| PF00389 | 2-Hacid_dh | 1.28 |
| PF02826 | 2-Hacid_dh_C | 1.28 |
| PF04185 | Phosphoesterase | 1.06 |
| PF00501 | AMP-binding | 0.85 |
| PF00072 | Response_reg | 0.85 |
| PF13620 | CarboxypepD_reg | 0.85 |
| PF01208 | URO-D | 0.85 |
| PF12969 | DUF3857 | 0.85 |
| PF05163 | DinB | 0.64 |
| PF01740 | STAS | 0.64 |
| PF01850 | PIN | 0.64 |
| PF07238 | PilZ | 0.64 |
| PF02954 | HTH_8 | 0.64 |
| PF02887 | PK_C | 0.64 |
| PF04191 | PEMT | 0.64 |
| PF05336 | rhaM | 0.64 |
| PF08220 | HTH_DeoR | 0.43 |
| PF11175 | DUF2961 | 0.43 |
| PF01494 | FAD_binding_3 | 0.43 |
| PF11306 | DUF3108 | 0.43 |
| PF04055 | Radical_SAM | 0.43 |
| PF09137 | Glucodextran_N | 0.43 |
| PF13683 | rve_3 | 0.43 |
| PF07963 | N_methyl | 0.43 |
| PF13432 | TPR_16 | 0.43 |
| PF01554 | MatE | 0.43 |
| PF04102 | SlyX | 0.43 |
| PF00873 | ACR_tran | 0.21 |
| PF13578 | Methyltransf_24 | 0.21 |
| PF14060 | DUF4252 | 0.21 |
| PF17137 | DUF5110 | 0.21 |
| PF12631 | MnmE_helical | 0.21 |
| PF02371 | Transposase_20 | 0.21 |
| PF12770 | CHAT | 0.21 |
| PF00392 | GntR | 0.21 |
| PF13518 | HTH_28 | 0.21 |
| PF14338 | Mrr_N | 0.21 |
| PF01120 | Alpha_L_fucos | 0.21 |
| PF08471 | Ribonuc_red_2_N | 0.21 |
| PF13563 | 2_5_RNA_ligase2 | 0.21 |
| PF04909 | Amidohydro_2 | 0.21 |
| PF13673 | Acetyltransf_10 | 0.21 |
| PF02321 | OEP | 0.21 |
| PF01053 | Cys_Met_Meta_PP | 0.21 |
| PF12681 | Glyoxalase_2 | 0.21 |
| PF07853 | DUF1648 | 0.21 |
| PF01266 | DAO | 0.21 |
| PF13378 | MR_MLE_C | 0.21 |
| PF10041 | DUF2277 | 0.21 |
| PF00561 | Abhydrolase_1 | 0.21 |
| PF00343 | Phosphorylase | 0.21 |
| PF02065 | Melibiase | 0.21 |
| PF02055 | Glyco_hydro_30 | 0.21 |
| PF04966 | OprB | 0.21 |
| PF00535 | Glycos_transf_2 | 0.21 |
| PF12796 | Ank_2 | 0.21 |
| PF00027 | cNMP_binding | 0.21 |
| PF13517 | FG-GAP_3 | 0.21 |
| PF00150 | Cellulase | 0.21 |
| PF07995 | GSDH | 0.21 |
| PF14871 | GHL6 | 0.21 |
| PF02746 | MR_MLE_N | 0.21 |
| PF13601 | HTH_34 | 0.21 |
| PF12867 | DinB_2 | 0.21 |
| PF01841 | Transglut_core | 0.21 |
| PF03200 | Glyco_hydro_63 | 0.21 |
| PF00924 | MS_channel | 0.21 |
| PF03976 | PPK2 | 0.21 |
| PF02446 | Glyco_hydro_77 | 0.21 |
| PF05222 | AlaDh_PNT_N | 0.21 |
| PF13103 | TonB_2 | 0.21 |
| PF05721 | PhyH | 0.21 |
| PF01738 | DLH | 0.21 |
| PF13826 | DUF4188 | 0.21 |
| PF11154 | DUF2934 | 0.21 |
| PF01694 | Rhomboid | 0.21 |
| PF00180 | Iso_dh | 0.21 |
| PF03721 | UDPG_MGDP_dh_N | 0.21 |
| PF00753 | Lactamase_B | 0.21 |
| PF02687 | FtsX | 0.21 |
| PF13185 | GAF_2 | 0.21 |
| PF00668 | Condensation | 0.21 |
| PF06463 | Mob_synth_C | 0.21 |
| PF00294 | PfkB | 0.21 |
| PF09949 | APP1_cat | 0.21 |
| PF01966 | HD | 0.21 |
| PF07715 | Plug | 0.21 |
| PF00722 | Glyco_hydro_16 | 0.21 |
| PF01174 | SNO | 0.21 |
| PF03169 | OPT | 0.21 |
| PF08534 | Redoxin | 0.21 |
| PF10282 | Lactonase | 0.21 |
| PF01613 | Flavin_Reduct | 0.21 |
| PF00069 | Pkinase | 0.21 |
| PF05960 | DUF885 | 0.21 |
| PF07823 | CPDase | 0.21 |
| PF01791 | DeoC | 0.21 |
| COG ID | Name | Functional Category | % Frequency in 470 Family Scaffolds |
|---|---|---|---|
| COG2259 | Uncharacterized membrane protein YphA, DoxX/SURF4 family | Function unknown [S] | 18.94 |
| COG4270 | Uncharacterized membrane protein | Function unknown [S] | 18.94 |
| COG1826 | Twin-arginine protein secretion pathway components TatA and TatB | Intracellular trafficking, secretion, and vesicular transport [U] | 2.34 |
| COG0805 | Twin-arginine protein secretion pathway component TatC | Intracellular trafficking, secretion, and vesicular transport [U] | 1.70 |
| COG3534 | Alpha-L-arabinofuranosidase | Carbohydrate transport and metabolism [G] | 1.49 |
| COG3511 | Phospholipase C | Cell wall/membrane/envelope biogenesis [M] | 1.06 |
| COG0407 | Uroporphyrinogen-III decarboxylase HemE | Coenzyme transport and metabolism [H] | 0.85 |
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 0.85 |
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 0.85 |
| COG0469 | Pyruvate kinase | Carbohydrate transport and metabolism [G] | 0.64 |
| COG2318 | Bacillithiol/mycothiol S-transferase BstA/DinB, DinB/YfiT family (unrelated to E. coli DinB) | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.64 |
| COG3254 | L-rhamnose mutarotase | Cell wall/membrane/envelope biogenesis [M] | 0.64 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.43 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.43 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 0.43 |
| COG1538 | Outer membrane protein TolC | Cell wall/membrane/envelope biogenesis [M] | 0.43 |
| COG2900 | Uncharacterized coiled-coil protein SlyX (sensitive to lysis X) | Function unknown [S] | 0.43 |
| COG3387 | Glucoamylase (glucan-1,4-alpha-glucosidase), GH15 family | Carbohydrate transport and metabolism [G] | 0.43 |
| COG4948 | L-alanine-DL-glutamate epimerase or related enzyme of enolase superfamily | Cell wall/membrane/envelope biogenesis [M] | 0.43 |
| COG0058 | Glucan phosphorylase | Carbohydrate transport and metabolism [G] | 0.21 |
| COG0075 | Archaeal aspartate aminotransferase or a related aminotransferase, includes purine catabolism protein PucG | Amino acid transport and metabolism [E] | 0.21 |
| COG0118 | Imidazoleglycerol phosphate synthase glutamine amidotransferase subunit HisH | Amino acid transport and metabolism [E] | 0.21 |
| COG0156 | 7-keto-8-aminopelargonate synthetase or related enzyme | Coenzyme transport and metabolism [H] | 0.21 |
| COG0209 | Ribonucleotide reductase alpha subunit | Nucleotide transport and metabolism [F] | 0.21 |
| COG0240 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.21 |
| COG0311 | Pyridoxal 5'-phosphate synthase subunit PdxT (glutamine amidotransferase) | Coenzyme transport and metabolism [H] | 0.21 |
| COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 0.21 |
| COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 0.21 |
| COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 0.21 |
| COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 0.21 |
| COG0668 | Small-conductance mechanosensitive channel | Cell wall/membrane/envelope biogenesis [M] | 0.21 |
| COG0677 | UDP-N-acetyl-D-mannosaminuronate dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 0.21 |
| COG0705 | Membrane-associated serine protease, rhomboid family | Posttranslational modification, protein turnover, chaperones [O] | 0.21 |
| COG1004 | UDP-glucose 6-dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 0.21 |
| COG1020 | EntF, seryl-AMP synthase component of non-ribosomal peptide synthetase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.21 |
| COG1250 | 3-hydroxyacyl-CoA dehydrogenase | Lipid transport and metabolism [I] | 0.21 |
| COG1297 | Predicted oligopeptide transporter, OPT family | General function prediction only [R] | 0.21 |
| COG1640 | 4-alpha-glucanotransferase | Carbohydrate transport and metabolism [G] | 0.21 |
| COG1853 | FMN reductase RutF, DIM6/NTAB family | Energy production and conversion [C] | 0.21 |
| COG1893 | Ketopantoate reductase | Coenzyme transport and metabolism [H] | 0.21 |
| COG1921 | Seryl-tRNA(Sec) selenium transferase | Translation, ribosomal structure and biogenesis [J] | 0.21 |
| COG1982 | Arginine/lysine/ornithine decarboxylase | Amino acid transport and metabolism [E] | 0.21 |
| COG2008 | Threonine aldolase | Amino acid transport and metabolism [E] | 0.21 |
| COG2133 | Glucose/arabinose dehydrogenase, beta-propeller fold | Carbohydrate transport and metabolism [G] | 0.21 |
| COG2273 | Beta-glucanase, GH16 family | Carbohydrate transport and metabolism [G] | 0.21 |
| COG2326 | Polyphosphate kinase 2, PPK2 family | Energy production and conversion [C] | 0.21 |
| COG2730 | Aryl-phospho-beta-D-glucosidase BglC, GH1 family | Carbohydrate transport and metabolism [G] | 0.21 |
| COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 0.21 |
| COG2896 | GTP 3',8-cyclase (molybdenum cofactor biosynthesis protein MoaA) | Coenzyme transport and metabolism [H] | 0.21 |
| COG3264 | Small-conductance mechanosensitive channel MscK | Cell wall/membrane/envelope biogenesis [M] | 0.21 |
| COG3345 | Alpha-galactosidase | Carbohydrate transport and metabolism [G] | 0.21 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.21 |
| COG3659 | Carbohydrate-selective porin OprB | Cell wall/membrane/envelope biogenesis [M] | 0.21 |
| COG3669 | Alpha-L-fucosidase | Carbohydrate transport and metabolism [G] | 0.21 |
| COG3934 | Endo-1,4-beta-mannosidase | Carbohydrate transport and metabolism [G] | 0.21 |
| COG4100 | Cystathionine beta-lyase family protein involved in aluminum resistance | Inorganic ion transport and metabolism [P] | 0.21 |
| COG4805 | Uncharacterized conserved protein, DUF885 family | Function unknown [S] | 0.21 |
| COG5285 | Ectoine hydroxylase-related dioxygenase, phytanoyl-CoA dioxygenase (PhyH) family | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.21 |
| COG5520 | O-Glycosyl hydrolase | Cell wall/membrane/envelope biogenesis [M] | 0.21 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 92.77 % |
| Unclassified | root | N/A | 7.23 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2162886011|MRS1b_contig_2663501 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → Mesorhizobium caraganae | 1056 | Open in IMG/M |
| 2170459010|GIO7OMY02GEIGB | Not Available | 563 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101648586 | Not Available | 1192 | Open in IMG/M |
| 3300000955|JGI1027J12803_100312237 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 710 | Open in IMG/M |
| 3300001154|JGI12636J13339_1050525 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 514 | Open in IMG/M |
| 3300001471|JGI12712J15308_10076128 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 849 | Open in IMG/M |
| 3300001546|JGI12659J15293_10079167 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 721 | Open in IMG/M |
| 3300001593|JGI12635J15846_10113418 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1925 | Open in IMG/M |
| 3300001593|JGI12635J15846_10773968 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100722811 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 875 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100846522 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 796 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101463963 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 577 | Open in IMG/M |
| 3300002907|JGI25613J43889_10046806 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1222 | Open in IMG/M |
| 3300002911|JGI25390J43892_10098190 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 657 | Open in IMG/M |
| 3300004080|Ga0062385_10085631 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1483 | Open in IMG/M |
| 3300004081|Ga0063454_100022857 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2027 | Open in IMG/M |
| 3300004082|Ga0062384_101178986 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 556 | Open in IMG/M |
| 3300004082|Ga0062384_101408275 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300004091|Ga0062387_100567998 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 806 | Open in IMG/M |
| 3300004152|Ga0062386_100484672 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1003 | Open in IMG/M |
| 3300004152|Ga0062386_101291146 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300005162|Ga0066814_10079929 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 585 | Open in IMG/M |
| 3300005171|Ga0066677_10032228 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2519 | Open in IMG/M |
| 3300005176|Ga0066679_10450715 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 842 | Open in IMG/M |
| 3300005176|Ga0066679_10860800 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300005179|Ga0066684_10271153 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1120 | Open in IMG/M |
| 3300005332|Ga0066388_100054032 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4168 | Open in IMG/M |
| 3300005332|Ga0066388_101700012 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1117 | Open in IMG/M |
| 3300005366|Ga0070659_100155521 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1867 | Open in IMG/M |
| 3300005439|Ga0070711_101626767 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 565 | Open in IMG/M |
| 3300005445|Ga0070708_101337307 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300005467|Ga0070706_100378903 | All Organisms → cellular organisms → Bacteria | 1318 | Open in IMG/M |
| 3300005468|Ga0070707_101452156 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300005526|Ga0073909_10028431 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1890 | Open in IMG/M |
| 3300005529|Ga0070741_10106360 | All Organisms → cellular organisms → Bacteria | 2955 | Open in IMG/M |
| 3300005537|Ga0070730_10190512 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1372 | Open in IMG/M |
| 3300005539|Ga0068853_100603638 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1042 | Open in IMG/M |
| 3300005540|Ga0066697_10211157 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1153 | Open in IMG/M |
| 3300005541|Ga0070733_10597222 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
| 3300005542|Ga0070732_10195827 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1207 | Open in IMG/M |
| 3300005554|Ga0066661_10526883 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 710 | Open in IMG/M |
| 3300005556|Ga0066707_10228172 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1209 | Open in IMG/M |
| 3300005557|Ga0066704_10616448 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 695 | Open in IMG/M |
| 3300005557|Ga0066704_10805917 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300005561|Ga0066699_10457204 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 913 | Open in IMG/M |
| 3300005561|Ga0066699_10861678 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 634 | Open in IMG/M |
| 3300005569|Ga0066705_10783135 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 569 | Open in IMG/M |
| 3300005569|Ga0066705_10845298 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 544 | Open in IMG/M |
| 3300005575|Ga0066702_10030920 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2739 | Open in IMG/M |
| 3300005576|Ga0066708_10265304 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1094 | Open in IMG/M |
| 3300005602|Ga0070762_10756454 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 655 | Open in IMG/M |
| 3300005610|Ga0070763_10227423 | All Organisms → cellular organisms → Bacteria | 1003 | Open in IMG/M |
| 3300005610|Ga0070763_10654983 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300005614|Ga0068856_100187672 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2081 | Open in IMG/M |
| 3300005712|Ga0070764_10264396 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 983 | Open in IMG/M |
| 3300005764|Ga0066903_104458197 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 747 | Open in IMG/M |
| 3300005764|Ga0066903_105403765 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 674 | Open in IMG/M |
| 3300005764|Ga0066903_106196370 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300005764|Ga0066903_108138194 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_1_40CM_4_62_6 | 537 | Open in IMG/M |
| 3300005921|Ga0070766_11191780 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 527 | Open in IMG/M |
| 3300005938|Ga0066795_10269761 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300005952|Ga0080026_10009281 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2302 | Open in IMG/M |
| 3300005952|Ga0080026_10161722 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 652 | Open in IMG/M |
| 3300005993|Ga0080027_10116681 | All Organisms → cellular organisms → Bacteria | 1009 | Open in IMG/M |
| 3300005995|Ga0066790_10032195 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2285 | Open in IMG/M |
| 3300006028|Ga0070717_10570750 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1025 | Open in IMG/M |
| 3300006047|Ga0075024_100326593 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
| 3300006050|Ga0075028_100741746 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300006052|Ga0075029_100979871 | Not Available | 583 | Open in IMG/M |
| 3300006059|Ga0075017_101052745 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 634 | Open in IMG/M |
| 3300006102|Ga0075015_100115377 | All Organisms → cellular organisms → Bacteria | 1365 | Open in IMG/M |
| 3300006162|Ga0075030_100899402 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 698 | Open in IMG/M |
| 3300006174|Ga0075014_100248648 | All Organisms → cellular organisms → Bacteria | 917 | Open in IMG/M |
| 3300006175|Ga0070712_101296564 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 635 | Open in IMG/M |
| 3300006755|Ga0079222_11435099 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 641 | Open in IMG/M |
| 3300006791|Ga0066653_10778787 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 502 | Open in IMG/M |
| 3300006796|Ga0066665_11243963 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 569 | Open in IMG/M |
| 3300006797|Ga0066659_10144906 | All Organisms → cellular organisms → Bacteria | 1681 | Open in IMG/M |
| 3300006797|Ga0066659_10995059 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 701 | Open in IMG/M |
| 3300006852|Ga0075433_10306340 | All Organisms → cellular organisms → Bacteria | 1406 | Open in IMG/M |
| 3300006854|Ga0075425_101564499 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
| 3300006953|Ga0074063_13237386 | Not Available | 754 | Open in IMG/M |
| 3300007258|Ga0099793_10086769 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1435 | Open in IMG/M |
| 3300007258|Ga0099793_10333104 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_1_40CM_4_62_6 | 740 | Open in IMG/M |
| 3300007788|Ga0099795_10098242 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1145 | Open in IMG/M |
| 3300007982|Ga0102924_1260524 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
| 3300009038|Ga0099829_10481892 | Not Available | 1029 | Open in IMG/M |
| 3300009038|Ga0099829_11106671 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 657 | Open in IMG/M |
| 3300009090|Ga0099827_10318291 | Not Available | 1319 | Open in IMG/M |
| 3300009090|Ga0099827_11260953 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_1_40CM_4_62_6 | 643 | Open in IMG/M |
| 3300009143|Ga0099792_10552587 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
| 3300009521|Ga0116222_1306317 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
| 3300009551|Ga0105238_11072192 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 828 | Open in IMG/M |
| 3300009551|Ga0105238_11540912 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 694 | Open in IMG/M |
| 3300009632|Ga0116102_1195892 | Not Available | 544 | Open in IMG/M |
| 3300009634|Ga0116124_1033047 | All Organisms → cellular organisms → Bacteria | 1586 | Open in IMG/M |
| 3300009646|Ga0116132_1031878 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1778 | Open in IMG/M |
| 3300009672|Ga0116215_1494284 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 529 | Open in IMG/M |
| 3300009700|Ga0116217_10325241 | All Organisms → cellular organisms → Bacteria | 985 | Open in IMG/M |
| 3300009700|Ga0116217_10805058 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 578 | Open in IMG/M |
| 3300009760|Ga0116131_1094561 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 901 | Open in IMG/M |
| 3300009839|Ga0116223_10012513 | All Organisms → cellular organisms → Bacteria | 6323 | Open in IMG/M |
| 3300010043|Ga0126380_11976797 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300010048|Ga0126373_13326130 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_1_40CM_4_62_6 | 500 | Open in IMG/M |
| 3300010303|Ga0134082_10486041 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_1_40CM_4_62_6 | 537 | Open in IMG/M |
| 3300010335|Ga0134063_10378693 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_1_40CM_4_62_6 | 691 | Open in IMG/M |
| 3300010335|Ga0134063_10716207 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_1_40CM_4_62_6 | 518 | Open in IMG/M |
| 3300010341|Ga0074045_10017287 | All Organisms → cellular organisms → Bacteria | 5760 | Open in IMG/M |
| 3300010341|Ga0074045_10552056 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 737 | Open in IMG/M |
| 3300010343|Ga0074044_10360358 | All Organisms → cellular organisms → Bacteria | 953 | Open in IMG/M |
| 3300010358|Ga0126370_10283879 | All Organisms → cellular organisms → Bacteria | 1303 | Open in IMG/M |
| 3300010358|Ga0126370_10288239 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1295 | Open in IMG/M |
| 3300010358|Ga0126370_11490286 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 643 | Open in IMG/M |
| 3300010359|Ga0126376_10660161 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 999 | Open in IMG/M |
| 3300010359|Ga0126376_11848019 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 643 | Open in IMG/M |
| 3300010360|Ga0126372_12929583 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 529 | Open in IMG/M |
| 3300010361|Ga0126378_10648677 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1169 | Open in IMG/M |
| 3300010361|Ga0126378_11371988 | All Organisms → cellular organisms → Bacteria | 800 | Open in IMG/M |
| 3300010361|Ga0126378_11767972 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
| 3300010364|Ga0134066_10002703 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 3023 | Open in IMG/M |
| 3300010364|Ga0134066_10135578 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_1_40CM_4_62_6 | 757 | Open in IMG/M |
| 3300010366|Ga0126379_10072635 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 2942 | Open in IMG/M |
| 3300010373|Ga0134128_11547614 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 730 | Open in IMG/M |
| 3300010373|Ga0134128_12923893 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 526 | Open in IMG/M |
| 3300010376|Ga0126381_101012981 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1198 | Open in IMG/M |
| 3300010376|Ga0126381_103522310 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300010379|Ga0136449_101146780 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetes bacterium DG_61 | 1231 | Open in IMG/M |
| 3300010379|Ga0136449_104478936 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300010398|Ga0126383_10364922 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1469 | Open in IMG/M |
| 3300011120|Ga0150983_10402964 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300011269|Ga0137392_10333771 | All Organisms → cellular organisms → Bacteria | 1255 | Open in IMG/M |
| 3300011269|Ga0137392_11088597 | Not Available | 655 | Open in IMG/M |
| 3300011270|Ga0137391_10238124 | All Organisms → cellular organisms → Bacteria | 1579 | Open in IMG/M |
| 3300011270|Ga0137391_10897595 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 725 | Open in IMG/M |
| 3300011271|Ga0137393_10027032 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4290 | Open in IMG/M |
| 3300011271|Ga0137393_10675907 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 885 | Open in IMG/M |
| 3300011271|Ga0137393_10811219 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 800 | Open in IMG/M |
| 3300011271|Ga0137393_10964912 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_1_40CM_4_62_6 | 726 | Open in IMG/M |
| 3300012096|Ga0137389_10010102 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 6251 | Open in IMG/M |
| 3300012096|Ga0137389_10366488 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1227 | Open in IMG/M |
| 3300012189|Ga0137388_10317898 | All Organisms → cellular organisms → Bacteria | 1430 | Open in IMG/M |
| 3300012189|Ga0137388_11810671 | Not Available | 542 | Open in IMG/M |
| 3300012200|Ga0137382_10176366 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1460 | Open in IMG/M |
| 3300012200|Ga0137382_10679739 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 737 | Open in IMG/M |
| 3300012201|Ga0137365_10165155 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1660 | Open in IMG/M |
| 3300012202|Ga0137363_10241175 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1466 | Open in IMG/M |
| 3300012202|Ga0137363_10316757 | All Organisms → cellular organisms → Bacteria | 1284 | Open in IMG/M |
| 3300012202|Ga0137363_10791584 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
| 3300012203|Ga0137399_10113646 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2116 | Open in IMG/M |
| 3300012203|Ga0137399_10129773 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1991 | Open in IMG/M |
| 3300012203|Ga0137399_10265976 | All Organisms → cellular organisms → Bacteria | 1410 | Open in IMG/M |
| 3300012203|Ga0137399_10266253 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1409 | Open in IMG/M |
| 3300012203|Ga0137399_10586465 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 937 | Open in IMG/M |
| 3300012203|Ga0137399_11077388 | Not Available | 676 | Open in IMG/M |
| 3300012205|Ga0137362_11038370 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
| 3300012205|Ga0137362_11425202 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_1_40CM_4_62_6 | 579 | Open in IMG/M |
| 3300012207|Ga0137381_10494167 | Not Available | 1068 | Open in IMG/M |
| 3300012207|Ga0137381_10820983 | Not Available | 805 | Open in IMG/M |
| 3300012207|Ga0137381_11169239 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_1_40CM_4_62_6 | 661 | Open in IMG/M |
| 3300012209|Ga0137379_10472154 | Not Available | 1163 | Open in IMG/M |
| 3300012209|Ga0137379_11384979 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300012211|Ga0137377_10483819 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1176 | Open in IMG/M |
| 3300012211|Ga0137377_10601245 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1037 | Open in IMG/M |
| 3300012349|Ga0137387_10536153 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_1_40CM_4_62_6 | 849 | Open in IMG/M |
| 3300012350|Ga0137372_10149338 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1910 | Open in IMG/M |
| 3300012355|Ga0137369_10658022 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 723 | Open in IMG/M |
| 3300012357|Ga0137384_10082853 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 2666 | Open in IMG/M |
| 3300012357|Ga0137384_10297157 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1343 | Open in IMG/M |
| 3300012362|Ga0137361_11514473 | Not Available | 593 | Open in IMG/M |
| 3300012362|Ga0137361_11707360 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300012363|Ga0137390_10552717 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1122 | Open in IMG/M |
| 3300012469|Ga0150984_110731254 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 520 | Open in IMG/M |
| 3300012582|Ga0137358_10356751 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 990 | Open in IMG/M |
| 3300012917|Ga0137395_10123180 | All Organisms → cellular organisms → Bacteria | 1749 | Open in IMG/M |
| 3300012917|Ga0137395_11265726 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300012918|Ga0137396_10283899 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1223 | Open in IMG/M |
| 3300012918|Ga0137396_11223400 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_1_40CM_4_62_6 | 527 | Open in IMG/M |
| 3300012922|Ga0137394_10193256 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1737 | Open in IMG/M |
| 3300012922|Ga0137394_10531639 | All Organisms → cellular organisms → Bacteria | 997 | Open in IMG/M |
| 3300012923|Ga0137359_10447744 | All Organisms → cellular organisms → Bacteria | 1142 | Open in IMG/M |
| 3300012924|Ga0137413_11780119 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300012925|Ga0137419_10031495 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3253 | Open in IMG/M |
| 3300012925|Ga0137419_10591254 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 891 | Open in IMG/M |
| 3300012925|Ga0137419_11420589 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_1_40CM_4_62_6 | 586 | Open in IMG/M |
| 3300012927|Ga0137416_11226499 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_1_40CM_4_62_6 | 676 | Open in IMG/M |
| 3300012929|Ga0137404_10011075 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6243 | Open in IMG/M |
| 3300012929|Ga0137404_10590874 | All Organisms → cellular organisms → Bacteria | 998 | Open in IMG/M |
| 3300012929|Ga0137404_12243314 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 511 | Open in IMG/M |
| 3300012958|Ga0164299_11300535 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Acidobacteriales bacterium 13_2_20CM_55_8 | 556 | Open in IMG/M |
| 3300012971|Ga0126369_11822357 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 697 | Open in IMG/M |
| 3300012977|Ga0134087_10164285 | All Organisms → cellular organisms → Bacteria | 974 | Open in IMG/M |
| 3300012987|Ga0164307_10969548 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 689 | Open in IMG/M |
| 3300012987|Ga0164307_11465725 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 576 | Open in IMG/M |
| 3300013296|Ga0157374_10359058 | All Organisms → cellular organisms → Bacteria | 1448 | Open in IMG/M |
| 3300013307|Ga0157372_12398070 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 606 | Open in IMG/M |
| 3300014154|Ga0134075_10251542 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_1_40CM_4_62_6 | 764 | Open in IMG/M |
| 3300014155|Ga0181524_10071490 | All Organisms → cellular organisms → Bacteria | 2064 | Open in IMG/M |
| 3300014165|Ga0181523_10530497 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300014168|Ga0181534_10806859 | Not Available | 555 | Open in IMG/M |
| 3300014497|Ga0182008_10800375 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300014498|Ga0182019_10544404 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 809 | Open in IMG/M |
| 3300014501|Ga0182024_10228548 | All Organisms → cellular organisms → Bacteria | 2515 | Open in IMG/M |
| 3300014657|Ga0181522_10946091 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 532 | Open in IMG/M |
| 3300015051|Ga0137414_1063290 | All Organisms → cellular organisms → Bacteria | 732 | Open in IMG/M |
| 3300015052|Ga0137411_1257559 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_1_40CM_4_62_6 | 593 | Open in IMG/M |
| 3300015054|Ga0137420_1066604 | Not Available | 597 | Open in IMG/M |
| 3300015054|Ga0137420_1113774 | All Organisms → cellular organisms → Bacteria | 1019 | Open in IMG/M |
| 3300015054|Ga0137420_1454410 | All Organisms → cellular organisms → Bacteria | 3150 | Open in IMG/M |
| 3300015241|Ga0137418_10154200 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2022 | Open in IMG/M |
| 3300015371|Ga0132258_13652116 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1051 | Open in IMG/M |
| 3300016294|Ga0182041_10933645 | Not Available | 782 | Open in IMG/M |
| 3300016319|Ga0182033_10589665 | All Organisms → cellular organisms → Bacteria | 964 | Open in IMG/M |
| 3300016357|Ga0182032_10111321 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1956 | Open in IMG/M |
| 3300016387|Ga0182040_11492999 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_1_40CM_4_62_6 | 574 | Open in IMG/M |
| 3300016404|Ga0182037_10315668 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1261 | Open in IMG/M |
| 3300017823|Ga0187818_10087069 | All Organisms → cellular organisms → Bacteria | 1349 | Open in IMG/M |
| 3300017931|Ga0187877_1399644 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 519 | Open in IMG/M |
| 3300017933|Ga0187801_10425172 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 555 | Open in IMG/M |
| 3300017936|Ga0187821_10351784 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300017940|Ga0187853_10060497 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1921 | Open in IMG/M |
| 3300017943|Ga0187819_10199991 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 1179 | Open in IMG/M |
| 3300017944|Ga0187786_10281993 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300017946|Ga0187879_10748702 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 545 | Open in IMG/M |
| 3300017955|Ga0187817_10002668 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 9312 | Open in IMG/M |
| 3300017959|Ga0187779_10280267 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1062 | Open in IMG/M |
| 3300017970|Ga0187783_11007354 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300017970|Ga0187783_11094851 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetes bacterium DG_61 | 574 | Open in IMG/M |
| 3300017970|Ga0187783_11183153 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300017972|Ga0187781_10594277 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 798 | Open in IMG/M |
| 3300017973|Ga0187780_10949615 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300017975|Ga0187782_11520494 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 528 | Open in IMG/M |
| 3300017995|Ga0187816_10114114 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 1162 | Open in IMG/M |
| 3300017995|Ga0187816_10428297 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300017996|Ga0187891_1013814 | All Organisms → cellular organisms → Bacteria | 4079 | Open in IMG/M |
| 3300017999|Ga0187767_10153476 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 692 | Open in IMG/M |
| 3300018003|Ga0187876_1043190 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1906 | Open in IMG/M |
| 3300018004|Ga0187865_1003526 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 12792 | Open in IMG/M |
| 3300018006|Ga0187804_10103429 | All Organisms → cellular organisms → Bacteria | 1172 | Open in IMG/M |
| 3300018006|Ga0187804_10232897 | Not Available | 792 | Open in IMG/M |
| 3300018008|Ga0187888_1056492 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 1785 | Open in IMG/M |
| 3300018022|Ga0187864_10329409 | Not Available | 674 | Open in IMG/M |
| 3300018035|Ga0187875_10401525 | All Organisms → cellular organisms → Bacteria | 732 | Open in IMG/M |
| 3300018037|Ga0187883_10759731 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 506 | Open in IMG/M |
| 3300018043|Ga0187887_10310904 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 931 | Open in IMG/M |
| 3300018058|Ga0187766_10754788 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
| 3300018062|Ga0187784_11459753 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 542 | Open in IMG/M |
| 3300018062|Ga0187784_11570571 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 521 | Open in IMG/M |
| 3300018085|Ga0187772_10020243 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3811 | Open in IMG/M |
| 3300018085|Ga0187772_10374262 | All Organisms → cellular organisms → Bacteria | 988 | Open in IMG/M |
| 3300018088|Ga0187771_10834017 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 782 | Open in IMG/M |
| 3300018090|Ga0187770_10259837 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1346 | Open in IMG/M |
| 3300018468|Ga0066662_12573498 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300018482|Ga0066669_10001238 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 9562 | Open in IMG/M |
| 3300018482|Ga0066669_10803201 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 833 | Open in IMG/M |
| 3300019789|Ga0137408_1207158 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1515 | Open in IMG/M |
| 3300019789|Ga0137408_1226130 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1553 | Open in IMG/M |
| 3300019789|Ga0137408_1226131 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1507 | Open in IMG/M |
| 3300019789|Ga0137408_1392927 | All Organisms → cellular organisms → Bacteria | 1519 | Open in IMG/M |
| 3300019890|Ga0193728_1098027 | All Organisms → cellular organisms → Bacteria | 1358 | Open in IMG/M |
| 3300019890|Ga0193728_1190365 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 869 | Open in IMG/M |
| 3300020002|Ga0193730_1129964 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 683 | Open in IMG/M |
| 3300020004|Ga0193755_1006939 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3673 | Open in IMG/M |
| 3300020018|Ga0193721_1134130 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 612 | Open in IMG/M |
| 3300020170|Ga0179594_10056934 | All Organisms → cellular organisms → Bacteria | 1333 | Open in IMG/M |
| 3300020199|Ga0179592_10017881 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3124 | Open in IMG/M |
| 3300020199|Ga0179592_10347500 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 653 | Open in IMG/M |
| 3300020579|Ga0210407_10064567 | All Organisms → cellular organisms → Bacteria | 2744 | Open in IMG/M |
| 3300020579|Ga0210407_10319158 | All Organisms → cellular organisms → Bacteria | 1214 | Open in IMG/M |
| 3300020579|Ga0210407_10821401 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
| 3300020579|Ga0210407_11120925 | Not Available | 595 | Open in IMG/M |
| 3300020579|Ga0210407_11160524 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_1_40CM_4_62_6 | 583 | Open in IMG/M |
| 3300020579|Ga0210407_11292794 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 545 | Open in IMG/M |
| 3300020580|Ga0210403_10026198 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4647 | Open in IMG/M |
| 3300020581|Ga0210399_10455070 | All Organisms → cellular organisms → Bacteria | 1066 | Open in IMG/M |
| 3300020582|Ga0210395_11060275 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300020582|Ga0210395_11318922 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300020583|Ga0210401_11014743 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 688 | Open in IMG/M |
| 3300021168|Ga0210406_10003264 | All Organisms → cellular organisms → Bacteria | 17920 | Open in IMG/M |
| 3300021170|Ga0210400_11010986 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 675 | Open in IMG/M |
| 3300021170|Ga0210400_11397499 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300021170|Ga0210400_11477895 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 539 | Open in IMG/M |
| 3300021171|Ga0210405_10000319 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 67501 | Open in IMG/M |
| 3300021171|Ga0210405_10497040 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 956 | Open in IMG/M |
| 3300021171|Ga0210405_10950297 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
| 3300021178|Ga0210408_10691744 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
| 3300021181|Ga0210388_10096230 | Not Available | 2531 | Open in IMG/M |
| 3300021181|Ga0210388_10452991 | All Organisms → cellular organisms → Bacteria | 1127 | Open in IMG/M |
| 3300021344|Ga0193719_10041670 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1988 | Open in IMG/M |
| 3300021377|Ga0213874_10290093 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300021404|Ga0210389_10428926 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1040 | Open in IMG/M |
| 3300021405|Ga0210387_10463785 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1125 | Open in IMG/M |
| 3300021405|Ga0210387_10498349 | All Organisms → cellular organisms → Bacteria | 1082 | Open in IMG/M |
| 3300021405|Ga0210387_11334347 | Not Available | 619 | Open in IMG/M |
| 3300021407|Ga0210383_10157233 | All Organisms → cellular organisms → Bacteria | 1934 | Open in IMG/M |
| 3300021420|Ga0210394_10396243 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1214 | Open in IMG/M |
| 3300021420|Ga0210394_10548888 | All Organisms → cellular organisms → Bacteria | 1016 | Open in IMG/M |
| 3300021420|Ga0210394_11467210 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 578 | Open in IMG/M |
| 3300021432|Ga0210384_10002755 | All Organisms → cellular organisms → Bacteria | 21123 | Open in IMG/M |
| 3300021432|Ga0210384_10438011 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1177 | Open in IMG/M |
| 3300021432|Ga0210384_10997042 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
| 3300021433|Ga0210391_10692115 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 799 | Open in IMG/M |
| 3300021474|Ga0210390_10076812 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2764 | Open in IMG/M |
| 3300021474|Ga0210390_10370068 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1212 | Open in IMG/M |
| 3300021475|Ga0210392_11075571 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300021475|Ga0210392_11084061 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 600 | Open in IMG/M |
| 3300021479|Ga0210410_11589228 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 547 | Open in IMG/M |
| 3300021559|Ga0210409_10026911 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5551 | Open in IMG/M |
| 3300021559|Ga0210409_10072451 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3201 | Open in IMG/M |
| 3300021861|Ga0213853_10478817 | All Organisms → cellular organisms → Bacteria | 1696 | Open in IMG/M |
| 3300022522|Ga0242659_1123884 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300022531|Ga0242660_1178053 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300022726|Ga0242654_10020613 | All Organisms → cellular organisms → Bacteria | 1611 | Open in IMG/M |
| 3300024251|Ga0247679_1077992 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_1_40CM_4_62_6 | 557 | Open in IMG/M |
| 3300024288|Ga0179589_10032166 | All Organisms → cellular organisms → Bacteria | 1852 | Open in IMG/M |
| 3300024288|Ga0179589_10502423 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 562 | Open in IMG/M |
| 3300024331|Ga0247668_1026498 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1193 | Open in IMG/M |
| 3300025427|Ga0208077_1019244 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 977 | Open in IMG/M |
| 3300025459|Ga0208689_1078594 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300025460|Ga0208562_1014083 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1985 | Open in IMG/M |
| 3300025898|Ga0207692_10492833 | All Organisms → cellular organisms → Bacteria | 777 | Open in IMG/M |
| 3300025905|Ga0207685_10514869 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_1_40CM_4_62_6 | 631 | Open in IMG/M |
| 3300025906|Ga0207699_11363540 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 525 | Open in IMG/M |
| 3300025909|Ga0207705_10268665 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → Mesorhizobium caraganae | 1304 | Open in IMG/M |
| 3300025914|Ga0207671_10845332 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea → Luteitalea sp. | 725 | Open in IMG/M |
| 3300025915|Ga0207693_10567418 | All Organisms → cellular organisms → Bacteria | 884 | Open in IMG/M |
| 3300025915|Ga0207693_10595851 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 860 | Open in IMG/M |
| 3300025922|Ga0207646_11555056 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_1_40CM_4_62_6 | 572 | Open in IMG/M |
| 3300025924|Ga0207694_11592400 | Not Available | 551 | Open in IMG/M |
| 3300025925|Ga0207650_10637335 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 898 | Open in IMG/M |
| 3300025927|Ga0207687_10525273 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 990 | Open in IMG/M |
| 3300025928|Ga0207700_10488787 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1088 | Open in IMG/M |
| 3300025929|Ga0207664_11986421 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 505 | Open in IMG/M |
| 3300025934|Ga0207686_11274221 | Not Available | 603 | Open in IMG/M |
| 3300025949|Ga0207667_10989089 | All Organisms → cellular organisms → Bacteria | 829 | Open in IMG/M |
| 3300025972|Ga0207668_12051135 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 515 | Open in IMG/M |
| 3300026035|Ga0207703_10151763 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2021 | Open in IMG/M |
| 3300026285|Ga0209438_1147529 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300026318|Ga0209471_1281542 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 555 | Open in IMG/M |
| 3300026325|Ga0209152_10327931 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 579 | Open in IMG/M |
| 3300026328|Ga0209802_1226629 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_1_40CM_4_62_6 | 680 | Open in IMG/M |
| 3300026331|Ga0209267_1044301 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Acidobacteriales bacterium 13_2_20CM_55_8 | 2037 | Open in IMG/M |
| 3300026331|Ga0209267_1049102 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1910 | Open in IMG/M |
| 3300026334|Ga0209377_1166448 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_1_40CM_4_62_6 | 809 | Open in IMG/M |
| 3300026490|Ga0257153_1076663 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300026523|Ga0209808_1222952 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_1_40CM_4_62_6 | 608 | Open in IMG/M |
| 3300026530|Ga0209807_1214375 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 664 | Open in IMG/M |
| 3300026530|Ga0209807_1240727 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300026538|Ga0209056_10422525 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Acidobacteriales bacterium 13_2_20CM_55_8 | 794 | Open in IMG/M |
| 3300026542|Ga0209805_1157875 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1034 | Open in IMG/M |
| 3300026548|Ga0209161_10066659 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2278 | Open in IMG/M |
| 3300026550|Ga0209474_10391953 | All Organisms → cellular organisms → Bacteria | 732 | Open in IMG/M |
| 3300026552|Ga0209577_10611496 | Not Available | 648 | Open in IMG/M |
| 3300026557|Ga0179587_10125964 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1576 | Open in IMG/M |
| 3300026557|Ga0179587_10510022 | Not Available | 789 | Open in IMG/M |
| 3300026921|Ga0207860_1006893 | All Organisms → cellular organisms → Bacteria | 1616 | Open in IMG/M |
| 3300027014|Ga0207815_1022033 | Not Available | 786 | Open in IMG/M |
| 3300027034|Ga0209730_1014480 | All Organisms → cellular organisms → Bacteria | 805 | Open in IMG/M |
| 3300027063|Ga0207762_1070195 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300027512|Ga0209179_1027350 | All Organisms → cellular organisms → Bacteria | 1150 | Open in IMG/M |
| 3300027528|Ga0208985_1061606 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
| 3300027605|Ga0209329_1087573 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 678 | Open in IMG/M |
| 3300027643|Ga0209076_1051816 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1162 | Open in IMG/M |
| 3300027643|Ga0209076_1173612 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_1_40CM_4_62_6 | 598 | Open in IMG/M |
| 3300027651|Ga0209217_1048707 | All Organisms → cellular organisms → Bacteria | 1283 | Open in IMG/M |
| 3300027737|Ga0209038_10076360 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1006 | Open in IMG/M |
| 3300027767|Ga0209655_10065468 | All Organisms → cellular organisms → Bacteria | 1210 | Open in IMG/M |
| 3300027767|Ga0209655_10274907 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 546 | Open in IMG/M |
| 3300027783|Ga0209448_10013086 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2678 | Open in IMG/M |
| 3300027821|Ga0209811_10138177 | Not Available | 897 | Open in IMG/M |
| 3300027826|Ga0209060_10530181 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 534 | Open in IMG/M |
| 3300027846|Ga0209180_10708699 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 546 | Open in IMG/M |
| 3300027854|Ga0209517_10036397 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium | 3987 | Open in IMG/M |
| 3300027857|Ga0209166_10399429 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
| 3300027860|Ga0209611_10235454 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1101 | Open in IMG/M |
| 3300027874|Ga0209465_10185484 | All Organisms → cellular organisms → Bacteria | 1037 | Open in IMG/M |
| 3300027879|Ga0209169_10343737 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 785 | Open in IMG/M |
| 3300027894|Ga0209068_10354823 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_1_40CM_4_62_6 | 831 | Open in IMG/M |
| 3300027903|Ga0209488_10747851 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
| 3300027905|Ga0209415_10251954 | All Organisms → cellular organisms → Bacteria | 1586 | Open in IMG/M |
| 3300027911|Ga0209698_10038529 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4299 | Open in IMG/M |
| 3300028138|Ga0247684_1022686 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 991 | Open in IMG/M |
| 3300028138|Ga0247684_1023857 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 967 | Open in IMG/M |
| 3300028380|Ga0268265_12080640 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_1_40CM_4_62_6 | 575 | Open in IMG/M |
| 3300028536|Ga0137415_11222137 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_1_40CM_4_62_6 | 567 | Open in IMG/M |
| 3300028666|Ga0265336_10184306 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 620 | Open in IMG/M |
| 3300028747|Ga0302219_10209713 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 752 | Open in IMG/M |
| 3300028792|Ga0307504_10359454 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_1_40CM_4_62_6 | 563 | Open in IMG/M |
| 3300028798|Ga0302222_10166605 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 866 | Open in IMG/M |
| 3300028873|Ga0302197_10424872 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 586 | Open in IMG/M |
| 3300029636|Ga0222749_10117284 | All Organisms → cellular organisms → Bacteria | 1267 | Open in IMG/M |
| 3300029953|Ga0311343_10696309 | All Organisms → cellular organisms → Bacteria | 850 | Open in IMG/M |
| 3300029987|Ga0311334_11347954 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300029999|Ga0311339_11649411 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300030011|Ga0302270_10426231 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 703 | Open in IMG/M |
| 3300030399|Ga0311353_10725993 | Not Available | 855 | Open in IMG/M |
| 3300030520|Ga0311372_11725276 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 753 | Open in IMG/M |
| 3300030520|Ga0311372_11996978 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
| 3300030659|Ga0316363_10089515 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1382 | Open in IMG/M |
| 3300030741|Ga0265459_10983011 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 882 | Open in IMG/M |
| 3300030813|Ga0265750_1070170 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 566 | Open in IMG/M |
| 3300030906|Ga0302314_11039471 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 786 | Open in IMG/M |
| 3300030916|Ga0075386_11951419 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300030940|Ga0265740_1001261 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1547 | Open in IMG/M |
| 3300030991|Ga0073994_11575089 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300031057|Ga0170834_108073587 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300031057|Ga0170834_109741073 | All Organisms → cellular organisms → Bacteria | 751 | Open in IMG/M |
| 3300031090|Ga0265760_10130072 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 814 | Open in IMG/M |
| 3300031128|Ga0170823_12953863 | All Organisms → cellular organisms → Bacteria | 940 | Open in IMG/M |
| 3300031231|Ga0170824_105611191 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 605 | Open in IMG/M |
| 3300031231|Ga0170824_114044823 | All Organisms → cellular organisms → Bacteria | 1495 | Open in IMG/M |
| 3300031231|Ga0170824_125400921 | All Organisms → cellular organisms → Bacteria | 1539 | Open in IMG/M |
| 3300031236|Ga0302324_100151574 | All Organisms → cellular organisms → Bacteria | 3798 | Open in IMG/M |
| 3300031456|Ga0307513_10943087 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 571 | Open in IMG/M |
| 3300031545|Ga0318541_10850460 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300031708|Ga0310686_103416712 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 593 | Open in IMG/M |
| 3300031708|Ga0310686_106787032 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 523 | Open in IMG/M |
| 3300031708|Ga0310686_112815055 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1996 | Open in IMG/M |
| 3300031715|Ga0307476_10121092 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1863 | Open in IMG/M |
| 3300031715|Ga0307476_10231107 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1347 | Open in IMG/M |
| 3300031715|Ga0307476_10370419 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1056 | Open in IMG/M |
| 3300031715|Ga0307476_10826613 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 685 | Open in IMG/M |
| 3300031718|Ga0307474_10234213 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1404 | Open in IMG/M |
| 3300031720|Ga0307469_10347097 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1244 | Open in IMG/M |
| 3300031720|Ga0307469_11326130 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_1_40CM_4_62_6 | 684 | Open in IMG/M |
| 3300031753|Ga0307477_10102495 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 1990 | Open in IMG/M |
| 3300031753|Ga0307477_10177410 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1485 | Open in IMG/M |
| 3300031754|Ga0307475_10334233 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1217 | Open in IMG/M |
| 3300031754|Ga0307475_10672567 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 826 | Open in IMG/M |
| 3300031754|Ga0307475_11005860 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_1_40CM_4_62_6 | 655 | Open in IMG/M |
| 3300031781|Ga0318547_10092619 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1713 | Open in IMG/M |
| 3300031820|Ga0307473_10127622 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1408 | Open in IMG/M |
| 3300031823|Ga0307478_10001417 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 20805 | Open in IMG/M |
| 3300031823|Ga0307478_10085820 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2412 | Open in IMG/M |
| 3300031823|Ga0307478_10118485 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2072 | Open in IMG/M |
| 3300031833|Ga0310917_10925401 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_1_40CM_4_62_6 | 586 | Open in IMG/M |
| 3300031879|Ga0306919_10196535 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1497 | Open in IMG/M |
| 3300031890|Ga0306925_10689709 | Not Available | 1070 | Open in IMG/M |
| 3300031959|Ga0318530_10480035 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_1_40CM_4_62_6 | 516 | Open in IMG/M |
| 3300031962|Ga0307479_10074962 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3272 | Open in IMG/M |
| 3300031962|Ga0307479_11501094 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300032002|Ga0307416_100211647 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales | 1850 | Open in IMG/M |
| 3300032160|Ga0311301_11029606 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1084 | Open in IMG/M |
| 3300032160|Ga0311301_11804932 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
| 3300032160|Ga0311301_12942676 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300032180|Ga0307471_103672573 | Not Available | 543 | Open in IMG/M |
| 3300032205|Ga0307472_100212359 | All Organisms → cellular organisms → Bacteria | 1482 | Open in IMG/M |
| 3300032205|Ga0307472_102615948 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300032579|Ga0316228_1186490 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
| 3300032605|Ga0316232_1189022 | All Organisms → cellular organisms → Bacteria | 837 | Open in IMG/M |
| 3300032782|Ga0335082_10111910 | All Organisms → cellular organisms → Bacteria | 2690 | Open in IMG/M |
| 3300032805|Ga0335078_10028260 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 8321 | Open in IMG/M |
| 3300032805|Ga0335078_11972088 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 626 | Open in IMG/M |
| 3300032805|Ga0335078_12591550 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300032828|Ga0335080_10084620 | All Organisms → cellular organisms → Bacteria | 3519 | Open in IMG/M |
| 3300032829|Ga0335070_11845496 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 546 | Open in IMG/M |
| 3300032893|Ga0335069_11634825 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetes bacterium DG_61 | 689 | Open in IMG/M |
| 3300032893|Ga0335069_12772121 | Not Available | 503 | Open in IMG/M |
| 3300032954|Ga0335083_11057414 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300032954|Ga0335083_11199631 | Not Available | 588 | Open in IMG/M |
| 3300032955|Ga0335076_10791912 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 830 | Open in IMG/M |
| 3300033289|Ga0310914_11619514 | Not Available | 551 | Open in IMG/M |
| 3300033402|Ga0326728_10828382 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300033405|Ga0326727_10714668 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 797 | Open in IMG/M |
| 3300033412|Ga0310810_10650639 | All Organisms → cellular organisms → Bacteria | 996 | Open in IMG/M |
| 3300033513|Ga0316628_102838594 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 636 | Open in IMG/M |
| 3300033982|Ga0371487_0404251 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola | 590 | Open in IMG/M |
| 3300033983|Ga0371488_0213033 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 966 | Open in IMG/M |
| 3300034163|Ga0370515_0125998 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1101 | Open in IMG/M |
| 3300034199|Ga0370514_023822 | All Organisms → cellular organisms → Bacteria | 1496 | Open in IMG/M |
| 3300034819|Ga0373958_0223250 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 502 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 18.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 12.13% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.23% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.47% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.40% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.40% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.62% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.55% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.34% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.13% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.13% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.77% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.77% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.77% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.91% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.91% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.70% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.70% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.49% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.49% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.28% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.28% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.28% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.28% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.85% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.85% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.85% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.64% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.64% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.64% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater | 0.43% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.43% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.43% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.43% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.43% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.43% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.43% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.43% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.43% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.43% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.43% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.43% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.21% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.21% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.21% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.21% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.21% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.21% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.21% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.21% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.21% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.21% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.21% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.21% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.21% |
| Ectomycorrhiza | Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza | 0.21% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.21% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.21% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.21% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.21% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.21% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.21% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.21% |
| Host-Associated | Host-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated | 0.21% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
| 2170459010 | Grass soil microbial communities from Rothamsted Park, UK - December 2009 direct MP BIO1O1 lysis 0-9cm (no DNA from 10 to 21cm!!!) | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001154 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 | Environmental | Open in IMG/M |
| 3300001471 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 | Environmental | Open in IMG/M |
| 3300001546 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002907 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm | Environmental | Open in IMG/M |
| 3300002911 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300005162 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAB | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300005938 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-191 | Environmental | Open in IMG/M |
| 3300005952 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 | Environmental | Open in IMG/M |
| 3300005993 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 | Environmental | Open in IMG/M |
| 3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006953 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300007982 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009632 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40 | Environmental | Open in IMG/M |
| 3300009634 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_150 | Environmental | Open in IMG/M |
| 3300009646 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_150 | Environmental | Open in IMG/M |
| 3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300009760 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_100 | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300014155 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_60_metaG | Environmental | Open in IMG/M |
| 3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
| 3300014168 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaG | Environmental | Open in IMG/M |
| 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
| 3300014498 | Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
| 3300015051 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017931 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_100 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
| 3300017940 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017944 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MG | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300017996 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_40 | Environmental | Open in IMG/M |
| 3300017999 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MG | Environmental | Open in IMG/M |
| 3300018003 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_40 | Environmental | Open in IMG/M |
| 3300018004 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_100 | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018008 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_40 | Environmental | Open in IMG/M |
| 3300018022 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40 | Environmental | Open in IMG/M |
| 3300018035 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10 | Environmental | Open in IMG/M |
| 3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
| 3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
| 3300020002 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1 | Environmental | Open in IMG/M |
| 3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
| 3300020018 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s2 | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Host-Associated | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022522 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022531 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024251 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK20 | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300024331 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK09 | Environmental | Open in IMG/M |
| 3300025427 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-2 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025459 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025460 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026285 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
| 3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
| 3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
| 3300026490 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-A | Environmental | Open in IMG/M |
| 3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
| 3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300026921 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 28 (SPAdes) | Environmental | Open in IMG/M |
| 3300027014 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027034 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027063 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 37 (SPAdes) | Environmental | Open in IMG/M |
| 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027528 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027605 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027651 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027737 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027767 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027860 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fc - Sphagnum magellanicum MG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028138 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK25 | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Host-Associated | Open in IMG/M |
| 3300028747 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300028798 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_2 | Environmental | Open in IMG/M |
| 3300028873 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N2_1 | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029953 | II_Bog_E3 coassembly | Environmental | Open in IMG/M |
| 3300029987 | I_Fen_E3 coassembly | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030011 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E2_3 | Environmental | Open in IMG/M |
| 3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
| 3300030741 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ANR Co-assembly | Environmental | Open in IMG/M |
| 3300030813 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030906 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_3 | Environmental | Open in IMG/M |
| 3300030916 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA12 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030940 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030991 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Host-Associated | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032579 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18021 | Environmental | Open in IMG/M |
| 3300032605 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18025_13 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
| 3300033405 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MY | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
| 3300033982 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB22AY SIP fraction | Environmental | Open in IMG/M |
| 3300033983 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB23AN SIP fraction | Environmental | Open in IMG/M |
| 3300034163 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14 | Environmental | Open in IMG/M |
| 3300034199 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_01D_14 | Environmental | Open in IMG/M |
| 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| MRS1b_0254.00003000 | 2162886011 | Miscanthus Rhizosphere | FEVKELSVPVSKAEELKKFYRIIANDERTNAVLKPSK |
| F62_06759720 | 2170459010 | Grass Soil | MEIKELSVPVEKLEQRKSFCRVIVGDQRNTAVLKPTGQ |
| INPhiseqgaiiFebDRAFT_1016485861 | 3300000364 | Soil | HYSRTFEVKGLSVPVTKADELKKFYRLIAGDERNTVVLKAGTK* |
| JGI1027J12803_1003122371 | 3300000955 | Soil | IHYSRTFEVKELSVPVTKADELKKFYRLIAGDERNTVVLKAGTK* |
| JGI12636J13339_10505252 | 3300001154 | Forest Soil | ALEIKELSVPVSKMDELKKFYRMIAADERNTAVLKPVGAGK* |
| JGI12712J15308_100761282 | 3300001471 | Forest Soil | TFEVKELSVPVEKTEDLRKFYRAIAGDERNTVVLKTASK* |
| JGI12659J15293_100791672 | 3300001546 | Forest Soil | DYTRTFEVKELSVPVSQAEDLRKFYRIIAGDERSTVVLKPAP* |
| JGI12635J15846_101134181 | 3300001593 | Forest Soil | TFEVKELSVPLNKIEDLKTLYRIIATDERNTAVLRPAKP* |
| JGI12635J15846_107739681 | 3300001593 | Forest Soil | KRTFEVKELSVPASQAEDLKKFYRIISSDERNTAVLKPASK* |
| JGIcombinedJ26739_1007228111 | 3300002245 | Forest Soil | GNVLRYTRTFEVKEPSVPLSKISXLKMLYRIIANDERNTAVLKPAGPASARN* |
| JGIcombinedJ26739_1008465223 | 3300002245 | Forest Soil | RTFEVKELSVPVSRADDLKKFYRIIASDERNTVVLKPSP* |
| JGIcombinedJ26739_1014639631 | 3300002245 | Forest Soil | YTRTFEVKELSVPVAQAEDLKKFYRIIAGDERNTVVLKAAAK* |
| JGI25613J43889_100468062 | 3300002907 | Grasslands Soil | TFEVKDPSVPMAKMEDLKKLYRIIANDERNTAVLKPAVPASAKN* |
| JGI25390J43892_100981902 | 3300002911 | Grasslands Soil | NGNTLKYTRTFEVKELSVPLAKVEDLKKLYRVIAGDERNTAVLKPAAH* |
| Ga0062385_100856311 | 3300004080 | Bog Forest Soil | IRYTRTYEIKQLSVPVSKADEVRKFNRIIASDERNMAVLKPIAK* |
| Ga0063454_1000228574 | 3300004081 | Soil | RTFEIKELSVPVSKAEDLKKFYRIIAGDERNTVVLKASAQ* |
| Ga0062384_1011789862 | 3300004082 | Bog Forest Soil | RYTRTFEVKETSVPLSKVDDLKKLYRIIASDERSTAVLKPAGSK* |
| Ga0062384_1014082752 | 3300004082 | Bog Forest Soil | LHYTRSLEIKELSVPVSKMDELKKFYRMIASDERNTAVLKPAEAGK* |
| Ga0062387_1005679981 | 3300004091 | Bog Forest Soil | SEVNGNTLKYTRTFEVKELSVPLSKIEDLKKLYRIIAGDERNNAVLKPVGH* |
| Ga0062386_1004846721 | 3300004152 | Bog Forest Soil | YHRTYEIKQLSVPVEQADQLRSFYQIIAGDERNMVVLKPTSK* |
| Ga0062386_1012911461 | 3300004152 | Bog Forest Soil | TELVGNVLRYHRTFEVKELSVPVSEAAQLRKFYRIIANDERNNAVLKFASP* |
| Ga0066814_100799292 | 3300005162 | Soil | SFEIKELSVPVDKAADLKKFYRIIASDERNTAVLKPAGK* |
| Ga0066677_100322281 | 3300005171 | Soil | VIGYTRTFEVKELSVPASKAEELKKFYRIIASDERNNVVLRPSR* |
| Ga0066679_104507151 | 3300005176 | Soil | DYTRTFEVKELSVPLDKAEDLRRFYRIIASDERNTVVLKPTP* |
| Ga0066679_108608001 | 3300005176 | Soil | IAYTRRFEVKELSVAVGKAEELKKFYRMIASDERNTAVLKPAK* |
| Ga0066684_102711531 | 3300005179 | Soil | KYTRTFEIKELSVPVDKMEELKKLYRIIWGDERNTAVLKPKA* |
| Ga0066388_1000540325 | 3300005332 | Tropical Forest Soil | FEIKELSVPVSKADDLKKFYHAISGDERNTAVLKPSESH* |
| Ga0066388_1017000124 | 3300005332 | Tropical Forest Soil | LDYTRTFEVKELSVPVSKAEDLKKFYRIIASDERNTAVLKPAR* |
| Ga0070659_1001555211 | 3300005366 | Corn Rhizosphere | NYTRTFEVKELSVPVSKADELKKFYRIIASDERNTAILKPVN* |
| Ga0070711_1016267671 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | AEVSGKTLKYTRTFEIKELSVPVSKADELKMFYRVIGNDERNTAVLKPGAK* |
| Ga0070708_1013373072 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | ESMEIKELSVPVEKLEQLKSFYRVIVGDERNTAVLKPAGK* |
| Ga0070706_1003789032 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | TLHYTRALEIKELSVPVSKMDDLKKFYRMIAADERNTAVLKPMGAGK* |
| Ga0070707_1014521561 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | RALEIKELSVPVGKIEELRKFYRMIAADERNTAVLKPAGAVK* |
| Ga0073909_100284311 | 3300005526 | Surface Soil | NTIHYSRTLEVKELSVPVAHADELKKFYRIIAGDERNTVVLKAGAK* |
| Ga0070741_101063601 | 3300005529 | Surface Soil | AIGYTRSFEVKQLSVPVSKAEELRKLYRIIASDERTTAVLKPAK* |
| Ga0070730_101905121 | 3300005537 | Surface Soil | SYHSKTEASGNTLKYTRTFELKELSVPVNKVDDLKKLYRIIAGDERNNAVLKPAGH* |
| Ga0068853_1006036381 | 3300005539 | Corn Rhizosphere | RSFEIKELSVPVSRAQDLKKFYRIIASDERSTAILKPIN* |
| Ga0066697_102111571 | 3300005540 | Soil | KYTRTFEVKELSVPLSKVEDLKKLYRIIASDERNTAVLKPATH* |
| Ga0070733_105972222 | 3300005541 | Surface Soil | YSRTLEVKELSVPVARADELKRFYRIVASDERNTVVLKAGAR* |
| Ga0070732_101958271 | 3300005542 | Surface Soil | TFEIKQLSVPVSKAEELKKFYRIIATDERNTAVLKPAK* |
| Ga0066661_105268832 | 3300005554 | Soil | YTRTFEVKELSVPLSKVEDLKKLYRIIASDERNTAVLKPATQ* |
| Ga0066707_102281721 | 3300005556 | Soil | LKYTRTFEVKELSVPLSKVEDLKKLYRIIASDERNTAVLKPATH* |
| Ga0066704_106164481 | 3300005557 | Soil | EVKELSVPLSKVEDLKKLYRIIASDERNTAVLKPATH* |
| Ga0066704_108059171 | 3300005557 | Soil | FEIKELSVPLNKMDDLKKFYRIIASDERNTAVLKPIAH* |
| Ga0066699_104572041 | 3300005561 | Soil | VKELSVPASKAEELKKFYRIIASDERNNVVLRPSR* |
| Ga0066699_108616781 | 3300005561 | Soil | LKYSRTFEIKELSVPLAKTDDLKKFYRIIAGDERNTAVLKPVVH* |
| Ga0066705_107831352 | 3300005569 | Soil | GNTLKYTRTFEIKELSVPVNKVEDLKKLYRIIAGDERNTAVLRPATH* |
| Ga0066705_108452981 | 3300005569 | Soil | YTRTFEVKELSVPVSKADELKKFYRIIASDERNTAVLKPAK* |
| Ga0066702_100309201 | 3300005575 | Soil | EVKELSVPVSHAEDLKKLYRIIASDERNTVVLKTAAH* |
| Ga0066708_102653042 | 3300005576 | Soil | EVKELSVPVSKAEELKKFYRIIASDERNTAVLKPAQ* |
| Ga0070762_107564542 | 3300005602 | Soil | VLHYRRALEIKELSVPVSKMDELKKFYRMIAADERNTA |
| Ga0070763_102274232 | 3300005610 | Soil | LRYTCTFEIKDLSVPVSKAEQLKEFYRIIAGDERNSAVLKRVSQ* |
| Ga0070763_106549832 | 3300005610 | Soil | AEVSGNVLLYTRTFEVKDPSVPLSKLDDLKMLYRIIASDERNTAVLKPVGMP* |
| Ga0068856_1001876724 | 3300005614 | Corn Rhizosphere | SRTFEIKEPSVPLSKLNDLKTLYRVIATDERNNAVLKPTQP* |
| Ga0070764_102643961 | 3300005712 | Soil | VDYTRTFEVKELSVPVSKAEDLRKFYRIIASDERGTVVLKPGP* |
| Ga0066903_1044581971 | 3300005764 | Tropical Forest Soil | GNKLRYTRTFEIKELSVPMERMEDLKKLYRMIANDERNTAVLKPSAAAASAK* |
| Ga0066903_1054037651 | 3300005764 | Tropical Forest Soil | VKGNVIDYKRTFEVKELSVPVNRAEEWRKFYRIFAGEERSTVVLKAANK* |
| Ga0066903_1061963702 | 3300005764 | Tropical Forest Soil | LKYTRNFEIKELTVPLEKVEELRKFYRVITGDERNTAVLKPKS* |
| Ga0066903_1081381942 | 3300005764 | Tropical Forest Soil | KELSVPVSKVEDLKKLYRIIAGDERNNAVLKPVGH* |
| Ga0070766_111917802 | 3300005921 | Soil | LLYTRTLELKELSVPVGSVEDLKHFYRVIASDERNTAILKPVAAAH* |
| Ga0066795_102697612 | 3300005938 | Soil | MLHYTRAVEIKELSVPVSKMAELKKFYRMIAADERNTAVL |
| Ga0080026_100092812 | 3300005952 | Permafrost Soil | VKELSVPVARADDLKKFYRIIASDERNTVVLKTK* |
| Ga0080026_101617222 | 3300005952 | Permafrost Soil | TGKTLKYTRTFEIKELSVPASKADELKKFYRVIGNDERNTAVLKPTAN* |
| Ga0080027_101166811 | 3300005993 | Prmafrost Soil | YTRTFEIKELSVPVKDAEQLKKFYRIIATDERNAAVFKLVAR* |
| Ga0066790_100321951 | 3300005995 | Soil | VKELSVPVARADDLKKFYRIIARDERNTVVLKTK* |
| Ga0070717_105707503 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | NYQRTFDVKELSVPVSRAEELRKFYRIIATDERNTVVLKAAVQ* |
| Ga0075024_1003265931 | 3300006047 | Watersheds | RYTRAFEVKQLTVPVEKIEDLKKLYRIITGDERSTAVLKPVAK* |
| Ga0075028_1007417461 | 3300006050 | Watersheds | RYTRTIEIKDLSVPADKADQLKAFYRIIAGDERNSAVLKRSSR* |
| Ga0075029_1009798711 | 3300006052 | Watersheds | IKELSVPVSKMDELKKFYRMIGTDERNTAVLKPAGIGK* |
| Ga0075017_1010527451 | 3300006059 | Watersheds | NRTFEVKELSVPVNKTDDLRKFYRIIASDERNTVVLKPASK* |
| Ga0075015_1001153771 | 3300006102 | Watersheds | HYTRSLEIKELSVPVSKMDELKKFYRMIASDERNTAVLKPAAAGR* |
| Ga0075030_1008994021 | 3300006162 | Watersheds | SMEIKELSVPVSKMDELKRFYRIIASDERNTAVLKPAAAGK* |
| Ga0075014_1002486482 | 3300006174 | Watersheds | VKELSVPVDHTDELKRFYRTINGDERNTVVLKAVP* |
| Ga0070712_1012965642 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | SVPVEKLEQRKSFCRVIVGDQRNTTVLKPTGNNR* |
| Ga0079222_114350992 | 3300006755 | Agricultural Soil | TFEVKELSVPVSKVEDLKKLYRIIAGDERNTAVLKPATH* |
| Ga0066653_107787871 | 3300006791 | Soil | EYTRTFEVKELSVPVSKADELKKFYRIIASDERNTAVLKPAK* |
| Ga0066665_112439631 | 3300006796 | Soil | LRYTRTFEIKELSVPLSKMDDLKKLYRIIAGDERNTAVLKPAVH* |
| Ga0066659_101449064 | 3300006797 | Soil | RTFEVKELSVPLGKVEDLKKLYRVIAGDERNTAVLKPAAR* |
| Ga0066659_109950592 | 3300006797 | Soil | FEVKELSVPLSKVEDLKKLYRIIASDERNTAVLKPATH* |
| Ga0075433_103063404 | 3300006852 | Populus Rhizosphere | YTRTLEIKELSVPLEKMDDLKKFYRVIASNERNTAVLKPSTAAASAK* |
| Ga0075425_1015644992 | 3300006854 | Populus Rhizosphere | FEIKELSVPMSKMDDLRKFYRVISSDERNTAVLKPSAAAAAK* |
| Ga0074063_132373861 | 3300006953 | Soil | SRVFEIKDLSVPVSKAPDLMHFYRVIASDERNSAVLKRTSP* |
| Ga0099793_100867694 | 3300007258 | Vadose Zone Soil | LKYTRTFEVKELSVPLSKVEDLKKLYRVIAGDERNTAVLKPAAH* |
| Ga0099793_103331042 | 3300007258 | Vadose Zone Soil | TLKYTRTFEVKELSVPLSKVEDLKKLYRIIAGDERNTAVLKPAAH* |
| Ga0099795_100982422 | 3300007788 | Vadose Zone Soil | RSLEVKELSVPVNKVEELRTFYRRIAGDERNNAVLKPSGLGK* |
| Ga0102924_12605241 | 3300007982 | Iron-Sulfur Acid Spring | LWTISAFELKELSIPVNRAEDLRKFYRTIAGDERNTVVLKPLP* |
| Ga0099829_104818921 | 3300009038 | Vadose Zone Soil | RALEIKELSVPVSKMDELKKFYRMIAADERNTAVLKPAGAGK* |
| Ga0099829_111066711 | 3300009038 | Vadose Zone Soil | KELSVPLSKVEDLKKLYRVIAGDERNTAVLKLATH* |
| Ga0099827_103182911 | 3300009090 | Vadose Zone Soil | VKELSVPASKAEDLKKFYRIIASDERNTAVLKPASK* |
| Ga0099827_112609532 | 3300009090 | Vadose Zone Soil | KTEVNGNTLKYTRTFEVKELTVPLSKVEDLKKLYRIIAGDERNNAVLKPAVH* |
| Ga0099792_105525871 | 3300009143 | Vadose Zone Soil | GNVLRYARTFEVKDPSVPLSRIEDLKKLYRIIANDERSTAVLKPVASASGKN* |
| Ga0116222_13063171 | 3300009521 | Peatlands Soil | VLHYQRTFEVKKLSVPASDAPQLKKFYRIIATDERNNAVLKLASP* |
| Ga0105238_110721921 | 3300009551 | Corn Rhizosphere | EVKELSVPVSHAEDLKKLYRIIASDERNTVVLKTAAQ* |
| Ga0105238_115409122 | 3300009551 | Corn Rhizosphere | SRSFEIKELSVPVSRAQELKKFYRIIASDERNTAILKPAN* |
| Ga0116102_11958922 | 3300009632 | Peatland | VEIKELSVPVNKMDELKSFYRMIAADERNTAILKPAGASK* |
| Ga0116124_10330471 | 3300009634 | Peatland | SGQVLHYTRALEIKELSVPVGKMDELKRFYRMIASDERNTAVLKPAGAGK* |
| Ga0116132_10318781 | 3300009646 | Peatland | NVVDYSRTFEVRELSVPVKAADLRKFYRIIAGDERNTVVLKPAP* |
| Ga0116215_14942842 | 3300009672 | Peatlands Soil | FEVKELSVPVNKTADLRKFYRLIAGDERNTVVLKPSP* |
| Ga0116217_103252412 | 3300009700 | Peatlands Soil | ELSVPVIKMDELKRFYRMIASDERNTAVLKPAGAGK* |
| Ga0116217_108050581 | 3300009700 | Peatlands Soil | HYTRSLEIKELSVQVSKMDELKKFYRMIASDERNTAVLKPDEAGK* |
| Ga0116131_10945613 | 3300009760 | Peatland | VEIEALSVPVGKMDERKKFYRMIATDERNTAVLKPAGAGK* |
| Ga0116223_100125131 | 3300009839 | Peatlands Soil | EVKELSVPVSRVEELKKFYRIIASDERNTAVLKPAAR* |
| Ga0126380_119767971 | 3300010043 | Tropical Forest Soil | KELSVPVNKTDELKKFYRIIAGDERSTAVLKPSK* |
| Ga0126373_133261301 | 3300010048 | Tropical Forest Soil | TLKYTRTFEMKELSVPVSKVEDLKKLYRIIAGDERNTAVLKPVAH* |
| Ga0134082_104860411 | 3300010303 | Grasslands Soil | NGNTLKYTRTFEVKELSVPLSKVEDLKKLYRVIAGDERNTAVLKPATH* |
| Ga0134063_103786931 | 3300010335 | Grasslands Soil | KELSVPVSKVEDLKKLYRIIAGDERNTAVLKPASH* |
| Ga0134063_107162072 | 3300010335 | Grasslands Soil | YTRTFEVKELSVPLSKVEDLKKLYRIIASDERNTAVLKPATH* |
| Ga0074045_100172875 | 3300010341 | Bog Forest Soil | VEIKELSVPVSKMDELKKFYRMIASDERNSAVLKPAQAGK* |
| Ga0074045_105520562 | 3300010341 | Bog Forest Soil | LIRYTRTYEIKQLSVPVSKADEVRKFNRIIASDERNMAVLKPIAK* |
| Ga0074044_103603582 | 3300010343 | Bog Forest Soil | LHYTRAVEIKELSVPVNKMDELKSFYRMIAADERNTAILKPAGASK* |
| Ga0126370_102838791 | 3300010358 | Tropical Forest Soil | VKEVTVPLAQVDNLKKLYRMIASDERNTSLIKPVGN* |
| Ga0126370_102882391 | 3300010358 | Tropical Forest Soil | EFSNHALKYTRVFEIKEVTVPLAKIEDLRKLYRAIAGDERNTAVLKPAAH* |
| Ga0126370_114902863 | 3300010358 | Tropical Forest Soil | VKELSVPVERADELKKFYRTINGDERNTVVLKVVAK* |
| Ga0126376_106601613 | 3300010359 | Tropical Forest Soil | KELSVPMDKIEELRKFYRAIVGDERSTAVLKPKT* |
| Ga0126376_118480191 | 3300010359 | Tropical Forest Soil | FEVKELSVPVSKAEDLKKFYRIIASDERNTAVLKPAK* |
| Ga0126372_129295831 | 3300010360 | Tropical Forest Soil | IKKVSVPLDMTEELKRFYRVIGGDERSTAVLKPAGK* |
| Ga0126378_106486771 | 3300010361 | Tropical Forest Soil | TFEVKELSVPVSKVEELKKLYRIIASDERSTAVLKPTAH* |
| Ga0126378_113719882 | 3300010361 | Tropical Forest Soil | KELTVPVSKADDLKKFYRFIATDERNTAVLKASN* |
| Ga0126378_117679721 | 3300010361 | Tropical Forest Soil | IKELTVPVSKADDLKKFYRYIATDERNTAVLKTSN* |
| Ga0134066_100027035 | 3300010364 | Grasslands Soil | KELSVPLGKVEDLKKLYRVIAGDERNTAVLKPAAH* |
| Ga0134066_101355782 | 3300010364 | Grasslands Soil | SYHSKTEVHGSMLKYTRTFEVKELSVPVSKVEDLKKLYRIIASDERNAAVLKPTSH* |
| Ga0126379_100726351 | 3300010366 | Tropical Forest Soil | VKELSVPVSKAEELKKFYRIIASDERSTAVLKPSK* |
| Ga0134128_115476141 | 3300010373 | Terrestrial Soil | LEYSRKFEVKELSVPLSRVADLKKFYRIIASDERNTTLLRKVGP* |
| Ga0134128_129238932 | 3300010373 | Terrestrial Soil | YSRSFEIKELSVPVSRAQELKKFYRIIASDERNTAILKPAN* |
| Ga0126381_1010129811 | 3300010376 | Tropical Forest Soil | EVKELSVPVAKADQLKKFYRLIAGDERNTVVLKPGVK* |
| Ga0126381_1035223101 | 3300010376 | Tropical Forest Soil | SKSEMVGDTLRYTRSFEVKELTVPVNKADELKRFYRIIAGDERSMAVLKAK* |
| Ga0136449_1011467801 | 3300010379 | Peatlands Soil | LKYHRAFEVKQLSVPVGQADQLKKFYRIIASDERNTAVLKLVTQ* |
| Ga0136449_1044789362 | 3300010379 | Peatlands Soil | YTRALEIKELSVPISKMDELKKFYRMIATDERNTAVLKPAGPGK* |
| Ga0126383_103649223 | 3300010398 | Tropical Forest Soil | VKELSVPVAKADELKKFYRIIASDERNTVVLKAAQ* |
| Ga0150983_104029642 | 3300011120 | Forest Soil | GGDTIRYTRTVEIKELSVPVSKADDLKKFYRIIATDERNTAVLKPAAH* |
| Ga0137392_103337714 | 3300011269 | Vadose Zone Soil | FGIKELSVPISKMEDLKKFYRMIAGDERNTAVLKPVAH* |
| Ga0137392_110885971 | 3300011269 | Vadose Zone Soil | QLSVPLNRMDDLKKFYRIIATDERNSAVLKPVGH* |
| Ga0137391_102381243 | 3300011270 | Vadose Zone Soil | NFRSKPEASGDMLRYTRTSEVKQTSVPLNKIDDLKKLYRLIAGDERNTAVPKLASH* |
| Ga0137391_108975951 | 3300011270 | Vadose Zone Soil | ELSVPLSKVEDLKKLYRVIAGDERNTAVLKPAAH* |
| Ga0137393_100270321 | 3300011271 | Vadose Zone Soil | LKYTRTFEVKELSVPLSKVEDLKKLYRIIAGDERNTAVLRPMAH* |
| Ga0137393_106759071 | 3300011271 | Vadose Zone Soil | RTFELKELSVPVNKAEDLRKFYRIIAGDERNTVVLKPAP* |
| Ga0137393_108112191 | 3300011271 | Vadose Zone Soil | ELSVPLSKVEDLKKLYRVIAGDERNTAVLKPATH* |
| Ga0137393_109649121 | 3300011271 | Vadose Zone Soil | TLKYTRTFEVKELSVPLGKVEELKKLYRVIAGDERNTAVLKPAAH* |
| Ga0137389_100101026 | 3300012096 | Vadose Zone Soil | VKQTSVPLNKIDDLKKLYRLIAGDERNTAVPKLASH* |
| Ga0137389_103664883 | 3300012096 | Vadose Zone Soil | YTRTFEVKELSVPLSKVEDLKKLYRVIAGDERNTAVLKPAAH* |
| Ga0137388_103178984 | 3300012189 | Vadose Zone Soil | FEVKELSVPLNKVEELKKLYRIIAGDERNTAVLKPASH* |
| Ga0137388_118106711 | 3300012189 | Vadose Zone Soil | EIKELSVPVSKMDELKKFYRMIAADERNTAVLKPAGAGK* |
| Ga0137382_101763661 | 3300012200 | Vadose Zone Soil | TLKYTRTFEVKELSVPLSKVEDLKKLYRVIAGDERNTAVLKPATH* |
| Ga0137382_106797391 | 3300012200 | Vadose Zone Soil | GNTLKYTRTFEVKELSVPLSKVEDLKKLYRVIAGDERNTAVLKPAAH* |
| Ga0137365_101651551 | 3300012201 | Vadose Zone Soil | FEVKELSVPVSKVDDLKKLYRIIAGDERNTAVLRPAAH* |
| Ga0137363_102411751 | 3300012202 | Vadose Zone Soil | VNGNTLKYTRTFEVKELSVPLSKVEDLKKLYRVIAGDERNTAVLKPATH* |
| Ga0137363_103167571 | 3300012202 | Vadose Zone Soil | ELSVPLNKMDDLKKFYRIIAGDERNTAVLKPAVH* |
| Ga0137363_107915841 | 3300012202 | Vadose Zone Soil | MLHYTRALEIKELSVPVSKMDDLKKFYRMIAADERNTAVLKPAGEGK* |
| Ga0137399_101136461 | 3300012203 | Vadose Zone Soil | TLKYTRTFEVKELSVPLGKVEELKKLYRVIAGDERNTAVLRPAAR* |
| Ga0137399_101297735 | 3300012203 | Vadose Zone Soil | RYTRTFEIKELSVPLNKMDDLKKFYRIIAGDERNTAVLKPAVH* |
| Ga0137399_102659761 | 3300012203 | Vadose Zone Soil | RYTRTFEIKELSVPLNKMDDLKKFYRIIAGDERNTAVLKPAAH* |
| Ga0137399_102662531 | 3300012203 | Vadose Zone Soil | LKYTRTFEVKELSVPLGKVEDLKKLYRIIAGDERNTAVFKPVAR* |
| Ga0137399_105864651 | 3300012203 | Vadose Zone Soil | FEVKELSVPLSKVEDLKKLYRVIAGDERNTAVLKPAAH* |
| Ga0137399_110773881 | 3300012203 | Vadose Zone Soil | KELSVPASKAEDLKKFYRIIASDERNTAVLKPASK* |
| Ga0137362_110383701 | 3300012205 | Vadose Zone Soil | KELSVPVSKMDDLKKFYRMIAADERNTAVLKPAGAGK* |
| Ga0137362_114252021 | 3300012205 | Vadose Zone Soil | IKELSVPLNKMDDLKKFYRIIAGDERNTAVLKPAAH* |
| Ga0137381_104941671 | 3300012207 | Vadose Zone Soil | VKELSVPVGKAEELKKFYRIIATDERNTVVLKPSK* |
| Ga0137381_108209832 | 3300012207 | Vadose Zone Soil | YTRALEIKELSVPVSKMDDLKKFYRMIAADERKTAVLKPAGAGK* |
| Ga0137381_111692391 | 3300012207 | Vadose Zone Soil | EVKELSVPVSKVDDLKKLYRIIAGDERNTAVLRPAAH* |
| Ga0137379_104721542 | 3300012209 | Vadose Zone Soil | YTRVFEVKQLSVPVNRMDDLKKFYRIIATDERNSAVLKPSGH* |
| Ga0137379_113849792 | 3300012209 | Vadose Zone Soil | LTVPMDKMDDLKKFYRIIASDERNTAVLKPSAQSALR* |
| Ga0137377_104838191 | 3300012211 | Vadose Zone Soil | TFEVKELSVPVGKAEELKKFYRIIASDERNTAVLKSSK* |
| Ga0137377_106012451 | 3300012211 | Vadose Zone Soil | IKELSVPLNKMDDLKKFYRIVASDERNTAVLKPVAH* |
| Ga0137387_105361533 | 3300012349 | Vadose Zone Soil | EVNGNTLKYTRTFEVKELSVTLSKVEDLKKLYRIIAGDERNTAVLKPAAH* |
| Ga0137372_101493383 | 3300012350 | Vadose Zone Soil | VGITVASGDFEVKELSVPVSRAQDLKKFYRIIASDERNTEILKPSKQ* |
| Ga0137369_106580221 | 3300012355 | Vadose Zone Soil | RTFEVKELSVPVSKAEELKKFYRIIASDERNTAVLKPAH* |
| Ga0137384_100828532 | 3300012357 | Vadose Zone Soil | VNGNTLKYTRTFEVKELSVPLGKVEDLKKLYRVIAGDERNTAVLKPAAH* |
| Ga0137384_102971571 | 3300012357 | Vadose Zone Soil | KELSVPVSKAEELKKFYRIIASDERNTAVLKPAH* |
| Ga0137361_115144731 | 3300012362 | Vadose Zone Soil | VLEVKQLSVPVNRMDDLKKVYRIIATDERNSAVLKPTGH* |
| Ga0137361_117073601 | 3300012362 | Vadose Zone Soil | TRTFEVKELSVPVSKADELKKFYRIIASDERNTAVLKPAH* |
| Ga0137390_105527171 | 3300012363 | Vadose Zone Soil | ELSVPLSKVEDLKKLYRAIAGDERNTAVLKPAAH* |
| Ga0150984_1107312541 | 3300012469 | Avena Fatua Rhizosphere | LEIKELSVPVARADDLKKFYRIIAGDERNTVVLRAGSK* |
| Ga0137358_103567513 | 3300012582 | Vadose Zone Soil | FEVKELSVPLSKVEDLKKLYRVIAGDERNTAVLKPATH* |
| Ga0137395_101231801 | 3300012917 | Vadose Zone Soil | KELSVPVSKMDELKKFYRMIAADERNTAVLKPAGAGK* |
| Ga0137395_112657262 | 3300012917 | Vadose Zone Soil | EISGNVLRYARTFEVKDPSVPLSRIEDLKKLYRIIANDERSTAVLKPVASASGKN* |
| Ga0137396_102838992 | 3300012918 | Vadose Zone Soil | VKELSVPVNRADELKKFYRIIAGDERNTVVLKAAGK* |
| Ga0137396_112234002 | 3300012918 | Vadose Zone Soil | LKYTRTFEVKELSVPLSKVEDLKKLYRVIAGDERNTAVLKPATH* |
| Ga0137394_101932564 | 3300012922 | Vadose Zone Soil | EVKELSVPLSKVEDLKKLYRVIAGDERNTAVLKPAAH* |
| Ga0137394_105316391 | 3300012922 | Vadose Zone Soil | RTFEVKELSVPLNKVEELKKLYRIIAGDERNTAVLKPVGH* |
| Ga0137359_104477442 | 3300012923 | Vadose Zone Soil | HYTRALEIKELSVPVSKMDDLKKFYRMIAADERNTAVLKPAGAGK* |
| Ga0137413_117801192 | 3300012924 | Vadose Zone Soil | EIKELSVPVNKMDELKKFYRMIATDERNTAILKPSAAVK* |
| Ga0137419_100314955 | 3300012925 | Vadose Zone Soil | EVKELSVPLSKVDDLKKLYRIIAGDERNNAVLKPVGH* |
| Ga0137419_105912541 | 3300012925 | Vadose Zone Soil | TFEIKELSVPLSKMDDLKKFYRAIAGDERNTAVLKPVAH* |
| Ga0137419_114205891 | 3300012925 | Vadose Zone Soil | LKYTRTFEVKELSVPLGKVEELKKLYRVIAGDERNTAVLRPAAR* |
| Ga0137416_112264992 | 3300012927 | Vadose Zone Soil | NGNTLKYTRTFEVKELSVPLSKVEDLKKLYRIIASDERNTAVLKPAAH* |
| Ga0137404_100110757 | 3300012929 | Vadose Zone Soil | LSVPVERVEELKKFYRIVASDERNTAVLKPVGLGK* |
| Ga0137404_105908741 | 3300012929 | Vadose Zone Soil | RYSRTFEVTESSVPLAKIEDLKKLYRIIANDEQNTAVLKPVVPASAKN* |
| Ga0137404_122433142 | 3300012929 | Vadose Zone Soil | TRTLEVKELSVPVSKVEELRTFYRRIAGDERNTAVLKPVEVPK* |
| Ga0164299_113005352 | 3300012958 | Soil | EVRELSVPVGKAEELKKFYRIIANDERNTVILKPSK* |
| Ga0126369_118223573 | 3300012971 | Tropical Forest Soil | GSTLKYTRTFEIKELSVPVSKVDDLKKLYRIIAGDERNTAVLKPLTH* |
| Ga0134087_101642851 | 3300012977 | Grasslands Soil | TEVHGSMLKYTRTFEVKELSVPVSKVEDLKKLYRIIASDERNAAVLKPTSH* |
| Ga0164307_109695481 | 3300012987 | Soil | FEVKELSVPVSKADELKKFYRIIASDERNTAVLKPAK* |
| Ga0164307_114657252 | 3300012987 | Soil | VIGYTRTFEVKELSVPVGKAEELKKFYRIIANDERNTVILKPSK* |
| Ga0157374_103590584 | 3300013296 | Miscanthus Rhizosphere | TFEIKELSVPMEKMEDLRKFYRVIAGDERNTAVLKPSTAAASAK* |
| Ga0157372_123980701 | 3300013307 | Corn Rhizosphere | AFEVKDLSVPVSKADDLKRFYRIVATDERNTAVLKPSK* |
| Ga0134075_102515423 | 3300014154 | Grasslands Soil | LKYSRTFEVKELSVPVSKVDDLKKLYRIIAGDERNTAVLRPAAH* |
| Ga0181524_100714901 | 3300014155 | Bog | KELSVPVKRADELKRLYRMIASDERNTVVLKADGR* |
| Ga0181523_105304971 | 3300014165 | Bog | MEIKELSVPVNKMDELKKFYRTIANDERNTAVLKPAEIK* |
| Ga0181534_108068591 | 3300014168 | Bog | SYEVKELSVPVAQTEELHRFYNAIVADERNTAVFKRGSQ* |
| Ga0182008_108003751 | 3300014497 | Rhizosphere | RTFEIKELSVPVSRAAELKKFYRIIASDERNTAILKPVN* |
| Ga0182019_105444042 | 3300014498 | Fen | GNSIFYTRDFEVKELSVPVSKAEELKNFYRIIATDERNTAVLKPVGK* |
| Ga0182024_102285481 | 3300014501 | Permafrost | VKDPSVPLNKVDDLKMLYRIIASDERNTAVLKPAGTP* |
| Ga0181522_109460912 | 3300014657 | Bog | NIIRYTRTFEIKELSVPASRADELKRFYRIVASDERNAAVLRIASH* |
| Ga0137414_10632902 | 3300015051 | Vadose Zone Soil | RYTRTFEIKDLSVPVSKAEQLRDFYRIIASDERNSAVLKRVPQ* |
| Ga0137411_12575591 | 3300015052 | Vadose Zone Soil | VKELSVPLSKVEDLKKLYRMIAGDERNTAVLKPAAH* |
| Ga0137420_10666041 | 3300015054 | Vadose Zone Soil | DYSFGSYHSKTEASGQMLHYTRALEIKELSVPVSKMPVSKMDDLKKFYRMIANDERNTAVLKPVGGGK* |
| Ga0137420_11137741 | 3300015054 | Vadose Zone Soil | ALYTRTFEIKELSVPLNKMDDLKKFYRIIAGDERNTAVLKPAVH* |
| Ga0137420_14544105 | 3300015054 | Vadose Zone Soil | LRYTRTFEVKELSVPLSKFEDLKKLYRIIAGDERNTAVLKPAAH* |
| Ga0137418_101542003 | 3300015241 | Vadose Zone Soil | SVPVSKMDDLKKFYRMIANDERNTAVLKPVGGGK* |
| Ga0132258_136521162 | 3300015371 | Arabidopsis Rhizosphere | AYSRTFEIKQLSVPVSRAPELKKFYRIIASDERNTAILKPVN* |
| Ga0182041_109336451 | 3300016294 | Soil | EIRELSVPLNKMDELKRFYRMIATDERNTAVLKRSAGIH |
| Ga0182033_105896653 | 3300016319 | Soil | KELSVPVDQLDQLRAFYRVIASDERNTAVLKPAAK |
| Ga0182032_101113214 | 3300016357 | Soil | EIKELSVPMEKMDELRKFYRVIATDERNTAVLKPSAAAASAK |
| Ga0182040_114929991 | 3300016387 | Soil | SRIFEVKELSVPVSKVEELKKLYRIIASDERNTAVLKPADH |
| Ga0182037_103156683 | 3300016404 | Soil | VKELTVPVSKAEDLKKLYRVIASDERNTAVLKPAAH |
| Ga0187818_100870691 | 3300017823 | Freshwater Sediment | HYSRTFEVKELSVPVDKIEQLRKFYRAIASDERSTVVLKAAAK |
| Ga0187877_13996441 | 3300017931 | Peatland | RSMEIKELSVPVSKMDDLKKFYRMIAADERNTVVLKPAGAAK |
| Ga0187801_104251721 | 3300017933 | Freshwater Sediment | KELSVPVSRAEELRKFYRIIASDERNTVVLKSAAK |
| Ga0187821_103517842 | 3300017936 | Freshwater Sediment | YTRKFEVKDPSVPLAKVEELKKLYRIIASDERNTAVLTPASQ |
| Ga0187853_100604971 | 3300017940 | Peatland | ELSVPVSKMNELKKFYRMIASDERNTAVLKPAGAGK |
| Ga0187819_101999911 | 3300017943 | Freshwater Sediment | VNGNVIHYKRTFEVKELSVPVNRSEELRKFYRIIASDERNTVVLKSEAK |
| Ga0187786_102819931 | 3300017944 | Tropical Peatland | EIKELSVPVEKAEDLKKFYRIIASDERNTAVLKPSAPH |
| Ga0187879_107487022 | 3300017946 | Peatland | EIKELSVPVSEMDELKKFYRMIASDERNTAVLKPMAPK |
| Ga0187817_1000266811 | 3300017955 | Freshwater Sediment | VKELSVPVSRSEELRRFYRTIAADERNTVVLKATKQ |
| Ga0187779_102802671 | 3300017959 | Tropical Peatland | GNTLRYTRTFEVKELSVPLNKVDDLKKLYRIIAGDERNTAVLKPAIH |
| Ga0187783_110073541 | 3300017970 | Tropical Peatland | NVINYQRTFEVKELSVPVERAEELRKFYRIIAGDERNTVVLKPTAH |
| Ga0187783_110948512 | 3300017970 | Tropical Peatland | EVKELSVPATEAAQLRKFYRMIASDERNTAVLKLGSL |
| Ga0187783_111831531 | 3300017970 | Tropical Peatland | KTQSIGKTLHYVRTLEVKELSVPVSKVDELKKFYRVIASDERNTTVLKPAGK |
| Ga0187781_105942771 | 3300017972 | Tropical Peatland | KELSVPLSQTEDLKRFYRIIANDERGTAVLKPAAHGEGVSR |
| Ga0187780_109496151 | 3300017973 | Tropical Peatland | LRYTRTLEIKEFTVPVSKVDELRKFYRIIGNDERNTAVLKPAAH |
| Ga0187782_115204941 | 3300017975 | Tropical Peatland | EIKELSVPVSKMDDLKKFYRMIASDERNTAVLKPGASGN |
| Ga0187816_101141141 | 3300017995 | Freshwater Sediment | IHYKRTFEVKELSVPVNRSEELRKFYRIIASDERNTVVLKSEAK |
| Ga0187816_104282971 | 3300017995 | Freshwater Sediment | IHYKRTFEVKELSVPVNRSEELRKFYRIIASDERNTVVLKSQAK |
| Ga0187891_10138144 | 3300017996 | Peatland | VNGSLIRYTRTFEVTELSVPVARTEELRKFYRTIANDERSMVVLKSAAK |
| Ga0187767_101534762 | 3300017999 | Tropical Peatland | KGNVLRYTRTIEFKELSVPLNRIEDLRKFYRIIADDERRTAVLKPAGIH |
| Ga0187876_10431903 | 3300018003 | Peatland | HYTRSLEIKELSVPVSKMDELKKFYRMIASDERNTAVLKPVGAGK |
| Ga0187865_100352612 | 3300018004 | Peatland | VKPHYTRSVEIEALSVPVGKMDERKKFYRMIATDERNTAVLKPAGAGK |
| Ga0187804_101034293 | 3300018006 | Freshwater Sediment | IKELSVPVSKMDELKRFYRMIAADERNTAVLKPAVAGK |
| Ga0187804_102328972 | 3300018006 | Freshwater Sediment | QILHYTRSMEIKELSVPVSKMDELRKFYRMIASDERNTAVLKAAGAGR |
| Ga0187888_10564921 | 3300018008 | Peatland | GINELSVPVSQMDELKKFYRRSAADERNTAVLKPAAAAK |
| Ga0187864_103294091 | 3300018022 | Peatland | VKELSVPVARTEELRKFYRTIANDERSMVVFKSAAK |
| Ga0187875_104015251 | 3300018035 | Peatland | NGNVVGYTRTFEVKELSVPVNKAEDLRKFYRIIAGDERNTVVLKPTP |
| Ga0187883_107597311 | 3300018037 | Peatland | IYYSRTFEIKELSVPVKRADELKRLYRMIASDERNTVVLKADGR |
| Ga0187887_103109041 | 3300018043 | Peatland | YSRTFEVKELSVPVARADELRKFYRIIAGDERNTVVLKAATN |
| Ga0187766_107547881 | 3300018058 | Tropical Peatland | KLRYTRTFEVREVTVPLAQVDNLKKLYRMTASDERNTAVIKPAGN |
| Ga0187784_114597532 | 3300018062 | Tropical Peatland | DYERTFELKELSVPVNRAEELRKFYRIIATDERSTVVLKAGAK |
| Ga0187784_115705712 | 3300018062 | Tropical Peatland | LHYSRSLEIKELSVPVNKMDELKKFYRMIATDERNTAVLKPAGTGN |
| Ga0187772_100202433 | 3300018085 | Tropical Peatland | VYTRTFVSVPLEKMDELKKFYRVIASDERGTAVLKPGTH |
| Ga0187772_103742621 | 3300018085 | Tropical Peatland | VAGNVLRYHRTFEVKELSVPASDAAQLQKFYRIIASDERNNAVLKLAP |
| Ga0187771_108340171 | 3300018088 | Tropical Peatland | VKELSVPVSRAEELRKFYRIIATDERNTVVLKAGAK |
| Ga0187770_102598371 | 3300018090 | Tropical Peatland | TFEVKELSVPVARAEDLRKFYRIIASDERNTVVLKAGQP |
| Ga0066662_125734982 | 3300018468 | Grasslands Soil | MQGNVLRYARTFEITEPSVPLGKMDELKKLYRIIANDERNTAVLKPAVPATAKN |
| Ga0066669_1000123810 | 3300018482 | Grasslands Soil | LKYTRTFEIKELSVPVNKVEDLKRLYRIIAGDERNTAVLRPATH |
| Ga0066669_108032013 | 3300018482 | Grasslands Soil | FEIKELSVPVDKMEELKKLYRFIAGDERNTAVLKPKS |
| Ga0137408_12071584 | 3300019789 | Vadose Zone Soil | RTFEVKELSVPLSKVEDLKKLYRIIAGDERNTAVLKPTAH |
| Ga0137408_12261301 | 3300019789 | Vadose Zone Soil | YTRTFEVKELSVPLSKVEDLKKLYRIIAGDERNTAVLKPTAH |
| Ga0137408_12261314 | 3300019789 | Vadose Zone Soil | TRTFEVKELSVPLSKVEDLKKLYRIIAGDERNTAVLKPTAH |
| Ga0137408_13929274 | 3300019789 | Vadose Zone Soil | TRTFKVKELSVPLSKVEDLKKLYRIIAGDERNTAVLKPTAH |
| Ga0193728_10980273 | 3300019890 | Soil | VGRTLRYTRTFEIKELSVPVSKAEQLRDFYRVIAGDERNSAILKRVSQ |
| Ga0193728_11903652 | 3300019890 | Soil | GKTLKYTRTFEIKELSVPVSKAEELKTFYRVIGNDERNTAVLKPGPN |
| Ga0193730_11299641 | 3300020002 | Soil | FEVKELSVPVSKAEELKKFYRIIATDERNTVVLKPSK |
| Ga0193755_10069395 | 3300020004 | Soil | MLKYTRTFEVKELSVPLNKVEELKKLYRIIAGDERNTAVLKPAGH |
| Ga0193721_11341301 | 3300020018 | Soil | IRYTRAFEVKDLSVPVSKADDLKKFYRIVATDERNTAVLKPSK |
| Ga0179594_100569341 | 3300020170 | Vadose Zone Soil | LAGNVIRYTRAFEVKDLSVSVSKADELKKFYRIIYSDERNTAVLKPSGK |
| Ga0179592_100178815 | 3300020199 | Vadose Zone Soil | KELSVPLSKVEDLKKLYRVIAGDERNTAVLKPATH |
| Ga0179592_103475002 | 3300020199 | Vadose Zone Soil | KTEAVGDTIRYTRTVEIKELSVPVYKSDDLKKFYRIIATDERNTAVLKPASH |
| Ga0210407_100645673 | 3300020579 | Soil | KELSVPVSKADDLKKFYRIIATDERNTAVLKPAAH |
| Ga0210407_103191581 | 3300020579 | Soil | GNTLKYTRRLEVKELTVPMSQMETLKKFYRIIASDERNTAVLQPAAH |
| Ga0210407_108214011 | 3300020579 | Soil | VKGNVIGYTRTFEVKELSVPVDQTEELRKFYRIIAGDERNNVVLKTASK |
| Ga0210407_111209252 | 3300020579 | Soil | ALEIKELSVPVSKMDELKKFYRMIAADERNTAVLKPAGAGK |
| Ga0210407_111605242 | 3300020579 | Soil | EVKETSVPLSKVEDLKKLYRIIAGDERNTAVFKPAVH |
| Ga0210407_112927941 | 3300020579 | Soil | AYTRIFEVKELSVPVSKADELKKFYRIIASDERNTAVLKTVGK |
| Ga0210403_100261981 | 3300020580 | Soil | SKTEVNGNTLKYTRTFEVKELSVPLGKVDDLKKLYRIIAGDERNNAVLKPVAH |
| Ga0210399_104550701 | 3300020581 | Soil | GNKLRYTRTFEVKEVTVPVAKMDELKKLYRIIAGDERNTAVIKPSGK |
| Ga0210395_110602752 | 3300020582 | Soil | EVKELSVPVSKSEELKKFYRIIATDERNTVVLKQHGK |
| Ga0210395_113189222 | 3300020582 | Soil | TRTFEVKDPSVPLSKLDDLKMLYRIIASDERNTAVLKPAAMP |
| Ga0210401_110147431 | 3300020583 | Soil | VKETSVPLSKVDELKKLYRIIASDERNTAVLQPKSH |
| Ga0210406_1000326418 | 3300021168 | Soil | GDTIRYTRTVEIKELSVPVSKADDLKKFYRIIASDERNTAVLKPASH |
| Ga0210400_110109862 | 3300021170 | Soil | AEVSGNILRYTRTFEVKEPSVPLAKMEDLKKLYRIIANDERNAAVLKPTGPDSAKN |
| Ga0210400_113974992 | 3300021170 | Soil | VIDYRRTFEVKELSVPVNKADELKKFYRIIAGDERNTVVFLKAAGK |
| Ga0210400_114778952 | 3300021170 | Soil | NVVGYTRTFEVKELTVPVAKAEDLKKFYRIIAGDERSTVVLKPAP |
| Ga0210405_1000031976 | 3300021171 | Soil | MAFSSYSVPVSKADDLKKFYRIIASDERNTAVLKPASH |
| Ga0210405_104970401 | 3300021171 | Soil | TFEVKELSVAVDRADELKRFDRAITGDERNTVVLKAVAH |
| Ga0210405_109502971 | 3300021171 | Soil | VGDTIRYTRTVEIKELSVPVSKADDLKKFYRIIATDERNTAVLKPAAH |
| Ga0210408_106917441 | 3300021178 | Soil | RTFEIKQLSVPVSKVDDLKKFYRVIANDERNAAVFKPATH |
| Ga0210388_100962301 | 3300021181 | Soil | GDTIRYTRTAEIKELSVPVSKADDLKKFYRIIATDERNTAVLKPASN |
| Ga0210388_104529912 | 3300021181 | Soil | KELSVPVDKTEELRKFYRIIAGDERNTVVLKTASK |
| Ga0193719_100416701 | 3300021344 | Soil | NGSVLGYTRSLEVKELSVPVNKVEELRTFYRRIAGDERNNAVLKPAGLGK |
| Ga0213874_102900931 | 3300021377 | Plant Roots | GYTRTFEIKELSVPVSKADQLKKFYRIISSDERNTAVLKPVGGK |
| Ga0210389_104289262 | 3300021404 | Soil | FEVKELHVPVDKADELKKFYRIIAGDERNTVVLKTAAK |
| Ga0210387_104637853 | 3300021405 | Soil | EVKELSVPVSKAEDLRKFYRIIAGDERNTVVLKPAP |
| Ga0210387_104983491 | 3300021405 | Soil | AIRYTRTFEIKELSVPVSSAGDLKTFYRTIASDERNTAVLKVSSK |
| Ga0210387_113343472 | 3300021405 | Soil | RTFEVKELSVPVARADELRKFYRTINGDERNTVVLKAVAH |
| Ga0210383_101572331 | 3300021407 | Soil | MEIKELSVPVEKLEQRKSFCRVIVGDQRNTAVLKPTRQ |
| Ga0210394_103962431 | 3300021420 | Soil | TFEIKELSVPVSQAGALKTFYRTIASDERNTVVLKAPAK |
| Ga0210394_105488881 | 3300021420 | Soil | LWTISAFELKELSIPVNRAEDLRKFYRTIAGDERNTVVLKPLP |
| Ga0210394_114672101 | 3300021420 | Soil | TFEIKELSVPVSKADELKKFYRIIASDERSTAVLKPAGK |
| Ga0210384_100027556 | 3300021432 | Soil | VSGNTLKYTRKFEVKELSVPVSKVDDLKKLYRIIAGDERNTAVLKPVGQ |
| Ga0210384_104380112 | 3300021432 | Soil | TFEIKELSVPASKADDLKKFYRMVASDERNTAVLKPVSK |
| Ga0210384_109970422 | 3300021432 | Soil | TESVGDTIRYTRTVEIKELSVPVSKADDLKKFYRIIATDERNTAVLKPAAH |
| Ga0210391_106921151 | 3300021433 | Soil | NVLRYTRTFEVKETSVPLNKVDDLKKLYRIIASDERSTAVLKPAGSK |
| Ga0210390_100768121 | 3300021474 | Soil | NTLRYTRTFEVKELSVPLNKVDDLKKLYRIIASDERNTAVLKPASSK |
| Ga0210390_103700681 | 3300021474 | Soil | RYTRTFEVKETSVPLSKVDDLRKLYRIIANDERSTAVLKPAGSK |
| Ga0210392_110755712 | 3300021475 | Soil | KELSVPTSKLNDLKTLYRIIASDERNTAVLKPASN |
| Ga0210392_110840612 | 3300021475 | Soil | NVLRYTRTFEVKELSVPASKAEDLKKLYRIIAGDERNTAVLKPVGH |
| Ga0210410_115892281 | 3300021479 | Soil | KELSVPVSRADDLKAFYRTIASDERNTVVLKVSAK |
| Ga0210409_100269111 | 3300021559 | Soil | TEVNGNTLKYTRTFEVKELSVPLGKVDDLKKLYRIIAGDERNNAVLKPVAH |
| Ga0210409_100724514 | 3300021559 | Soil | SKTEVNGNTLKYTRTFEVKELSVPLGKVDDLKKLYRIIAGDERSTAVLKPASH |
| Ga0213853_104788171 | 3300021861 | Watersheds | SKTELKGNVLRYTRTMEIKELSVPVSKMEELKRFYRVIASDERNNAVLKPAAAK |
| Ga0242659_11238841 | 3300022522 | Soil | KTEVKGQTLLYTRTFEIKGVAVPLENMDDLRKFYRIIGSDERGTAILKPTAH |
| Ga0242660_11780532 | 3300022531 | Soil | VKELSVPLGKVEDLKKLYRIIAGDERNTAVLKPVAH |
| Ga0242654_100206133 | 3300022726 | Soil | EVKELSVPVSRADDLKKFYRIIAGDERNTVVLKTQ |
| Ga0247679_10779921 | 3300024251 | Soil | FEVKELTVPLNKVDELKKLYRIIANDERNTAVLKPASH |
| Ga0179589_100321662 | 3300024288 | Vadose Zone Soil | NVLRYARTFEVKDPSVPLSRIEDLKKLYRIIANDERSTAVLKPVASASGKN |
| Ga0179589_105024232 | 3300024288 | Vadose Zone Soil | TVEIKELSVPVSKSDDLKKFYRIIATDERNTAVLKPVAH |
| Ga0247668_10264981 | 3300024331 | Soil | TRTFEVKELVVPTEKLDELKKLYRIIAGDERSTAVLKPKS |
| Ga0208077_10192442 | 3300025427 | Arctic Peat Soil | QKELSVPAAKSEELKKFYRTIAADERNTAVLMPVAK |
| Ga0208689_10785942 | 3300025459 | Peatland | TRTFEIKELSVPVNKAEELRRFYRIIAGDERNTVVLKPAP |
| Ga0208562_10140834 | 3300025460 | Peatland | LSVPVSKTDELKKFYRMIASDERNTAVLKPAGAGK |
| Ga0207692_104928331 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | GNVLRYARTFEVKEPSVPLAKMDDLKKLYRIIANDERNTAVLKPAAPASVKN |
| Ga0207685_105148691 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | RRLEVKELTVPMSQMETLKKFYRIIASDERNTAVLQPAAH |
| Ga0207699_113635402 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | LRYTRSFEVKELTVPVSRVEELKKLYRIIAGDERNTAVLKPVAN |
| Ga0207705_102686651 | 3300025909 | Corn Rhizosphere | YTRIFEVKELSVPVSKAEELKKFYRIIANDERTNAVLKPSK |
| Ga0207671_108453322 | 3300025914 | Corn Rhizosphere | VVKYTRTFEVKELSVPVSKAEELKKFYRIIANDERTNAVLKPSK |
| Ga0207693_105674182 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | LKELSVPVSKTDELKKFYRIIASDERNTAVLKPAK |
| Ga0207693_105958512 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MPALRRAPEVSGKTLKYTRTFEIKELSVPVSKADELKMFYRVIGNDERNTAVLKPGPN |
| Ga0207646_115550561 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | TRTFEVKELSVPLNKVEELKKLYRMIAGDERNTAVLKPVGH |
| Ga0207694_115924001 | 3300025924 | Corn Rhizosphere | RELSVPVNKAADLKQFYRIIEGDERNLAVLKPAASH |
| Ga0207650_106373352 | 3300025925 | Switchgrass Rhizosphere | RTFEVNDLSVPVAKAEELKKFYRIIANDERSTAVLRPKN |
| Ga0207687_105252731 | 3300025927 | Miscanthus Rhizosphere | YSRTFEIKELSVPVSRAAELKKFYRIIASDERNTAILKPVN |
| Ga0207700_104887872 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | GNVLRYARTFEIRDVSVPADQADNLKKLYRIIATDERSTVVLKKRMQAKR |
| Ga0207664_119864211 | 3300025929 | Agricultural Soil | VKSNVIDYTRTFEVKELSVPIARAEELRKFYRIIASDERNNVVLKAAGK |
| Ga0207686_112742212 | 3300025934 | Miscanthus Rhizosphere | LEVKELSVPVTKAQSLKEFYRAIEGDERNSAVLKKTQ |
| Ga0207667_109890892 | 3300025949 | Corn Rhizosphere | RTFEIKEPSVPLSKLNDLKTLYRVIATDERNNAVLKPTQP |
| Ga0207668_120511352 | 3300025972 | Switchgrass Rhizosphere | FEVNDLSVPVAKAEELKKFYRIIANDERSTAVLRPTN |
| Ga0207703_101517631 | 3300026035 | Switchgrass Rhizosphere | TFEIKELSVPMEKMEDLRKFYRVIAGDERNTAVLKPSTAAASAK |
| Ga0209438_11475292 | 3300026285 | Grasslands Soil | ARTFEVKEPSVPVAKMGDLKKLYRIIANDERNTAVLKPTVPASAKN |
| Ga0209471_12815421 | 3300026318 | Soil | EVKELSVAVGKAEELKKFYRMIASDERNTAVLKPAK |
| Ga0209152_103279312 | 3300026325 | Soil | TFEVKELSVPVSHAEDLKKLYRIIASDERNTVVLKTAAH |
| Ga0209802_12266292 | 3300026328 | Soil | ILKYTRTFELKELSVPVSKVEDLKKLYRIIAGDERNTAVLKPAGH |
| Ga0209267_10443014 | 3300026331 | Soil | VIGYTRTFEVKELSVPVGKAEELKKFYRIIAGDERNTVVLKPSK |
| Ga0209267_10491025 | 3300026331 | Soil | NGNTLKYTRTFEVKELSVPLSKVEDLKKLYRIIASDERNTAVLKPATH |
| Ga0209377_11664482 | 3300026334 | Soil | TLRYTRTFEVKELSVPLNKVEELKKLYRVIAGDERNTAVLKPVGH |
| Ga0257153_10766631 | 3300026490 | Soil | RTFEIKELTVPMDKMDDLKKFYRIIASDERNTAVLKPSAQSALR |
| Ga0209808_12229522 | 3300026523 | Soil | EVKELSVPVSKVEDLKKLYRIIASDERNAAVLKPTSH |
| Ga0209807_12143751 | 3300026530 | Soil | GNVITYSRTYQIKQLSVPADKAEEVKKFYRTIARDERSTVVLKSAAQP |
| Ga0209807_12407272 | 3300026530 | Soil | TFEVKELSVPVSKAEELKKFYRIIAGDERNTAVLKPAQ |
| Ga0209056_104225251 | 3300026538 | Soil | VIGYTRTFEVKELSVPVGKAEELKKFYRIIATDERNTVVLKPSK |
| Ga0209805_11578751 | 3300026542 | Soil | VKELSVPASKAEELKKFYRIIASDERNNVVLRPSR |
| Ga0209161_100666591 | 3300026548 | Soil | FEVKELSVPLSKVEDLKKLYRIIASDERNTAVLKPATH |
| Ga0209474_103919531 | 3300026550 | Soil | FEVKELSVPVSKVEDLKKLYRIIAGDERNTAVLKPAVH |
| Ga0209577_106114961 | 3300026552 | Soil | LEIKELSVPVSKMDDLKKFYRMIAADERNTAVLKPVGAGK |
| Ga0179587_101259644 | 3300026557 | Vadose Zone Soil | VKELSVPLSKVEDLKKLYRVIAGDERNTAVLKPATH |
| Ga0179587_105100221 | 3300026557 | Vadose Zone Soil | LHYTRALEIKELSVPVSKMDDLKKFYRMIANDERNTAVLKPVGAVK |
| Ga0207860_10068932 | 3300026921 | Tropical Forest Soil | LTMEIKELSVPVNNLDQLKAFYRVIASDERNTAVLKPAVK |
| Ga0207815_10220331 | 3300027014 | Tropical Forest Soil | FEVKELSVPVSKIGDLRTFYRKINGDERNTAVLKPVDAR |
| Ga0209730_10144803 | 3300027034 | Forest Soil | GNTLRYTRTFEVKELSVPVSKAEDLKKLYRIIASDERNTAVLKPAAR |
| Ga0207762_10701951 | 3300027063 | Tropical Forest Soil | YRRTFEVKELSVPVTKADDLKKFYRIIAGDERNTVVLKATAK |
| Ga0209179_10273501 | 3300027512 | Vadose Zone Soil | RYARTFEVKDPSVPLSRIEDLKKLYRIIANDERSTAVLKPVASASGKN |
| Ga0208985_10616061 | 3300027528 | Forest Soil | YERTFEVKELSVPVERAEDLRKFYRIIAGDERNSVVLKAKQ |
| Ga0209329_10875732 | 3300027605 | Forest Soil | RTVEIKELSVPVSKADDLKKFYRIIASDERNTAVLKPASH |
| Ga0209076_10518163 | 3300027643 | Vadose Zone Soil | FEVKELSVPLSKVEDLKKLYRIIAGDERNTAVLKPAAH |
| Ga0209076_11736122 | 3300027643 | Vadose Zone Soil | NGNTLKYTRTFEVKELSVPLSKVEDLKKLYRMIAGDERNTAVLKPAAH |
| Ga0209217_10487071 | 3300027651 | Forest Soil | SKAEVTGKTLKYTRTFEIKELSVPVSKADELKTFYRVIGNDERNTAVLKPGH |
| Ga0209038_100763601 | 3300027737 | Bog Forest Soil | TETHGNVLRYTRTFEVKETSVPLSKVEDLKKLYRIIAGDERNTAVLKPAGN |
| Ga0209655_100654681 | 3300027767 | Bog Forest Soil | LSVPVNQIEELKKFYRMIASDERNTAVLKPSEPGK |
| Ga0209655_102749071 | 3300027767 | Bog Forest Soil | ARSMEIKELSVPVSKMDELKKFYRMIASDERSTAVLKPAQK |
| Ga0209448_100130864 | 3300027783 | Bog Forest Soil | LIRYTRTYEIKQLSVPVSKADEVRKFNRIIASDERNMAVLKPIAK |
| Ga0209811_101381771 | 3300027821 | Surface Soil | GNTIHYSRTLEVKELSVPVAHADELKKFYRIIAGDERNTVVLKAGAK |
| Ga0209060_105301812 | 3300027826 | Surface Soil | EVVGNVLKYHRTFEEKQLSVPVSDVPKLKQFYRIIASDERNTAVLHLAAR |
| Ga0209180_107086991 | 3300027846 | Vadose Zone Soil | TFEVKELSVPLSKVEDLKKLYRVIAGDERNTAVLKPATH |
| Ga0209517_100363975 | 3300027854 | Peatlands Soil | EVKELSVPVSRVEELKKFYRIIASDERNTAVLKPAAR |
| Ga0209166_103994292 | 3300027857 | Surface Soil | KELSVPLSKMDDLKKFYRVIAGDERNTAVLKPATAAASN |
| Ga0209611_102354543 | 3300027860 | Host-Associated | YTRSFEIKDLSVPAAKAGDLKELYRVIAGDERNSAVLKRTAATD |
| Ga0209465_101854841 | 3300027874 | Tropical Forest Soil | KELSVPVSKVEDLKKLYRIIASDERNNAVLKPAGH |
| Ga0209169_103437371 | 3300027879 | Soil | VDYTRTFEVKELSVPVSKAEDLRKFYRIIASDERGTVVLKPGP |
| Ga0209068_103548232 | 3300027894 | Watersheds | VNGSTLKYTRTFEVKELSVPLSKVDDLKKLYRIIAGDERNNAALKPAVH |
| Ga0209488_107478511 | 3300027903 | Vadose Zone Soil | ASYHSKAEINGNVLRYARTFEVKDPSVPLSRIEDLKKLYRIIANDERSTAVLKPVASASGKN |
| Ga0209415_102519541 | 3300027905 | Peatlands Soil | YTRTFEIKELSVPVSRAGDLKAFYRTIASDERNTVVLKISSK |
| Ga0209698_100385294 | 3300027911 | Watersheds | VKELSVPVAKAEELKKFYRIIAGDERNTVVLKGQAK |
| Ga0247684_10226861 | 3300028138 | Soil | TFEVKELSVPLNKMDELKKLYRIIASDERNTAVLKLASH |
| Ga0247684_10238573 | 3300028138 | Soil | TLKYTRRLEVKELTVPLSQMETLKKFYRIIASDERNTAVLQPASH |
| Ga0268265_120806402 | 3300028380 | Switchgrass Rhizosphere | TFEIKEPSVPLSKLNDLKTLYRVIATDERNNAVLKPTQP |
| Ga0137415_112221372 | 3300028536 | Vadose Zone Soil | VNGNTLKYTRTFEVKELSVPLSKVEDLKKLYRIIAGDERNTAVLKPVAH |
| Ga0265336_101843061 | 3300028666 | Rhizosphere | FELKELSLPVDRADELKRFDRAIAGDERNTVVLKAVAR |
| Ga0302219_102097132 | 3300028747 | Palsa | TRTFEIKELSVPVSKVDELKKFYRMIATDERNTAVLKPVAAAK |
| Ga0307504_103594542 | 3300028792 | Soil | VKELSVPLSKVEDLKKLYRVIAGDERNTAVLKPAAH |
| Ga0302222_101666052 | 3300028798 | Palsa | IHYSRTFEVKELSVPVARAEDLRKFYRIIAGDERNTVVLKAGQQ |
| Ga0302197_104248722 | 3300028873 | Bog | TVVTGNTVDYTRTFEIKELSVPVDKAEELRKFYRIIATDERSTIVLKQAH |
| Ga0222749_101172841 | 3300029636 | Soil | YTRTFEVKDPSVPLSKVEDLKKFYRIIADDERNTAVLKPSQH |
| Ga0311343_106963091 | 3300029953 | Bog | VLRYHRTFEQKEVSVPLSQVSDLKKFYRIIALDERNTAVLKLVAMP |
| Ga0311334_113479541 | 3300029987 | Fen | VGHTLRYTRTFEVRELSVPVSKAEKLKLFYRIIEADERALAVLKPAASH |
| Ga0311339_116494112 | 3300029999 | Palsa | LEIKELNVPVSKMEELKKFYRMIATDERNTAVLKPVGAGK |
| Ga0302270_104262311 | 3300030011 | Bog | FEVKDLSVPAEKSEELRKFYRIIANDERSTVVLKAQAK |
| Ga0311353_107259932 | 3300030399 | Palsa | VPVDQLNDLRKFYRYIAGDERNNAVLKPSAPAQSTAH |
| Ga0311372_117252762 | 3300030520 | Palsa | IKELSVPVSNVDELKKFYRMIATDERNTAVLKPVAAAK |
| Ga0311372_119969781 | 3300030520 | Palsa | NVLRYTRTFEIKELTVPVARTDALKELYRTIEGDERESAVLSSAH |
| Ga0316363_100895153 | 3300030659 | Peatlands Soil | RTLEVKELSVPVDKLPQLKTFYRIIASDERSTAVLKPKGN |
| Ga0265459_109830113 | 3300030741 | Soil | VKELSVPVSKADDLKKFYRIIASDERNTVVLKPAP |
| Ga0265750_10701702 | 3300030813 | Soil | IRYTRTFEVKELSVPVDRADDLRRFDRVITGDERNTVVLKAVAH |
| Ga0302314_110394711 | 3300030906 | Palsa | HYSRTFEVKELSVPVARAEDLRKFYRIIAGDERNTVVLKAGQQ |
| Ga0075386_119514191 | 3300030916 | Soil | KELSVPVEKLEQLKSFYRVIVGDERNTAVLKPAGK |
| Ga0265740_10012611 | 3300030940 | Soil | KYTRRIEVKELTVSLAQMESLKKFYRTIASDERNTAVLQPAGSK |
| Ga0073994_115750891 | 3300030991 | Soil | RTFEIKELTVPMDKMDDLKKFYRVIASDERNTAVLKPSAQSALR |
| Ga0170834_1080735872 | 3300031057 | Forest Soil | NILRYTRSFEVKEVTVPLSKVENLKKLYRIIASDERNTTVLKPVTH |
| Ga0170834_1097410731 | 3300031057 | Forest Soil | HYSRTLEVKELSVPVARAEELKKFYRIVAGDERNTVVLKTGAR |
| Ga0265760_101300721 | 3300031090 | Soil | TRTFEVKELSVPVDKTEELRKFYRIIAGDERNTVVLKTASK |
| Ga0170823_129538631 | 3300031128 | Forest Soil | LGYTRTYEIKELSVPTSKLNDLKAFYRIIASDERNTAVLKPAAN |
| Ga0170824_1056111911 | 3300031231 | Forest Soil | RTLEIKDLSVPVARADDLKKFYRIIAGDERNTVVLRAGSK |
| Ga0170824_1140448231 | 3300031231 | Forest Soil | VKEVTVPLSKVENLKKLYRIIASDERNTTVLKPVTH |
| Ga0170824_1254009212 | 3300031231 | Forest Soil | LGYTRTYEIKELSVPTSKLNDLKAFYRIIASDERNTAVLKPASN |
| Ga0302324_1001515743 | 3300031236 | Palsa | RTFEIKELSVPVSKVDELKKFYRMIATDERNTAVLKPVAAAK |
| Ga0307513_109430872 | 3300031456 | Ectomycorrhiza | EIKELSIPAAKAEQLKTLYRTIDNDERTSAVLKRVSP |
| Ga0318541_108504602 | 3300031545 | Soil | SRTFEVKELSVPVSKSEELKKFYRIIATDERNTVVLKQQGK |
| Ga0310686_1034167121 | 3300031708 | Soil | RTFELKELSVPVEKSDDLRKFYRIIAGDERNTVVLKPAP |
| Ga0310686_1067870321 | 3300031708 | Soil | DYTRTFEVKELSVPVNKAEDLKKFYRIIAGDERNTVVLKPSP |
| Ga0310686_1128150552 | 3300031708 | Soil | VKELSIPVSKAEDLRRFYRIIASDERNTVVLKPAP |
| Ga0307476_101210921 | 3300031715 | Hardwood Forest Soil | FEVKELSVPVNKAEDLKKFYRIIAGDERNTVVLKPSP |
| Ga0307476_102311071 | 3300031715 | Hardwood Forest Soil | SRTLEVKELSVPVNRADDLKKFYRIIAGDERNTVVLKAK |
| Ga0307476_103704191 | 3300031715 | Hardwood Forest Soil | EVKELTVPVAKAEDLKKFYRIIAGDERSTVVLKPAP |
| Ga0307476_108266132 | 3300031715 | Hardwood Forest Soil | FEIKELSVPVSRADELKAFYRTIASDERNTVVLKVSSK |
| Ga0307474_102342133 | 3300031718 | Hardwood Forest Soil | FEVKELSVPVDKAEELRKFYRIIATDERNTLVLKPAP |
| Ga0307469_103470971 | 3300031720 | Hardwood Forest Soil | VLKYTRSLEIKQLTVPLSEMEDLKKFNRVIAGDERNTAVLKPAAH |
| Ga0307469_113261301 | 3300031720 | Hardwood Forest Soil | HSKTAVSGSTLKYTRTFEVKELSVPLSKVDDLKKLYRIIAGDERNTAVLKPAAH |
| Ga0307477_101024953 | 3300031753 | Hardwood Forest Soil | TRTFEVKELSVPVSKADDLKKFYRIIASDERNTAVLKAK |
| Ga0307477_101774101 | 3300031753 | Hardwood Forest Soil | YTRTFEIKELTVLVSKADELTFYGVIGNDERNKAVLKPGAN |
| Ga0307475_103342333 | 3300031754 | Hardwood Forest Soil | VKELSVPVGRADELKKFYRIIAGDERNTVVLKPSP |
| Ga0307475_106725672 | 3300031754 | Hardwood Forest Soil | EVKELSVPLSKVEDLKKLYRVIAGDERNTAVLKPATH |
| Ga0307475_110058601 | 3300031754 | Hardwood Forest Soil | KTEVNGTTLKYTRTFEVKELSVPLSKVDDLKKLYRIIAGDERTTAVLKPVVH |
| Ga0318547_100926194 | 3300031781 | Soil | KYTRTFEVKELSVPVSKVEDLKGLYRVIASDERNTAVLKLASH |
| Ga0307473_101276223 | 3300031820 | Hardwood Forest Soil | YHSKTEFSAHVLRYTRTFEGKEVTVSVAKVNDLKKLYRVIAGDERNTAVLKPAGQ |
| Ga0307478_100014173 | 3300031823 | Hardwood Forest Soil | VIGYPRTFDFKELSVPPSKADELKKFYRIIASDERSTAVLKPAGK |
| Ga0307478_100858201 | 3300031823 | Hardwood Forest Soil | YTRTFEIKELSVPVSKAEQLKTFYRVIGNDERNTAVLKPGPN |
| Ga0307478_101184851 | 3300031823 | Hardwood Forest Soil | VVDYTRTFEVKELSVPVDKAEDLRKFYRIIATDERNTVVLKPGP |
| Ga0310917_109254012 | 3300031833 | Soil | TEVNGGMLKYSRIFEVKELSVPVSKVEELKKLYRIIASDERNTAVLKPADH |
| Ga0306919_101965352 | 3300031879 | Soil | EVKELSVPVAKVDDLKKFYRIIGGDERNTVVLKPAQ |
| Ga0306925_106897093 | 3300031890 | Soil | QLSVPVTQAQDLKMFYRAIANDERGTAVLKPAATSSTSR |
| Ga0318530_104800352 | 3300031959 | Soil | LKYTRTFEVKELSVPVSKVEDLKGLYRVIASDERNTAVLKLASH |
| Ga0307479_100749621 | 3300031962 | Hardwood Forest Soil | KTLKYTRTFEIKELSVPVSKADELKMFYRVIGNDERNTAVLKSGPK |
| Ga0307479_115010941 | 3300031962 | Hardwood Forest Soil | FEIKELSVPLNKMEDLRKFYRIIAGDERNTAVLKPVAH |
| Ga0307416_1002116472 | 3300032002 | Rhizosphere | EVKELSVPVAKAQSLKAFFREIESDERNSAVLKKAQ |
| Ga0311301_110296063 | 3300032160 | Peatlands Soil | RTFEVKELSVPLSKMDDLKKFYRIIAGDERNTAVLKPGTAK |
| Ga0311301_118049322 | 3300032160 | Peatlands Soil | GGMIRYTRTFEVKELSVPVDRADELKRFDRAITGDERNTVVLKAVAR |
| Ga0311301_129426762 | 3300032160 | Peatlands Soil | YTRALEIKELSVPISKMDELKKFYRMIATDERNTAVLKPAGPGK |
| Ga0307471_1036725732 | 3300032180 | Hardwood Forest Soil | EVKELSGPVTKANELKKFYRVIGGDERNTVVLKTETK |
| Ga0307472_1002123591 | 3300032205 | Hardwood Forest Soil | ELSVPVSKMDDLKKFYRMIAADERNTAVLKPMGAGK |
| Ga0307472_1026159482 | 3300032205 | Hardwood Forest Soil | ELIVSMDKMDDLKKFYRIIASDERNTAVLKPSAQR |
| Ga0316228_11864901 | 3300032579 | Freshwater | ARGNQIHYTRTFEIKELSVPASRAAELKRFYRIIATDERSMAVLRTVSN |
| Ga0316232_11890221 | 3300032605 | Freshwater | EARGNQIHYTRTFEIKELSVPASRAAELKRFYRIIATDERSMAVLRTVSN |
| Ga0335082_101119101 | 3300032782 | Soil | LRYTRTLEIKQLSVPVNKVEELKKFYRIIASDERNAAVLRPASH |
| Ga0335078_100282601 | 3300032805 | Soil | KRSFEVKELSVPVSQADELKKFYRIIASDERNTAVLRPATKQP |
| Ga0335078_119720881 | 3300032805 | Soil | TFEVKELSVPVAKADDLKKFYRMIAGDERNTVVLKAGAK |
| Ga0335078_125915501 | 3300032805 | Soil | IHYTRTLEVKQLSVPVAQADQLKKFYRIIAGDERNTAILKSAGR |
| Ga0335080_100846201 | 3300032828 | Soil | TADGNRIRYSRTLEVKELSVPLSHIDELRDFYRTIASDERNNVVLKSKAP |
| Ga0335070_118454961 | 3300032829 | Soil | YKRTYELKEVSVPVSKAGELKEFYRIIANDERSMAVLAKAR |
| Ga0335069_116348252 | 3300032893 | Soil | RYHRTFEVKELSVPVSDAPQMRKFYRIIASDERNTAVLKPSGPP |
| Ga0335069_127721212 | 3300032893 | Soil | RTFEIKQLSVPVSQAEQLKKFYRIIASDERNNAVLKQTSP |
| Ga0335083_110574141 | 3300032954 | Soil | EIKQLSVPVSQAEDLKKFYRIIGNDERGTAVLKPK |
| Ga0335083_111996311 | 3300032954 | Soil | FEIKNPSVPLSQVGELKKFYRVIANDERNMAVLKSK |
| Ga0335076_107919122 | 3300032955 | Soil | EVSVPLEKMDELKKFYRLIGSDERGTAVLKPSAVKAADFSPTGH |
| Ga0310914_116195141 | 3300033289 | Soil | YQIKELSVPPSKSEDVKKFYQIIASDERNMAVLKPMTK |
| Ga0326728_108283821 | 3300033402 | Peat Soil | VKELSVPVSRADELKKFYRIIASDERNTVVLKAGPK |
| Ga0326727_107146682 | 3300033405 | Peat Soil | KELSVPVEKLDQLKTMYHAIAGDERNTAVLKAKAN |
| Ga0310810_106506391 | 3300033412 | Soil | TVEIRELSVPLSKMDDLKKFYRIIATDERNTAVLKPSTGSH |
| Ga0316628_1028385942 | 3300033513 | Soil | NGNVIRYVRNFEICELSVPASRAEEVKKFFRIIASDERNSVVLKPVSK |
| Ga0371487_0404251_3_110 | 3300033982 | Peat Soil | SVPVEKMDQLKKLYRIIATDERNTAVLRPAGPGGN |
| Ga0371488_0213033_794_940 | 3300033983 | Peat Soil | VNGNVVDYTRTFEVKELSVPVSRAEELRRFYRIIASDERNTMVLKPSP |
| Ga0370515_0125998_2_115 | 3300034163 | Untreated Peat Soil | EVTELSVPVACADELKKFYRIVAGDERNTVVLKAGAK |
| Ga0370514_023822_1326_1472 | 3300034199 | Untreated Peat Soil | VTGNVLDYTRTFEIKELSVPVDKAEELRKFYRIIATDERSTVVLKPAH |
| Ga0373958_0223250_1_126 | 3300034819 | Rhizosphere Soil | NRTFEVKELSVPVSKAEDLKKFYRIIASDERNTVVLKPASK |
| ⦗Top⦘ |