


| Basic Information | |
|---|---|
| Family ID | F003510 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 482 |
| Average Sequence Length | 45 residues |
| Representative Sequence | PFGDGGAERRREITAQELGALLSGIDLSTAKRRKRYQRKGA |
| Number of Associated Samples | 369 |
| Number of Associated Scaffolds | 482 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 15.59 % |
| % of genes near scaffold ends (potentially truncated) | 82.99 % |
| % of genes from short scaffolds (< 2000 bps) | 90.25 % |
| Associated GOLD sequencing projects | 344 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.36 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (90.041 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (7.469 % of family members) |
| Environment Ontology (ENVO) | Unclassified (18.050 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (46.680 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 17.39% β-sheet: 0.00% Coil/Unstructured: 82.61% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.36 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 482 Family Scaffolds |
|---|---|---|
| PF13007 | LZ_Tnp_IS66 | 56.43 |
| PF13817 | DDE_Tnp_IS66_C | 10.37 |
| PF08388 | GIIM | 2.70 |
| PF05717 | TnpB_IS66 | 2.28 |
| PF13005 | zf-IS66 | 2.28 |
| PF03050 | DDE_Tnp_IS66 | 1.04 |
| PF13518 | HTH_28 | 1.04 |
| PF07228 | SpoIIE | 0.41 |
| PF08327 | AHSA1 | 0.41 |
| PF01527 | HTH_Tnp_1 | 0.41 |
| PF13408 | Zn_ribbon_recom | 0.21 |
| PF01152 | Bac_globin | 0.21 |
| PF13277 | YmdB | 0.21 |
| PF13458 | Peripla_BP_6 | 0.21 |
| PF14690 | zf-ISL3 | 0.21 |
| PF03551 | PadR | 0.21 |
| PF05598 | DUF772 | 0.21 |
| PF08310 | LGFP | 0.21 |
| PF00665 | rve | 0.21 |
| PF08450 | SGL | 0.21 |
| PF00872 | Transposase_mut | 0.21 |
| PF02142 | MGS | 0.21 |
| PF07592 | DDE_Tnp_ISAZ013 | 0.21 |
| PF00239 | Resolvase | 0.21 |
| PF07676 | PD40 | 0.21 |
| PF11903 | ParD_like | 0.21 |
| PF12760 | Zn_Tnp_IS1595 | 0.21 |
| PF12704 | MacB_PCD | 0.21 |
| PF13340 | DUF4096 | 0.21 |
| PF02899 | Phage_int_SAM_1 | 0.21 |
| PF00132 | Hexapep | 0.21 |
| PF04185 | Phosphoesterase | 0.21 |
| PF02867 | Ribonuc_red_lgC | 0.21 |
| COG ID | Name | Functional Category | % Frequency in 482 Family Scaffolds |
|---|---|---|---|
| COG3436 | Transposase | Mobilome: prophages, transposons [X] | 3.32 |
| COG0209 | Ribonucleotide reductase alpha subunit | Nucleotide transport and metabolism [F] | 0.21 |
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.21 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.21 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.21 |
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.21 |
| COG2346 | Truncated hemoglobin YjbI | Inorganic ion transport and metabolism [P] | 0.21 |
| COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 0.21 |
| COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 0.21 |
| COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 0.21 |
| COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 0.21 |
| COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 0.21 |
| COG3386 | Sugar lactone lactonase YvrE | Carbohydrate transport and metabolism [G] | 0.21 |
| COG3391 | DNA-binding beta-propeller fold protein YncE | General function prediction only [R] | 0.21 |
| COG3511 | Phospholipase C | Cell wall/membrane/envelope biogenesis [M] | 0.21 |
| COG4584 | Transposase | Mobilome: prophages, transposons [X] | 0.21 |
| COG4973 | Site-specific recombinase XerC | Replication, recombination and repair [L] | 0.21 |
| COG4974 | Site-specific recombinase XerD | Replication, recombination and repair [L] | 0.21 |
| COG5479 | LGFP repeat-containing protein, may be involved in cell wall binding | Cell wall/membrane/envelope biogenesis [M] | 0.21 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 90.04 % |
| Unclassified | root | N/A | 9.96 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459009|GA8DASG01CY242 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 2170459017|G14TP7Y02GNUWN | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
| 3300001471|JGI12712J15308_10003664 | All Organisms → cellular organisms → Bacteria | 4447 | Open in IMG/M |
| 3300001546|JGI12659J15293_10026019 | All Organisms → cellular organisms → Bacteria | 1479 | Open in IMG/M |
| 3300001661|JGI12053J15887_10582295 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100172292 | All Organisms → cellular organisms → Bacteria | 2047 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100210113 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia | 1838 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100905224 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
| 3300002568|C688J35102_118674055 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300002914|JGI25617J43924_10179104 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
| 3300003992|Ga0055470_10139122 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300003997|Ga0055466_10223856 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300004080|Ga0062385_11292414 | Not Available | 502 | Open in IMG/M |
| 3300004081|Ga0063454_100777022 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 736 | Open in IMG/M |
| 3300004082|Ga0062384_101356422 | Not Available | 522 | Open in IMG/M |
| 3300004092|Ga0062389_102454157 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Blastopirellula → Blastopirellula marina | 691 | Open in IMG/M |
| 3300004152|Ga0062386_101838810 | Not Available | 505 | Open in IMG/M |
| 3300004156|Ga0062589_101817375 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300004480|Ga0062592_101185537 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
| 3300005167|Ga0066672_10956180 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300005172|Ga0066683_10090477 | All Organisms → cellular organisms → Bacteria | 1850 | Open in IMG/M |
| 3300005181|Ga0066678_10951694 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300005327|Ga0070658_10580770 | All Organisms → cellular organisms → Bacteria | 971 | Open in IMG/M |
| 3300005328|Ga0070676_11426004 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300005332|Ga0066388_100356840 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia | 2108 | Open in IMG/M |
| 3300005332|Ga0066388_100464320 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae | 1906 | Open in IMG/M |
| 3300005332|Ga0066388_103189998 | All Organisms → cellular organisms → Bacteria | 838 | Open in IMG/M |
| 3300005332|Ga0066388_103478231 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
| 3300005335|Ga0070666_11166614 | Not Available | 573 | Open in IMG/M |
| 3300005337|Ga0070682_101414430 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300005354|Ga0070675_101117980 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
| 3300005365|Ga0070688_100523712 | All Organisms → cellular organisms → Bacteria | 897 | Open in IMG/M |
| 3300005365|Ga0070688_100721809 | All Organisms → cellular organisms → Bacteria | 773 | Open in IMG/M |
| 3300005365|Ga0070688_101363972 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300005366|Ga0070659_100403498 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1154 | Open in IMG/M |
| 3300005434|Ga0070709_10474526 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 946 | Open in IMG/M |
| 3300005434|Ga0070709_10706095 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae | 785 | Open in IMG/M |
| 3300005437|Ga0070710_11309536 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300005440|Ga0070705_100288702 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1170 | Open in IMG/M |
| 3300005445|Ga0070708_100200509 | All Organisms → cellular organisms → Bacteria | 1868 | Open in IMG/M |
| 3300005458|Ga0070681_10480560 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1155 | Open in IMG/M |
| 3300005459|Ga0068867_100777571 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae | 852 | Open in IMG/M |
| 3300005466|Ga0070685_11284707 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300005468|Ga0070707_100841586 | All Organisms → cellular organisms → Bacteria | 881 | Open in IMG/M |
| 3300005471|Ga0070698_100430030 | All Organisms → cellular organisms → Bacteria | 1255 | Open in IMG/M |
| 3300005541|Ga0070733_10138213 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae | 1575 | Open in IMG/M |
| 3300005541|Ga0070733_10387783 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 929 | Open in IMG/M |
| 3300005546|Ga0070696_100270713 | All Organisms → cellular organisms → Bacteria | 1291 | Open in IMG/M |
| 3300005548|Ga0070665_100511088 | All Organisms → cellular organisms → Bacteria | 1213 | Open in IMG/M |
| 3300005549|Ga0070704_100815069 | All Organisms → cellular organisms → Bacteria | 835 | Open in IMG/M |
| 3300005556|Ga0066707_10584944 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae | 715 | Open in IMG/M |
| 3300005578|Ga0068854_100783987 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 829 | Open in IMG/M |
| 3300005587|Ga0066654_10124269 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1281 | Open in IMG/M |
| 3300005587|Ga0066654_10272711 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae | 898 | Open in IMG/M |
| 3300005591|Ga0070761_10076397 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1905 | Open in IMG/M |
| 3300005602|Ga0070762_10778720 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
| 3300005602|Ga0070762_10906820 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300005607|Ga0070740_10143770 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae | 1037 | Open in IMG/M |
| 3300005610|Ga0070763_10192848 | All Organisms → cellular organisms → Bacteria | 1083 | Open in IMG/M |
| 3300005712|Ga0070764_10185557 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae | 1160 | Open in IMG/M |
| 3300005712|Ga0070764_10926471 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300005764|Ga0066903_100587013 | All Organisms → cellular organisms → Bacteria | 1925 | Open in IMG/M |
| 3300005764|Ga0066903_100847012 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1644 | Open in IMG/M |
| 3300005841|Ga0068863_100815835 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 931 | Open in IMG/M |
| 3300005844|Ga0068862_100922533 | All Organisms → cellular organisms → Bacteria | 860 | Open in IMG/M |
| 3300005921|Ga0070766_10668821 | Not Available | 701 | Open in IMG/M |
| 3300005921|Ga0070766_10688648 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
| 3300005921|Ga0070766_10706552 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
| 3300005952|Ga0080026_10027475 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae | 1417 | Open in IMG/M |
| 3300005993|Ga0080027_10076610 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1234 | Open in IMG/M |
| 3300006047|Ga0075024_100576747 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae | 601 | Open in IMG/M |
| 3300006102|Ga0075015_100797101 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300006162|Ga0075030_101391423 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300006175|Ga0070712_100578260 | All Organisms → cellular organisms → Bacteria | 949 | Open in IMG/M |
| 3300006176|Ga0070765_100656309 | All Organisms → cellular organisms → Bacteria | 990 | Open in IMG/M |
| 3300006176|Ga0070765_101839935 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300006176|Ga0070765_101862495 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300006358|Ga0068871_101377058 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
| 3300006638|Ga0075522_10054162 | All Organisms → cellular organisms → Bacteria | 2308 | Open in IMG/M |
| 3300006755|Ga0079222_10205276 | All Organisms → cellular organisms → Bacteria | 1190 | Open in IMG/M |
| 3300006796|Ga0066665_10305913 | All Organisms → cellular organisms → Bacteria | 1280 | Open in IMG/M |
| 3300006796|Ga0066665_11611092 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300006797|Ga0066659_11534389 | Not Available | 558 | Open in IMG/M |
| 3300006804|Ga0079221_10443950 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 821 | Open in IMG/M |
| 3300006846|Ga0075430_101624378 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300006852|Ga0075433_10195331 | All Organisms → cellular organisms → Bacteria | 1800 | Open in IMG/M |
| 3300006893|Ga0073928_10091636 | All Organisms → cellular organisms → Bacteria | 2574 | Open in IMG/M |
| 3300006903|Ga0075426_10132465 | All Organisms → cellular organisms → Bacteria | 1795 | Open in IMG/M |
| 3300006914|Ga0075436_101276526 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300006954|Ga0079219_10825716 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
| 3300007255|Ga0099791_10397049 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
| 3300007255|Ga0099791_10569261 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300007788|Ga0099795_10105364 | All Organisms → cellular organisms → Bacteria | 1111 | Open in IMG/M |
| 3300007788|Ga0099795_10640228 | Not Available | 508 | Open in IMG/M |
| 3300009038|Ga0099829_11166841 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300009088|Ga0099830_10721744 | All Organisms → cellular organisms → Bacteria | 821 | Open in IMG/M |
| 3300009089|Ga0099828_10185717 | All Organisms → cellular organisms → Bacteria | 1851 | Open in IMG/M |
| 3300009090|Ga0099827_10101592 | All Organisms → cellular organisms → Bacteria | 2287 | Open in IMG/M |
| 3300009090|Ga0099827_10448992 | All Organisms → cellular organisms → Bacteria | 1105 | Open in IMG/M |
| 3300009101|Ga0105247_10626568 | All Organisms → cellular organisms → Bacteria | 801 | Open in IMG/M |
| 3300009101|Ga0105247_11261532 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300009148|Ga0105243_10735507 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 966 | Open in IMG/M |
| 3300009174|Ga0105241_10435965 | Not Available | 1156 | Open in IMG/M |
| 3300009174|Ga0105241_12338873 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300009177|Ga0105248_12895057 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300009179|Ga0115028_11877503 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300009400|Ga0116854_1005863 | All Organisms → cellular organisms → Bacteria | 1742 | Open in IMG/M |
| 3300009500|Ga0116229_10893114 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
| 3300009521|Ga0116222_1461339 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300009551|Ga0105238_12523989 | Not Available | 550 | Open in IMG/M |
| 3300009552|Ga0116138_1099658 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 807 | Open in IMG/M |
| 3300009624|Ga0116105_1046487 | All Organisms → cellular organisms → Bacteria | 986 | Open in IMG/M |
| 3300009624|Ga0116105_1215847 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300009644|Ga0116121_1017442 | All Organisms → cellular organisms → Bacteria | 2305 | Open in IMG/M |
| 3300009662|Ga0105856_1311174 | Not Available | 529 | Open in IMG/M |
| 3300009665|Ga0116135_1321860 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300009683|Ga0116224_10256759 | All Organisms → cellular organisms → Bacteria | 833 | Open in IMG/M |
| 3300009697|Ga0116231_10484295 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
| 3300009759|Ga0116101_1009862 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1719 | Open in IMG/M |
| 3300009824|Ga0116219_10522845 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300010045|Ga0126311_11542787 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300010047|Ga0126382_11096359 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 705 | Open in IMG/M |
| 3300010048|Ga0126373_10203299 | All Organisms → cellular organisms → Bacteria | 1921 | Open in IMG/M |
| 3300010048|Ga0126373_10443571 | Not Available | 1331 | Open in IMG/M |
| 3300010048|Ga0126373_12018469 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300010323|Ga0134086_10430704 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300010333|Ga0134080_10469517 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300010336|Ga0134071_10690871 | Not Available | 539 | Open in IMG/M |
| 3300010341|Ga0074045_10982317 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300010343|Ga0074044_10615155 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
| 3300010358|Ga0126370_10025981 | All Organisms → cellular organisms → Bacteria | 3448 | Open in IMG/M |
| 3300010358|Ga0126370_12673018 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 500 | Open in IMG/M |
| 3300010359|Ga0126376_10020587 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 4311 | Open in IMG/M |
| 3300010359|Ga0126376_11744723 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
| 3300010359|Ga0126376_12312433 | Not Available | 584 | Open in IMG/M |
| 3300010359|Ga0126376_12376950 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300010366|Ga0126379_10114402 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2434 | Open in IMG/M |
| 3300010366|Ga0126379_10823446 | All Organisms → cellular organisms → Bacteria | 1028 | Open in IMG/M |
| 3300010366|Ga0126379_11684507 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
| 3300010375|Ga0105239_12222314 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300010376|Ga0126381_100862500 | All Organisms → cellular organisms → Bacteria | 1302 | Open in IMG/M |
| 3300010376|Ga0126381_101647448 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 927 | Open in IMG/M |
| 3300010376|Ga0126381_103897265 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300010379|Ga0136449_100933015 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Kribbellaceae → Kribbella | 1409 | Open in IMG/M |
| 3300010379|Ga0136449_102223076 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
| 3300010396|Ga0134126_10948106 | All Organisms → cellular organisms → Bacteria | 966 | Open in IMG/M |
| 3300010396|Ga0134126_13071132 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 503 | Open in IMG/M |
| 3300010398|Ga0126383_11107286 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 881 | Open in IMG/M |
| 3300010401|Ga0134121_11969980 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 615 | Open in IMG/M |
| 3300010403|Ga0134123_11884359 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 653 | Open in IMG/M |
| 3300011269|Ga0137392_10163844 | All Organisms → cellular organisms → Bacteria | 1802 | Open in IMG/M |
| 3300011269|Ga0137392_10466586 | All Organisms → cellular organisms → Bacteria | 1048 | Open in IMG/M |
| 3300011271|Ga0137393_11009092 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
| 3300011998|Ga0120114_1095245 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 573 | Open in IMG/M |
| 3300012044|Ga0136636_10268569 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
| 3300012096|Ga0137389_10558836 | All Organisms → cellular organisms → Bacteria | 983 | Open in IMG/M |
| 3300012201|Ga0137365_11236118 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300012202|Ga0137363_11406674 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300012202|Ga0137363_11462549 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300012205|Ga0137362_11256868 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300012205|Ga0137362_11645757 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300012210|Ga0137378_11024181 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
| 3300012210|Ga0137378_11031460 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
| 3300012210|Ga0137378_11280573 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
| 3300012210|Ga0137378_11347075 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300012357|Ga0137384_10069571 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2922 | Open in IMG/M |
| 3300012357|Ga0137384_10730247 | All Organisms → cellular organisms → Bacteria | 803 | Open in IMG/M |
| 3300012357|Ga0137384_10780894 | All Organisms → cellular organisms → Bacteria | 773 | Open in IMG/M |
| 3300012359|Ga0137385_11632776 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300012360|Ga0137375_11126587 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300012469|Ga0150984_110354737 | All Organisms → cellular organisms → Bacteria | 961 | Open in IMG/M |
| 3300012672|Ga0137317_1021011 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300012899|Ga0157299_10263168 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300012924|Ga0137413_10933733 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
| 3300012929|Ga0137404_10147048 | All Organisms → cellular organisms → Bacteria | 1956 | Open in IMG/M |
| 3300012948|Ga0126375_10108357 | All Organisms → cellular organisms → Bacteria | 1664 | Open in IMG/M |
| 3300012955|Ga0164298_10193459 | Not Available | 1183 | Open in IMG/M |
| 3300012955|Ga0164298_11330174 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300012955|Ga0164298_11375214 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300012960|Ga0164301_10300950 | All Organisms → cellular organisms → Bacteria | 1080 | Open in IMG/M |
| 3300012986|Ga0164304_10315219 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1078 | Open in IMG/M |
| 3300012988|Ga0164306_10874518 | All Organisms → cellular organisms → Bacteria | 730 | Open in IMG/M |
| 3300012989|Ga0164305_11273218 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
| 3300013102|Ga0157371_11415039 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300013307|Ga0157372_12667462 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300013308|Ga0157375_11212177 | Not Available | 885 | Open in IMG/M |
| 3300013308|Ga0157375_13776035 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300013314|Ga0175859_1069951 | All Organisms → cellular organisms → Bacteria | 1325 | Open in IMG/M |
| 3300014056|Ga0120125_1089582 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
| 3300014056|Ga0120125_1125971 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300014156|Ga0181518_10620050 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300014158|Ga0181521_10483144 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300014159|Ga0181530_10450116 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300014162|Ga0181538_10664680 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300014164|Ga0181532_10004145 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 12789 | Open in IMG/M |
| 3300014167|Ga0181528_10556989 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300014199|Ga0181535_10891731 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300014200|Ga0181526_10517796 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
| 3300014326|Ga0157380_13064793 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300014493|Ga0182016_10086687 | All Organisms → cellular organisms → Bacteria | 2260 | Open in IMG/M |
| 3300014494|Ga0182017_10098389 | All Organisms → cellular organisms → Bacteria | 1918 | Open in IMG/M |
| 3300014495|Ga0182015_10069312 | All Organisms → cellular organisms → Bacteria | 2507 | Open in IMG/M |
| 3300014495|Ga0182015_10105616 | All Organisms → cellular organisms → Bacteria | 1951 | Open in IMG/M |
| 3300014495|Ga0182015_10344659 | All Organisms → cellular organisms → Bacteria | 968 | Open in IMG/M |
| 3300014501|Ga0182024_10199536 | All Organisms → cellular organisms → Bacteria | 2737 | Open in IMG/M |
| 3300014501|Ga0182024_10273838 | All Organisms → cellular organisms → Bacteria | 2247 | Open in IMG/M |
| 3300014501|Ga0182024_10450693 | All Organisms → cellular organisms → Bacteria | 1650 | Open in IMG/M |
| 3300014654|Ga0181525_10866692 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 512 | Open in IMG/M |
| 3300014657|Ga0181522_10261652 | All Organisms → cellular organisms → Bacteria | 1024 | Open in IMG/M |
| 3300015051|Ga0137414_1151474 | All Organisms → cellular organisms → Bacteria | 5008 | Open in IMG/M |
| 3300015054|Ga0137420_1096115 | All Organisms → cellular organisms → Bacteria | 1071 | Open in IMG/M |
| 3300015054|Ga0137420_1111125 | All Organisms → cellular organisms → Bacteria | 1010 | Open in IMG/M |
| 3300015069|Ga0167633_127509 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300015158|Ga0167622_1033904 | All Organisms → cellular organisms → Bacteria | 1008 | Open in IMG/M |
| 3300015190|Ga0167651_1010445 | All Organisms → cellular organisms → Bacteria | 2088 | Open in IMG/M |
| 3300015245|Ga0137409_10282901 | All Organisms → cellular organisms → Bacteria | 1463 | Open in IMG/M |
| 3300015261|Ga0182006_1200416 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
| 3300015264|Ga0137403_10179828 | All Organisms → cellular organisms → Bacteria | 2061 | Open in IMG/M |
| 3300015372|Ga0132256_102418966 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300015373|Ga0132257_103183500 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300015374|Ga0132255_100329055 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2207 | Open in IMG/M |
| 3300015374|Ga0132255_100470999 | Not Available | 1842 | Open in IMG/M |
| 3300015374|Ga0132255_106317056 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 501 | Open in IMG/M |
| 3300016270|Ga0182036_10490801 | All Organisms → cellular organisms → Bacteria | 971 | Open in IMG/M |
| 3300016270|Ga0182036_10717445 | All Organisms → cellular organisms → Bacteria | 810 | Open in IMG/M |
| 3300016294|Ga0182041_10710836 | All Organisms → cellular organisms → Bacteria | 892 | Open in IMG/M |
| 3300016319|Ga0182033_11831242 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300016341|Ga0182035_11835293 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300016357|Ga0182032_11264465 | Not Available | 636 | Open in IMG/M |
| 3300017924|Ga0187820_1230768 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300017924|Ga0187820_1288927 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300017934|Ga0187803_10340499 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300017941|Ga0187850_10301332 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
| 3300017948|Ga0187847_10171675 | All Organisms → cellular organisms → Bacteria | 1183 | Open in IMG/M |
| 3300017948|Ga0187847_10188298 | All Organisms → cellular organisms → Bacteria | 1125 | Open in IMG/M |
| 3300017959|Ga0187779_11336581 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300017970|Ga0187783_11079699 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 578 | Open in IMG/M |
| 3300017975|Ga0187782_10350389 | Not Available | 1118 | Open in IMG/M |
| 3300017975|Ga0187782_10457254 | All Organisms → cellular organisms → Bacteria | 973 | Open in IMG/M |
| 3300017988|Ga0181520_10216123 | All Organisms → cellular organisms → Bacteria | 1493 | Open in IMG/M |
| 3300018002|Ga0187868_1133308 | All Organisms → cellular organisms → Bacteria | 920 | Open in IMG/M |
| 3300018008|Ga0187888_1237886 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
| 3300018016|Ga0187880_1167516 | All Organisms → cellular organisms → Bacteria | 1019 | Open in IMG/M |
| 3300018022|Ga0187864_10027579 | All Organisms → cellular organisms → Bacteria | 3403 | Open in IMG/M |
| 3300018023|Ga0187889_10404419 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300018026|Ga0187857_10093018 | All Organisms → cellular organisms → Bacteria | 1475 | Open in IMG/M |
| 3300018033|Ga0187867_10094427 | All Organisms → cellular organisms → Bacteria | 1748 | Open in IMG/M |
| 3300018034|Ga0187863_10009632 | All Organisms → cellular organisms → Bacteria | 6354 | Open in IMG/M |
| 3300018037|Ga0187883_10264085 | All Organisms → cellular organisms → Bacteria | 880 | Open in IMG/M |
| 3300018038|Ga0187855_10138955 | All Organisms → cellular organisms → Bacteria | 1453 | Open in IMG/M |
| 3300018042|Ga0187871_10030677 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3362 | Open in IMG/M |
| 3300018042|Ga0187871_10076987 | All Organisms → cellular organisms → Bacteria | 1951 | Open in IMG/M |
| 3300018042|Ga0187871_10283742 | All Organisms → cellular organisms → Bacteria | 917 | Open in IMG/M |
| 3300018043|Ga0187887_10155997 | All Organisms → cellular organisms → Bacteria | 1365 | Open in IMG/M |
| 3300018044|Ga0187890_10072900 | All Organisms → cellular organisms → Bacteria | 2017 | Open in IMG/M |
| 3300018044|Ga0187890_10081199 | All Organisms → cellular organisms → Bacteria | 1896 | Open in IMG/M |
| 3300018044|Ga0187890_10844452 | Not Available | 517 | Open in IMG/M |
| 3300018046|Ga0187851_10871085 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300018084|Ga0184629_10572430 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300018089|Ga0187774_10262526 | All Organisms → cellular organisms → Bacteria | 985 | Open in IMG/M |
| 3300018090|Ga0187770_11332341 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300018090|Ga0187770_11661323 | Not Available | 522 | Open in IMG/M |
| 3300018468|Ga0066662_10285917 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1374 | Open in IMG/M |
| 3300018482|Ga0066669_10760493 | All Organisms → cellular organisms → Bacteria | 856 | Open in IMG/M |
| 3300019377|Ga0190264_11615305 | Not Available | 571 | Open in IMG/M |
| 3300019787|Ga0182031_1081818 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 879 | Open in IMG/M |
| 3300020012|Ga0193732_1046238 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
| 3300020021|Ga0193726_1136213 | All Organisms → cellular organisms → Bacteria | 1081 | Open in IMG/M |
| 3300020061|Ga0193716_1217702 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
| 3300020152|Ga0196971_1063101 | All Organisms → cellular organisms → Bacteria | 801 | Open in IMG/M |
| 3300020199|Ga0179592_10288551 | All Organisms → cellular organisms → Bacteria | 731 | Open in IMG/M |
| 3300020583|Ga0210401_10000665 | All Organisms → cellular organisms → Bacteria | 41683 | Open in IMG/M |
| 3300021090|Ga0210377_10214104 | Not Available | 1220 | Open in IMG/M |
| 3300021168|Ga0210406_11174301 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300021374|Ga0213881_10414542 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300021377|Ga0213874_10273089 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
| 3300021384|Ga0213876_10610990 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300021401|Ga0210393_10122615 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 2078 | Open in IMG/M |
| 3300021401|Ga0210393_10734865 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
| 3300021401|Ga0210393_10851481 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
| 3300021402|Ga0210385_10970979 | Not Available | 653 | Open in IMG/M |
| 3300021404|Ga0210389_10520659 | All Organisms → cellular organisms → Bacteria | 935 | Open in IMG/M |
| 3300021405|Ga0210387_11653946 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300021407|Ga0210383_10032868 | All Organisms → cellular organisms → Bacteria | 4336 | Open in IMG/M |
| 3300021420|Ga0210394_11389317 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300021444|Ga0213878_10041372 | All Organisms → cellular organisms → Bacteria | 1778 | Open in IMG/M |
| 3300021444|Ga0213878_10434493 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300021475|Ga0210392_11003026 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300021476|Ga0187846_10010189 | All Organisms → cellular organisms → Bacteria | 4546 | Open in IMG/M |
| 3300021476|Ga0187846_10267413 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
| 3300021477|Ga0210398_10447488 | All Organisms → cellular organisms → Bacteria | 1053 | Open in IMG/M |
| 3300021478|Ga0210402_10972917 | All Organisms → cellular organisms → Bacteria | 775 | Open in IMG/M |
| 3300021479|Ga0210410_10208270 | All Organisms → cellular organisms → Bacteria | 1752 | Open in IMG/M |
| 3300021559|Ga0210409_10149039 | All Organisms → cellular organisms → Bacteria | 2143 | Open in IMG/M |
| 3300021560|Ga0126371_10249602 | All Organisms → cellular organisms → Bacteria | 1888 | Open in IMG/M |
| 3300021560|Ga0126371_11246823 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 878 | Open in IMG/M |
| 3300021560|Ga0126371_12504930 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300024220|Ga0224568_1024287 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300024227|Ga0228598_1010005 | All Organisms → cellular organisms → Bacteria | 1892 | Open in IMG/M |
| 3300024227|Ga0228598_1024257 | All Organisms → cellular organisms → Bacteria | 1193 | Open in IMG/M |
| 3300024295|Ga0224556_1160311 | Not Available | 550 | Open in IMG/M |
| 3300025504|Ga0208356_1102566 | Not Available | 541 | Open in IMG/M |
| 3300025612|Ga0208691_1143333 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300025612|Ga0208691_1158917 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300025627|Ga0208220_1160503 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300025703|Ga0208357_1023842 | All Organisms → cellular organisms → Bacteria | 2274 | Open in IMG/M |
| 3300025703|Ga0208357_1164862 | Not Available | 613 | Open in IMG/M |
| 3300025703|Ga0208357_1219719 | Not Available | 501 | Open in IMG/M |
| 3300025862|Ga0209483_1038546 | All Organisms → cellular organisms → Bacteria | 2316 | Open in IMG/M |
| 3300025898|Ga0207692_10216567 | Not Available | 1133 | Open in IMG/M |
| 3300025900|Ga0207710_10119892 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1255 | Open in IMG/M |
| 3300025903|Ga0207680_10975919 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300025906|Ga0207699_10941183 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300025907|Ga0207645_10522003 | Not Available | 805 | Open in IMG/M |
| 3300025912|Ga0207707_10389808 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1197 | Open in IMG/M |
| 3300025923|Ga0207681_11041366 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
| 3300025928|Ga0207700_10353195 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1280 | Open in IMG/M |
| 3300025938|Ga0207704_11589382 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300025944|Ga0207661_10765848 | All Organisms → cellular organisms → Bacteria | 889 | Open in IMG/M |
| 3300026034|Ga0208773_1026449 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 752 | Open in IMG/M |
| 3300026088|Ga0207641_10181871 | All Organisms → cellular organisms → Bacteria | 1926 | Open in IMG/M |
| 3300026217|Ga0209871_1071613 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
| 3300026217|Ga0209871_1100231 | Not Available | 564 | Open in IMG/M |
| 3300026281|Ga0209863_10055950 | All Organisms → cellular organisms → Bacteria | 1170 | Open in IMG/M |
| 3300026320|Ga0209131_1093555 | All Organisms → cellular organisms → Bacteria | 1597 | Open in IMG/M |
| 3300026354|Ga0257180_1035791 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
| 3300026490|Ga0257153_1109289 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300026532|Ga0209160_1248337 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300026551|Ga0209648_10320007 | All Organisms → cellular organisms → Bacteria | 1094 | Open in IMG/M |
| 3300026552|Ga0209577_10055382 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3330 | Open in IMG/M |
| 3300026809|Ga0207820_113236 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300026959|Ga0207852_1031459 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300027014|Ga0207815_1017956 | All Organisms → cellular organisms → Bacteria | 881 | Open in IMG/M |
| 3300027063|Ga0207762_1042374 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
| 3300027109|Ga0208603_1005725 | All Organisms → cellular organisms → Bacteria | 2066 | Open in IMG/M |
| 3300027164|Ga0208994_1010799 | All Organisms → cellular organisms → Bacteria | 1199 | Open in IMG/M |
| 3300027432|Ga0209421_1101773 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300027609|Ga0209221_1166884 | Not Available | 541 | Open in IMG/M |
| 3300027619|Ga0209330_1054706 | All Organisms → cellular organisms → Bacteria | 910 | Open in IMG/M |
| 3300027625|Ga0208044_1114586 | All Organisms → cellular organisms → Bacteria | 773 | Open in IMG/M |
| 3300027667|Ga0209009_1133354 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300027701|Ga0209447_10136281 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300027745|Ga0209908_10141753 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300027745|Ga0209908_10152355 | Not Available | 609 | Open in IMG/M |
| 3300027768|Ga0209772_10016614 | All Organisms → cellular organisms → Bacteria | 2061 | Open in IMG/M |
| 3300027787|Ga0209074_10505799 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300027812|Ga0209656_10381124 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300027826|Ga0209060_10189597 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 949 | Open in IMG/M |
| 3300027840|Ga0209683_10050832 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1813 | Open in IMG/M |
| 3300027853|Ga0209274_10065006 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1754 | Open in IMG/M |
| 3300027853|Ga0209274_10361668 | All Organisms → cellular organisms → Bacteria | 748 | Open in IMG/M |
| 3300027855|Ga0209693_10216498 | All Organisms → cellular organisms → Bacteria | 941 | Open in IMG/M |
| 3300027862|Ga0209701_10614794 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300027867|Ga0209167_10368542 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
| 3300027879|Ga0209169_10063797 | All Organisms → cellular organisms → Bacteria | 1906 | Open in IMG/M |
| 3300027879|Ga0209169_10450830 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
| 3300027886|Ga0209486_10569179 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
| 3300027889|Ga0209380_10366951 | All Organisms → cellular organisms → Bacteria | 845 | Open in IMG/M |
| 3300027889|Ga0209380_10724929 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300027907|Ga0207428_10992572 | Not Available | 590 | Open in IMG/M |
| 3300027958|Ga0209749_1050964 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1326 | Open in IMG/M |
| 3300028736|Ga0302214_1136951 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300028779|Ga0302266_10060305 | All Organisms → cellular organisms → Bacteria | 1654 | Open in IMG/M |
| 3300028866|Ga0302278_10271071 | All Organisms → cellular organisms → Bacteria | 802 | Open in IMG/M |
| 3300028884|Ga0307308_10661858 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300029636|Ga0222749_10514024 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300029883|Ga0311327_10790341 | Not Available | 554 | Open in IMG/M |
| 3300029910|Ga0311369_10320773 | All Organisms → cellular organisms → Bacteria | 1374 | Open in IMG/M |
| 3300029910|Ga0311369_10391201 | All Organisms → cellular organisms → Bacteria | 1210 | Open in IMG/M |
| 3300029914|Ga0311359_10577504 | All Organisms → cellular organisms → Bacteria | 835 | Open in IMG/M |
| 3300029914|Ga0311359_10832699 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300029939|Ga0311328_11094886 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300029944|Ga0311352_10271180 | All Organisms → cellular organisms → Bacteria | 1422 | Open in IMG/M |
| 3300029944|Ga0311352_10960380 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| 3300029945|Ga0311330_10418365 | All Organisms → cellular organisms → Bacteria | 1104 | Open in IMG/M |
| 3300029951|Ga0311371_10655047 | All Organisms → cellular organisms → Bacteria | 1333 | Open in IMG/M |
| 3300029954|Ga0311331_11452595 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300029955|Ga0311342_10786038 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
| 3300029987|Ga0311334_10150202 | All Organisms → cellular organisms → Bacteria | 1755 | Open in IMG/M |
| 3300029993|Ga0302304_10164729 | All Organisms → cellular organisms → Bacteria | 831 | Open in IMG/M |
| 3300029999|Ga0311339_10839529 | All Organisms → cellular organisms → Bacteria | 880 | Open in IMG/M |
| 3300029999|Ga0311339_10979988 | All Organisms → cellular organisms → Bacteria | 794 | Open in IMG/M |
| 3300030002|Ga0311350_10508695 | Not Available | 1082 | Open in IMG/M |
| 3300030007|Ga0311338_10109267 | Not Available | 3410 | Open in IMG/M |
| 3300030007|Ga0311338_10240032 | All Organisms → cellular organisms → Bacteria | 2047 | Open in IMG/M |
| 3300030007|Ga0311338_10558187 | All Organisms → cellular organisms → Bacteria | 1187 | Open in IMG/M |
| 3300030041|Ga0302274_10094369 | All Organisms → cellular organisms → Bacteria | 1628 | Open in IMG/M |
| 3300030053|Ga0302177_10633587 | Not Available | 544 | Open in IMG/M |
| 3300030054|Ga0302182_10045171 | All Organisms → cellular organisms → Bacteria | 2002 | Open in IMG/M |
| 3300030503|Ga0311370_11720804 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 642 | Open in IMG/M |
| 3300030507|Ga0302192_10062876 | All Organisms → cellular organisms → Bacteria | 1842 | Open in IMG/M |
| 3300030520|Ga0311372_12293326 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300030580|Ga0311355_11178278 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
| 3300030617|Ga0311356_11034865 | All Organisms → cellular organisms → Bacteria | 765 | Open in IMG/M |
| 3300030618|Ga0311354_10625202 | All Organisms → cellular organisms → Bacteria | 1042 | Open in IMG/M |
| 3300030619|Ga0268386_10254752 | All Organisms → cellular organisms → Bacteria | 1290 | Open in IMG/M |
| 3300030619|Ga0268386_11029211 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300030815|Ga0265746_1029445 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
| 3300030872|Ga0265723_1001856 | All Organisms → cellular organisms → Bacteria | 965 | Open in IMG/M |
| 3300030906|Ga0302314_10374007 | All Organisms → cellular organisms → Bacteria | 1597 | Open in IMG/M |
| 3300031090|Ga0265760_10131792 | All Organisms → cellular organisms → Bacteria | 809 | Open in IMG/M |
| 3300031090|Ga0265760_10159804 | Not Available | 743 | Open in IMG/M |
| 3300031122|Ga0170822_14961383 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300031233|Ga0302307_10371720 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
| 3300031234|Ga0302325_10376714 | All Organisms → cellular organisms → Bacteria | 2232 | Open in IMG/M |
| 3300031234|Ga0302325_10427594 | All Organisms → cellular organisms → Bacteria | 2046 | Open in IMG/M |
| 3300031234|Ga0302325_10493049 | All Organisms → cellular organisms → Bacteria | 1855 | Open in IMG/M |
| 3300031234|Ga0302325_10839291 | All Organisms → cellular organisms → Bacteria | 1288 | Open in IMG/M |
| 3300031234|Ga0302325_10853716 | All Organisms → cellular organisms → Bacteria | 1274 | Open in IMG/M |
| 3300031234|Ga0302325_11219228 | All Organisms → cellular organisms → Bacteria | 999 | Open in IMG/M |
| 3300031236|Ga0302324_100008012 | All Organisms → cellular organisms → Bacteria | 22365 | Open in IMG/M |
| 3300031236|Ga0302324_101228888 | All Organisms → cellular organisms → Bacteria | 995 | Open in IMG/M |
| 3300031236|Ga0302324_102643626 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300031238|Ga0265332_10337089 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300031249|Ga0265339_10061036 | All Organisms → cellular organisms → Bacteria | 2030 | Open in IMG/M |
| 3300031259|Ga0302187_10083936 | All Organisms → cellular organisms → Bacteria | 1861 | Open in IMG/M |
| 3300031446|Ga0170820_15399901 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300031524|Ga0302320_11253641 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 754 | Open in IMG/M |
| 3300031524|Ga0302320_11574645 | Not Available | 641 | Open in IMG/M |
| 3300031525|Ga0302326_10798640 | All Organisms → cellular organisms → Bacteria | 1360 | Open in IMG/M |
| 3300031525|Ga0302326_11330423 | All Organisms → cellular organisms → Bacteria | 976 | Open in IMG/M |
| 3300031525|Ga0302326_12574803 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300031525|Ga0302326_13091616 | Not Available | 565 | Open in IMG/M |
| 3300031561|Ga0318528_10536675 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 628 | Open in IMG/M |
| 3300031679|Ga0318561_10066058 | All Organisms → cellular organisms → Bacteria | 1844 | Open in IMG/M |
| 3300031680|Ga0318574_10214863 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1107 | Open in IMG/M |
| 3300031708|Ga0310686_100998033 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300031708|Ga0310686_109208112 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300031708|Ga0310686_109479751 | All Organisms → cellular organisms → Bacteria | 837 | Open in IMG/M |
| 3300031708|Ga0310686_117325950 | Not Available | 504 | Open in IMG/M |
| 3300031708|Ga0310686_118909818 | All Organisms → cellular organisms → Bacteria | 1114 | Open in IMG/M |
| 3300031713|Ga0318496_10623009 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 596 | Open in IMG/M |
| 3300031716|Ga0310813_11296898 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300031718|Ga0307474_10978373 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 670 | Open in IMG/M |
| 3300031718|Ga0307474_11666705 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300031795|Ga0318557_10477570 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 573 | Open in IMG/M |
| 3300031796|Ga0318576_10524733 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300031805|Ga0318497_10424954 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
| 3300031823|Ga0307478_10464583 | All Organisms → cellular organisms → Bacteria | 1053 | Open in IMG/M |
| 3300031846|Ga0318512_10429181 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
| 3300031897|Ga0318520_11115418 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300031918|Ga0311367_12090556 | Not Available | 545 | Open in IMG/M |
| 3300031938|Ga0308175_101001115 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 924 | Open in IMG/M |
| 3300031942|Ga0310916_10286270 | All Organisms → cellular organisms → Bacteria | 1394 | Open in IMG/M |
| 3300031942|Ga0310916_10511345 | All Organisms → cellular organisms → Bacteria | 1023 | Open in IMG/M |
| 3300031962|Ga0307479_11691886 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300032001|Ga0306922_11857203 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300032002|Ga0307416_102122807 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 664 | Open in IMG/M |
| 3300032074|Ga0308173_10159207 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1835 | Open in IMG/M |
| 3300032074|Ga0308173_10995475 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 778 | Open in IMG/M |
| 3300032076|Ga0306924_10249520 | Not Available | 2038 | Open in IMG/M |
| 3300032162|Ga0272424_1090932 | All Organisms → cellular organisms → Bacteria | 1794 | Open in IMG/M |
| 3300032261|Ga0306920_100364265 | All Organisms → cellular organisms → Bacteria | 2150 | Open in IMG/M |
| 3300032261|Ga0306920_102442760 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
| 3300032261|Ga0306920_103226894 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300032261|Ga0306920_103882844 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300032515|Ga0348332_11254813 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300032770|Ga0335085_10316888 | All Organisms → cellular organisms → Bacteria | 1841 | Open in IMG/M |
| 3300032805|Ga0335078_10165818 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3108 | Open in IMG/M |
| 3300032805|Ga0335078_12224710 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300032892|Ga0335081_10138318 | All Organisms → cellular organisms → Bacteria | 3513 | Open in IMG/M |
| 3300032892|Ga0335081_10353859 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1912 | Open in IMG/M |
| 3300032892|Ga0335081_10690386 | All Organisms → cellular organisms → Bacteria | 1240 | Open in IMG/M |
| 3300032892|Ga0335081_11600515 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
| 3300032892|Ga0335081_12669673 | Not Available | 511 | Open in IMG/M |
| 3300032895|Ga0335074_10290277 | All Organisms → cellular organisms → Bacteria | 1880 | Open in IMG/M |
| 3300032898|Ga0335072_11590869 | Not Available | 552 | Open in IMG/M |
| 3300033004|Ga0335084_10216189 | All Organisms → cellular organisms → Bacteria | 1989 | Open in IMG/M |
| 3300033134|Ga0335073_10404452 | All Organisms → cellular organisms → Bacteria | 1595 | Open in IMG/M |
| 3300033179|Ga0307507_10053572 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 3853 | Open in IMG/M |
| 3300033290|Ga0318519_10158067 | All Organisms → cellular organisms → Bacteria | 1271 | Open in IMG/M |
| 3300033402|Ga0326728_10836705 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300033405|Ga0326727_10857270 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300033412|Ga0310810_10247028 | All Organisms → cellular organisms → Bacteria | 1966 | Open in IMG/M |
| 3300033888|Ga0334792_109254 | All Organisms → cellular organisms → Bacteria | 752 | Open in IMG/M |
| 3300034065|Ga0334827_211937 | Not Available | 576 | Open in IMG/M |
| 3300034124|Ga0370483_0065786 | All Organisms → cellular organisms → Bacteria | 1162 | Open in IMG/M |
| 3300034128|Ga0370490_0222149 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300034163|Ga0370515_0234396 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 779 | Open in IMG/M |
| 3300034195|Ga0370501_0023218 | All Organisms → cellular organisms → Bacteria | 1836 | Open in IMG/M |
| 3300034377|Ga0334931_176912 | Not Available | 519 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.47% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 6.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.22% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.60% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.56% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 4.36% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.94% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 2.90% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.70% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.49% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.49% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.49% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 2.28% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.28% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.07% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.66% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.45% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.45% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.45% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.24% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.04% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.04% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.04% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.04% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.83% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.83% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.83% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.83% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.83% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.83% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.83% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.83% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.83% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.83% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.83% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.62% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.62% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.62% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.62% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.62% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.62% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.62% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.62% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.62% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.62% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.62% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.62% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.41% |
| Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 0.41% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.41% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.41% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.41% |
| Thawing Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost | 0.41% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.41% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.41% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.41% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.41% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.41% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.41% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.41% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.41% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.41% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.41% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.41% |
| Host-Associated | Host-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated | 0.41% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 0.21% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.21% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 0.21% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.21% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.21% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.21% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.21% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.21% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.21% |
| Sub-Biocrust Soil | Environmental → Terrestrial → Soil → Unclassified → Desert → Sub-Biocrust Soil | 0.21% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.21% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.21% |
| Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 0.21% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.21% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.21% |
| Rock | Environmental → Terrestrial → Rock-Dwelling (Endoliths) → Unclassified → Unclassified → Rock | 0.21% |
| Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.21% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.21% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.21% |
| Ectomycorrhiza | Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza | 0.21% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.21% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.21% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.21% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.21% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.21% |
| Moss Associated | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Moss Associated | 0.21% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.21% |
| Bioremediated Contaminated Groundwater | Engineered → Bioremediation → Tetrachloroethylene And Derivatives → Tetrachloroethylene → Unclassified → Bioremediated Contaminated Groundwater | 0.21% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459009 | Grass soil microbial communities from Rothamsted Park, UK - July 2009 indirect DNA Tissue lysis 0-10cm | Environmental | Open in IMG/M |
| 2170459017 | Litter degradation ZMR4 | Engineered | Open in IMG/M |
| 3300001471 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 | Environmental | Open in IMG/M |
| 3300001546 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
| 3300003992 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D1 | Environmental | Open in IMG/M |
| 3300003997 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D1 | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005607 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300005952 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 | Environmental | Open in IMG/M |
| 3300005993 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 | Environmental | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006638 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009179 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 | Environmental | Open in IMG/M |
| 3300009400 | Soil microbial community of the Robinson Ridge, Antarctica. Combined Assembly of Gp0139162, Gp0138857, Gp0138858 | Environmental | Open in IMG/M |
| 3300009500 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fc - Sphagnum magellanicum MG | Host-Associated | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009552 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_150 | Environmental | Open in IMG/M |
| 3300009624 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 | Environmental | Open in IMG/M |
| 3300009644 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10 | Environmental | Open in IMG/M |
| 3300009662 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-060 | Environmental | Open in IMG/M |
| 3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
| 3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
| 3300009697 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fd - Sphagnum magellanicum MG | Host-Associated | Open in IMG/M |
| 3300009759 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_10 | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300011998 | Permafrost microbial communities from Nunavut, Canada - A30_35cm_6M | Environmental | Open in IMG/M |
| 3300012044 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ852 (21.06) | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012672 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT266_2 | Environmental | Open in IMG/M |
| 3300012899 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2 | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013314 | Moss microbial communities from three moss species from boreal forest in Fairbanks, Alaska, USA Reanalysis | Host-Associated | Open in IMG/M |
| 3300014056 | Permafrost microbial communities from Nunavut, Canada - A20_5cm_0M | Environmental | Open in IMG/M |
| 3300014156 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaG | Environmental | Open in IMG/M |
| 3300014158 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaG | Environmental | Open in IMG/M |
| 3300014159 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaG | Environmental | Open in IMG/M |
| 3300014162 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaG | Environmental | Open in IMG/M |
| 3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
| 3300014167 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaG | Environmental | Open in IMG/M |
| 3300014199 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaG | Environmental | Open in IMG/M |
| 3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014493 | Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaG | Environmental | Open in IMG/M |
| 3300014494 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E3D metaG | Environmental | Open in IMG/M |
| 3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014654 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG | Environmental | Open in IMG/M |
| 3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
| 3300015051 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015069 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G4C, Ice margin, adjacent to proglacial lake | Environmental | Open in IMG/M |
| 3300015158 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G1A, Ice margin) | Environmental | Open in IMG/M |
| 3300015190 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-4a, rock/ice/stream interface) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Host-Associated | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
| 3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
| 3300017941 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_150 | Environmental | Open in IMG/M |
| 3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300017988 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaG | Environmental | Open in IMG/M |
| 3300018002 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_40 | Environmental | Open in IMG/M |
| 3300018008 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_40 | Environmental | Open in IMG/M |
| 3300018016 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_40 | Environmental | Open in IMG/M |
| 3300018022 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40 | Environmental | Open in IMG/M |
| 3300018023 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_100 | Environmental | Open in IMG/M |
| 3300018026 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100 | Environmental | Open in IMG/M |
| 3300018033 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
| 3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
| 3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
| 3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
| 3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
| 3300018046 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10 | Environmental | Open in IMG/M |
| 3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
| 3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
| 3300019787 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020012 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s1 | Environmental | Open in IMG/M |
| 3300020021 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1 | Environmental | Open in IMG/M |
| 3300020061 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c1 | Environmental | Open in IMG/M |
| 3300020152 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S1+v_10-13C | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021090 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_b1 redo | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021374 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08 | Environmental | Open in IMG/M |
| 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Host-Associated | Open in IMG/M |
| 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Host-Associated | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021444 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R02 | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300024220 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLU5 | Environmental | Open in IMG/M |
| 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Host-Associated | Open in IMG/M |
| 3300024295 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 1-5 | Environmental | Open in IMG/M |
| 3300025504 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-1 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025612 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025627 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-1 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025703 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F52-2 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025862 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A (SPAdes) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026034 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_0N_302 (SPAdes) | Environmental | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026217 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 (SPAdes) | Environmental | Open in IMG/M |
| 3300026281 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 (SPAdes) | Environmental | Open in IMG/M |
| 3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026354 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-04-B | Environmental | Open in IMG/M |
| 3300026490 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-A | Environmental | Open in IMG/M |
| 3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300026809 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 47 (SPAdes) | Environmental | Open in IMG/M |
| 3300026959 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027014 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027063 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 37 (SPAdes) | Environmental | Open in IMG/M |
| 3300027109 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF008 (SPAdes) | Environmental | Open in IMG/M |
| 3300027164 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027432 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027609 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027619 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027625 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027667 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027701 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027745 | Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 812P2M | Environmental | Open in IMG/M |
| 3300027768 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027840 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027958 | Bioremediated contaminated groundwater from EPA Superfund site, New Mexico - Sample SAE3-47 (SPAdes) | Engineered | Open in IMG/M |
| 3300028736 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_N1_3 | Environmental | Open in IMG/M |
| 3300028779 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E1_2 | Environmental | Open in IMG/M |
| 3300028866 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N3_2 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029883 | I_Bog_E2 coassembly | Environmental | Open in IMG/M |
| 3300029910 | III_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300029914 | III_Bog_E2 coassembly | Environmental | Open in IMG/M |
| 3300029939 | I_Bog_E3 coassembly | Environmental | Open in IMG/M |
| 3300029944 | II_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300029945 | I_Bog_N2 coassembly | Environmental | Open in IMG/M |
| 3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300029954 | I_Bog_N3 coassembly | Environmental | Open in IMG/M |
| 3300029955 | II_Bog_E2 coassembly | Environmental | Open in IMG/M |
| 3300029987 | I_Fen_E3 coassembly | Environmental | Open in IMG/M |
| 3300029993 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_2 | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030002 | II_Fen_N1 coassembly | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030041 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_1 | Environmental | Open in IMG/M |
| 3300030053 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300030054 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_1 | Environmental | Open in IMG/M |
| 3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030507 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E3_2 | Environmental | Open in IMG/M |
| 3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030619 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (Novaseq) | Environmental | Open in IMG/M |
| 3300030815 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSU2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030872 | Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLI5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030906 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_3 | Environmental | Open in IMG/M |
| 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031122 | Oak Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031233 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Host-Associated | Open in IMG/M |
| 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Host-Associated | Open in IMG/M |
| 3300031259 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E1_3 | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031524 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3 | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031918 | III_Fen_N3 coassembly | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032162 | Rock endolithic microbial communities from Victoria Land, Antarctica - Pudding Butte nord | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Host-Associated | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| 3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
| 3300033405 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MY | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033888 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-3-X1 | Environmental | Open in IMG/M |
| 3300034065 | Peat soil microbial communities from Stordalen Mire, Sweden - 714 S1 1-5 | Environmental | Open in IMG/M |
| 3300034124 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_06D_14 | Environmental | Open in IMG/M |
| 3300034128 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_06D_16 | Environmental | Open in IMG/M |
| 3300034163 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14 | Environmental | Open in IMG/M |
| 3300034195 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_fen_01D_17 | Environmental | Open in IMG/M |
| 3300034377 | Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 27HNS | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| F47_09127100 | 2170459009 | Grass Soil | EEGTYAMPFGDEPERRREITAQELGALLSGIDLSQAKRRKRYHRKSTEAL |
| 4ZMR_00952600 | 2170459017 | Switchgrass, Maize And Mischanthus Litter | MPFGKREERRAEITAQELSALLSGIDLSQAKRRKRYERKGVSAG |
| JGI12712J15308_100036645 | 3300001471 | Forest Soil | MPFGEEPERRREITAQELGALLSGIDLSQAKRRKRYHRKCVEAS* |
| JGI12659J15293_100260192 | 3300001546 | Forest Soil | YAMPFGGSDVIAAEKRHEITGAELGALLSGIDLSHAKRRKRYVRQVSEAV* |
| JGI12053J15887_105822952 | 3300001661 | Forest Soil | YAMPLGDAPEKRREITAAELGAILSGIDLSDAKRRKRYQRNISAAA* |
| JGIcombinedJ26739_1001722921 | 3300002245 | Forest Soil | LEEGTYAMPFGEEPERRREITAQELGALLSGIDLSQAKRRKRYHRKCVEAS* |
| JGIcombinedJ26739_1002101132 | 3300002245 | Forest Soil | EEGTYAMPFDDDGEKRREITAQELGAILSGIDLSQAKRRKRYQRKTTGEL* |
| JGIcombinedJ26739_1009052241 | 3300002245 | Forest Soil | MPFSDSGEVRREITAQELGALLSGIDLSQAKRRKRYCRNASEGA* |
| C688J35102_1186740552 | 3300002568 | Soil | EEDEAQREITAQELGALLSGIDLSQAKRRKRYQRKSAEAA* |
| JGI25617J43924_101791043 | 3300002914 | Grasslands Soil | EDEPQREITAQELGALLSGIDLSAAKRRKRYQRKSVEAA* |
| Ga0055470_101391222 | 3300003992 | Natural And Restored Wetlands | TYAVPFGDGGAERQREITAQELAALLSGIDLQRATRRKRYQRSV* |
| Ga0055466_102238561 | 3300003997 | Natural And Restored Wetlands | LEEGTYAVPFGDGGAERQREITAQELAALLSGIDLQRATRRKRYQRSV* |
| Ga0062385_112924141 | 3300004080 | Bog Forest Soil | LEEGTYAMPFGDSGVIHGEKRREVTAAELGALLSGIDLSQAKRRKRYSRNIAEAA* |
| Ga0063454_1007770222 | 3300004081 | Soil | MPFGSGDEQRAEITSQELSALLSGIDLSRAKRRKRYRLNSLEDA* |
| Ga0062384_1013564222 | 3300004082 | Bog Forest Soil | RLEEGTYAMPFGDPDSTGGEKRHEITAAELGALLSGIDLSHAKRRKRYIRKVSEVL* |
| Ga0062389_1024541572 | 3300004092 | Bog Forest Soil | YAMPFGEERERRREITAQELGALLSGIDLSQAKRRKRYRRKGPEAS* |
| Ga0062386_1018388101 | 3300004152 | Bog Forest Soil | FGDSGLIEGEKRREITAAELGALLSGIDLSQAKRRKRYRRSIAEAA* |
| Ga0062589_1018173751 | 3300004156 | Soil | AIPFTEEDGEQRRCEITAQELGAILSGIDLSQASRRKRYQRASGEGG* |
| Ga0062592_1011855371 | 3300004480 | Soil | KRLEEGRYPVPFGAGDTERRREITVQELGALLSGIDLSTAKRRKRYQRDSI* |
| Ga0066672_109561802 | 3300005167 | Soil | DSAEERRREITAQELGALLSGIDLNQATRRKRYHQSVQQSE* |
| Ga0066683_100904772 | 3300005172 | Soil | LEEGTYAVPLAESAEERRREITAQELGALLSGIDLQHATRRKRYQRTA* |
| Ga0066678_109516941 | 3300005181 | Soil | EEGTYAMPFSSENEHRREITTQELGALLSGIDLSQAKRRKRYRRSIAEAA* |
| Ga0070658_105807702 | 3300005327 | Corn Rhizosphere | MPFGDSAEKRREITAAELGALLSGIDLSHAKRRKRYVRQTIATA* |
| Ga0070676_114260041 | 3300005328 | Miscanthus Rhizosphere | PVPFGAGDTERRREITVQELGALLSGIDLSTAKRRKRYQRDSI* |
| Ga0066388_1003568401 | 3300005332 | Tropical Forest Soil | LEEGTYAVPFAESAEQRRREITAQELGALLSGIDLNQAQRRKRYQRSA* |
| Ga0066388_1004643201 | 3300005332 | Tropical Forest Soil | GTYAVPLAESADERRREITAQELAALLSGIDLSTATRRKRYQHPNS* |
| Ga0066388_1031899982 | 3300005332 | Tropical Forest Soil | MGTYAIPFGDGSKERRREITAQELGALLSGIDLKQATRRKRYQRSV* |
| Ga0066388_1034782311 | 3300005332 | Tropical Forest Soil | MPFSESGEVRREITAQELGALLSSIDLSQAKRRKRYGRKAAEGA* |
| Ga0070666_111666142 | 3300005335 | Switchgrass Rhizosphere | TYAIPFTEEDGEQRRCEITAQELGAILSGIDLSQASRRKRYQRASAEPG* |
| Ga0070682_1014144301 | 3300005337 | Corn Rhizosphere | SKRLEAGTYAIPAAEGPQERRREITAQEFGALLSGIDLSQARRRKRYERKSAHAA* |
| Ga0070675_1011179801 | 3300005354 | Miscanthus Rhizosphere | LEEGTYAVPFGDGAERRREITAQELGALLSGIDLSTAKRRKRYRRASS* |
| Ga0070688_1005237121 | 3300005365 | Switchgrass Rhizosphere | LEEGTYGVPFEDGARERQREITAQELGALLSGIDLSTAKRRKRYR |
| Ga0070688_1007218092 | 3300005365 | Switchgrass Rhizosphere | VPYGESVQERRREITAQELGALLSGIDLKQATRRKRYRRSE* |
| Ga0070688_1013639722 | 3300005365 | Switchgrass Rhizosphere | TYAVPFEDGAGERQREITAQELGALLSGIDLSTAKRRKRYRCAGS* |
| Ga0070659_1004034982 | 3300005366 | Corn Rhizosphere | LEEGTYAVPFSDNAAERRQEITAQELGALLSGIDLSQAKRRKRYQR* |
| Ga0070709_104745262 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | FGDGVAERRREISAQELGALLSGIDVSAATRRKRYQRANQ* |
| Ga0070709_107060952 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | YAMPLADNAGEHRREITAQELGALLSGIDLSQARRRKRYQRPASPA* |
| Ga0070710_113095362 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | GTYAVPFGDNPEEHRREITAQELGALLSGIDLKQATRRKRYQRSV* |
| Ga0070705_1002887022 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | LSYKRLEEGRYPVPFGAGDTERRREITVQELGALLSGIDLSTAKRRKRYQRDSI* |
| Ga0070708_1002005092 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MPFDQGSEVRSEISAQELGALLSGIDLSQAKRRKRYQRKSAEAA* |
| Ga0070681_104805602 | 3300005458 | Corn Rhizosphere | MPFGDSAEKRREITAAELGALLSGIDLSHAKRRKRYVRQTIATS* |
| Ga0068867_1007775711 | 3300005459 | Miscanthus Rhizosphere | GRYPVPFGAGDTERRREITVQELGALLSGIDLSTAKRRKRYQRDSI* |
| Ga0070685_112847072 | 3300005466 | Switchgrass Rhizosphere | VWSKRLEEGRYPVPFGAGDTERRREITVQELGALLSGIDLSTAKRRKRYQRDSI* |
| Ga0070707_1008415861 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | FAESAEERRREITAQELGALLSGIDLNQAQRRKRYQRSA* |
| Ga0070698_1004300302 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | GTYAVPLAESAEERRREITAQELGALLSGIDLQHATRRKRYQRTA* |
| Ga0070733_101382131 | 3300005541 | Surface Soil | GDGGAERRREITAQELGARLSGIDLSTAKRRKRYRRVGV* |
| Ga0070733_103877832 | 3300005541 | Surface Soil | AVPFADGGTECRREITVQELGALLSGIDLSAATRRKRYRRATE* |
| Ga0070696_1002707131 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | KRLEEGTYAMPSAADAMERRREITTQELAALLSGIDLQQASRRKRYRR* |
| Ga0070665_1005110881 | 3300005548 | Switchgrass Rhizosphere | MRREISVQELGALLSGIDLSQAKRRKRYHGKRTEAA* |
| Ga0070704_1008150692 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | GTYAVPFGDSAKERRREITAQELGALLSGIDLKQATRRKRYKQSIE* |
| Ga0066707_105849442 | 3300005556 | Soil | EGTYAMPFSESGEVQCEITAAELAALLSGIDLSRAKRRKRYRRKAAEGV* |
| Ga0068854_1007839873 | 3300005578 | Corn Rhizosphere | LSYKRLEEGRYPVPFGAGDTERRREITVQELGALLSGIDLSTAKRRKRYQR |
| Ga0066654_101242692 | 3300005587 | Soil | VPFGDGEESRREISAQELAAILSGIDLQQATRRKRYQRSK* |
| Ga0066654_102727111 | 3300005587 | Soil | AIPGEERPDERRREITAQELSAILSGIDLEHAARRKRYQRPI* |
| Ga0070761_100763972 | 3300005591 | Soil | EEGTYVMPLGEDDQEHRKEITVQELGALLSGIDLQQATARKRYRRAT* |
| Ga0070762_107787201 | 3300005602 | Soil | EGTYEVPFSDGAEERRREITAQELGALLSGIDLKQATRRKRYRRSD* |
| Ga0070762_109068201 | 3300005602 | Soil | EDQPRREITAQELGALLSGIDLSVARRRKRYQRKSAEAA* |
| Ga0070740_101437701 | 3300005607 | Surface Soil | GTYAVPFGDGAEHRREITAQELGALLSGIDLSTAKRRKRYRRADS* |
| Ga0070763_101928481 | 3300005610 | Soil | YAVPFGKGDEPSYEITAQELGALLSGIDLSVARRQKRYQRKCTGAA* |
| Ga0070764_101855572 | 3300005712 | Soil | FGEGCAERQREITAQELGALLSGIDLSTAKRRKRYRRKGA* |
| Ga0070764_109264711 | 3300005712 | Soil | LEEGTYAIPSAADATERRREITTQELAALLSGIDLQQASRRKRYRR* |
| Ga0066903_1005870134 | 3300005764 | Tropical Forest Soil | MPFSASGEVRREITAQELGASLSGIDLSQARRRKRNRRHVIEDA* |
| Ga0066903_1008470122 | 3300005764 | Tropical Forest Soil | LEEGTYAVPLAESGEERRREITAQELGALLSGIDLNQARRRKRYQRTA* |
| Ga0068863_1008158352 | 3300005841 | Switchgrass Rhizosphere | LEDGTYGVPFEDGARERQREITAQELGALLSGIDLSTAKRRKRYRRADA* |
| Ga0068862_1009225331 | 3300005844 | Switchgrass Rhizosphere | SYKRLEEGRYPVPFGAGDTERRREITVQELGALLSGIDLSTAKRRKRYQRDSI* |
| Ga0070766_106688211 | 3300005921 | Soil | RLEEGAYAMPLADSAGEYRREITAQELGAMLIGIDLSQATQRKRYQRPANPS* |
| Ga0070766_106886482 | 3300005921 | Soil | RLEEGTYAMPLVDSAGEHRREITAQELGALLSGIDLSQARRRKRYQRPSIPA* |
| Ga0070766_107065521 | 3300005921 | Soil | YAMPFTEDDQQRREITAQELGALLSGIDLSVARRRKRYQRRSAEAA* |
| Ga0080026_100274752 | 3300005952 | Permafrost Soil | SGVMEGEKRREITAAELGALLSGIDLSQAKRRKRYQRRIVEAG* |
| Ga0080027_100766103 | 3300005993 | Prmafrost Soil | MPFGDAGVSGEKRREITAAELGAILSGIDLSDAKRRKRYRR |
| Ga0075024_1005767471 | 3300006047 | Watersheds | LEEGTYAMPFGEEGDSQREITAQELGALLSGIDLSTAKRRKRYRRGSEEAA* |
| Ga0075015_1007971011 | 3300006102 | Watersheds | GEVRQEITAQELGALLSGIDLRQAKRRKRYRRTVSEAA* |
| Ga0075030_1013914231 | 3300006162 | Watersheds | LEEGTYAVPFGDGGTERRREITAQELGALLSGIDLSTAKRRKRYRREGI* |
| Ga0070712_1005782602 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | AMPLADNAGEHRREITAQELGAVLSGIDLSQARRRKRYQRPASPA* |
| Ga0070765_1006563092 | 3300006176 | Soil | KRLEEGSYAMPLAESQGERRREITAQELGALLSGIDLKQATRRKRYQRPA* |
| Ga0070765_1018399352 | 3300006176 | Soil | AESAEEHRREITAQELGALLSGIDLSQAKRRKRYERPQ* |
| Ga0070765_1018624951 | 3300006176 | Soil | EEGTYAMPFGEEPERRREITAQELGALLSGIDLSQAKRRKRYHRKCVEAS* |
| Ga0068871_1013770581 | 3300006358 | Miscanthus Rhizosphere | LEEGTYAVPFGDGGPERRREITAQELGALLSGIDLSTAKRRKRYRREGV* |
| Ga0075522_100541621 | 3300006638 | Arctic Peat Soil | TGGEKRHEITAAELAALLSGIDLSHAKRRKRYIRQASEAL* |
| Ga0079222_102052761 | 3300006755 | Agricultural Soil | SKRLEEGTYAIPFGDGAAERRREITAQELGALLSGIDLGAATRRKRYRRADQ* |
| Ga0066665_103059131 | 3300006796 | Soil | KRLEKGTYAVPLGDSAEERRREITAQELGALLSGIDLNQATRRKRYHQSVQQSE* |
| Ga0066665_116110921 | 3300006796 | Soil | KRLEEGTYAVPFGDGNEERRREITAQELGALLSGIDLKQATRRKRYRRSVQ* |
| Ga0066659_115343892 | 3300006797 | Soil | GEMRREISAQELGALLSGIDLSQAKRRKRYQHKSTEAA* |
| Ga0079221_104439501 | 3300006804 | Agricultural Soil | YAVPLADSADEHRREITAQELAALLSGIDLSTARRRKRYRRKDA* |
| Ga0075430_1016243781 | 3300006846 | Populus Rhizosphere | LEEGTYAIPFGDGAAERRREMTVQELGALLSGIDLSTATRRKRYRRVGA* |
| Ga0075433_101953312 | 3300006852 | Populus Rhizosphere | YAMPFGGEDEHRREITAQELGALLSGIDLSVAKRRKRYQRKSSEAA* |
| Ga0073928_100916364 | 3300006893 | Iron-Sulfur Acid Spring | LAASTEERRREITAQELGALLSGIDLKQAKRRKRYQRSA* |
| Ga0075426_101324651 | 3300006903 | Populus Rhizosphere | PFGGEDEHRREITAQELGALLSGIDLSVAKRRKRYQRKSSEAA* |
| Ga0075436_1012765261 | 3300006914 | Populus Rhizosphere | SGERRREITAQELGALLSGIDLSQAKRRKRYQRSITEAA* |
| Ga0079219_108257161 | 3300006954 | Agricultural Soil | AVPFGGASEERRREITAQELAALLSGIDLERATRRKRYRRST* |
| Ga0099791_103970492 | 3300007255 | Vadose Zone Soil | AVPFAESAEERRREITAQELGALLSGIDLNQAQRRKRYQRSA* |
| Ga0099791_105692612 | 3300007255 | Vadose Zone Soil | AMPFEEGEQPRREITAQELGALLSGIDLSQAKRRKRYQRRITEAA* |
| Ga0099795_101053641 | 3300007788 | Vadose Zone Soil | GDGAEERRREITAQELGALLSGIDLKQATRRKRYRRSV* |
| Ga0099795_106402281 | 3300007788 | Vadose Zone Soil | REITAQELGALLSGIDLSTAKRRQRYRRKSVEAA* |
| Ga0099829_111668412 | 3300009038 | Vadose Zone Soil | DEPERRREITVQELGALLSGIDLSQAKRRKRYQRKSAGT* |
| Ga0099830_107217443 | 3300009088 | Vadose Zone Soil | YAMPFSECGEVRREITAQELGALLSGIDLRVAKRRKRYQRKRAEAA* |
| Ga0099828_101857172 | 3300009089 | Vadose Zone Soil | YAVPFGDGGAERRQEITAQELGALLSGIDLSTAKRRKRHRRAGA* |
| Ga0099827_101015925 | 3300009090 | Vadose Zone Soil | MPFDDSEQRRREITAQELGALLSGIDLHQARRRRRYRRSI |
| Ga0099827_104489921 | 3300009090 | Vadose Zone Soil | RLEEGTYAVPFGDGGAERRQEITAQELGALLSGIDLSTAKRRKRHRRAGA* |
| Ga0105247_106265682 | 3300009101 | Switchgrass Rhizosphere | EAGEVRREITAQELGALLSGIDLSQAQRRKRYQRKVIQDA* |
| Ga0105247_112615321 | 3300009101 | Switchgrass Rhizosphere | KRLEEGTYALPFGESAEERRREITAQEFGALLSGIDLEQATRRKRYRRSE* |
| Ga0105243_107355072 | 3300009148 | Miscanthus Rhizosphere | VPFGDSEAERRREVTVQELGALLSGIDLSTAKRRKRYQRDGI* |
| Ga0105241_104359651 | 3300009174 | Corn Rhizosphere | MPFGDSSEERRQEITMQELGALLSGIDLTQATRRQRYRRSV* |
| Ga0105241_123388731 | 3300009174 | Corn Rhizosphere | KRLEEGTYAVPFGDSAQERRREITAQELGALLSGIDLKQATRRKRYPQSIS* |
| Ga0105248_128950572 | 3300009177 | Switchgrass Rhizosphere | SKRLEQGTYAVPFGDGGEECRREITAQELGAILSGIDLDQATRRKRYRRTE* |
| Ga0115028_118775032 | 3300009179 | Wetland | SKRLEEGTYAMPFGDGGAERRREITAQELAALLSGIDLQRATRRKRYQRSA* |
| Ga0116854_10058631 | 3300009400 | Soil | RREITAAELGALLSGIDLSQAKRRKRYRRGIAAAA* |
| Ga0116229_108931141 | 3300009500 | Host-Associated | EGTYAMPFSESDEIRREITAQELGALLSGIDLNQAKRRRRYRHKAVEAA* |
| Ga0116222_14613391 | 3300009521 | Peatlands Soil | GTYAVPFGDSAEERRREITVQELGALLSGIDLSQAKRRKRYQRTE* |
| Ga0105238_125239891 | 3300009551 | Corn Rhizosphere | YAIPFGDGAAERRREISAQELGALLSGIDLTAATRRKRYRRENQ* |
| Ga0116138_10996581 | 3300009552 | Peatland | GTYAVPFGEGGAERRREITAQELGALLSGIDLSTAKRRKRYRRESV* |
| Ga0116105_10464872 | 3300009624 | Peatland | YAMPFDDGGEKRREITAQELGAILSGIDLSQAKRRKRYQRKTAGNL* |
| Ga0116105_12158472 | 3300009624 | Peatland | EEGTYVMPFGDEPERRREITAQELGALLSGIDLSQAKRRKRYQRRGAETS* |
| Ga0116121_10174424 | 3300009644 | Peatland | VVQGTYAIPAADATENRREITTQELSALLSGIDLQQASRRKRYGR* |
| Ga0105856_13111742 | 3300009662 | Permafrost Soil | AEKRHEITAAELGALLSGIDLSYAKRRKRYVRQVSEAL* |
| Ga0116135_13218601 | 3300009665 | Peatland | MTQGTYAMPLGDGAAERRREITTQELAALLSGIDLQKAARRKRY* |
| Ga0116224_102567591 | 3300009683 | Peatlands Soil | EPRREITAQELGALLSGIDLSVAKRRKRYRRKNAEAA* |
| Ga0116231_104842952 | 3300009697 | Host-Associated | ENSEGRCEISAQELGALLSGIDLSQAKRRKRYRHKPSEAV* |
| Ga0116101_10098621 | 3300009759 | Peatland | RLEEGTYAMPFGDTAEKRREITAAELGALLSGIDLSQAMRRKRYGRHIAAAA* |
| Ga0116219_105228451 | 3300009824 | Peatlands Soil | LEEGTYAAPFAGEAGEKRREITAQELGALLSGIDLDRAEKRKRYQRPS* |
| Ga0126311_115427872 | 3300010045 | Serpentine Soil | KRLEEGTYAVPLGDGGAERRREITAQELGALLSGIDLSTAKRHKRYRRAEM* |
| Ga0126382_110963591 | 3300010047 | Tropical Forest Soil | LERGADGPQDTAVPFGDGGADRQREITAQELGALLSGIDLSTARRRKRYRRNGA* |
| Ga0126373_102032993 | 3300010048 | Tropical Forest Soil | EGTYAMPFDDSGEQRREITAQELGALLSGIDLSRAKRRKRYQRTIETVA* |
| Ga0126373_104435712 | 3300010048 | Tropical Forest Soil | MPFDDGGEQRREITAQELGALLSGIDLSQAKRRKRYQRDIAAVV* |
| Ga0126373_120184692 | 3300010048 | Tropical Forest Soil | APFAGEAGERRREITAQELGALLSGIDLDRAEKRRRYQRPS* |
| Ga0134086_104307041 | 3300010323 | Grasslands Soil | YAVPLDESAEERRREITAQELGALLSGIDLEHATPRRRYRRSA* |
| Ga0134080_104695171 | 3300010333 | Grasslands Soil | TYAVPLAESAEERRREITAQELGALLSGIDLQHATRRKRYQRSA* |
| Ga0134071_106908712 | 3300010336 | Grasslands Soil | MPFAEDGERRREITAAELGALLSGIDLSEAKRRKRYRRMIAPAA* |
| Ga0074045_109823172 | 3300010341 | Bog Forest Soil | FAEEDEARREITAQELGALLSGIDLSTAKRRKRYRRRSVEAA* |
| Ga0074044_106151552 | 3300010343 | Bog Forest Soil | AGQRRREITAQELGALLSGIDLSQAKRRKRYARKRVEAA* |
| Ga0126370_100259813 | 3300010358 | Tropical Forest Soil | LEQGTYAVPLAESTAEKQRKMTAQELGALLSGIDLQHAIRRKRYQRTA* |
| Ga0126370_126730181 | 3300010358 | Tropical Forest Soil | GTYAVPLANSADEHRREITAQELGALLSGIDLSQAQRRKRYRRAGA* |
| Ga0126376_100205874 | 3300010359 | Tropical Forest Soil | PFEEAGQRRREITAAGVGRALLSGIDLSQAQRRKRNARNRVGAP* |
| Ga0126376_117447232 | 3300010359 | Tropical Forest Soil | GTYAVPFADSPEERRREITAQELAALLRGIDLSQAQRRKRYQRPT* |
| Ga0126376_123124332 | 3300010359 | Tropical Forest Soil | VRREITAQELGVLLSGIDLSQAKRRKRYQRTAGEGA* |
| Ga0126376_123769501 | 3300010359 | Tropical Forest Soil | KRLEEGTYAVPFGDAGGERRREITAQELGALLSGIDLSTAKRRKRYRRGDV* |
| Ga0126377_133750692 | 3300010362 | Tropical Forest Soil | MPLGEGEQGCEVTEQELGALLSGIDLSRAERRRRYSKKPAATP* |
| Ga0126379_101144025 | 3300010366 | Tropical Forest Soil | MPFEEAGQRRREITAAGVGRALLSGIDLSQAQRWKRYARNRVGAA* |
| Ga0126379_108234462 | 3300010366 | Tropical Forest Soil | ADSPEERRREITAQELAALLSGIDLSQAQRRKRYQRPT* |
| Ga0126379_116845072 | 3300010366 | Tropical Forest Soil | AVPFDDDGVERRREITAQELGAVLSGIDLSRAKRRKRYRRTEA* |
| Ga0105239_122223142 | 3300010375 | Corn Rhizosphere | YALPSGEAEERRREITAQELGALLSGIDLTQAERRKRYRRSV* |
| Ga0126381_1008625001 | 3300010376 | Tropical Forest Soil | AVPLGDSTDEHRREITAQELGALLSGIDLSQAKRRKRYQRFA* |
| Ga0126381_1016474482 | 3300010376 | Tropical Forest Soil | VPFDDGAERRREITAQELGALLSGIDLSTAKRRKRYRRGSV* |
| Ga0126381_1038972651 | 3300010376 | Tropical Forest Soil | TYAMPFSESGEVRREITAQELGALLSSIDLSQAKRRKRYGRKAAEGA* |
| Ga0136449_1009330153 | 3300010379 | Peatlands Soil | GEAGEKRREITAQELGALLSGIDLDRAEKRKRYQRPS* |
| Ga0136449_1022230762 | 3300010379 | Peatlands Soil | FAGEAGEKRREITAQELGALLSGIDLDRAEKRKRYQKRS* |
| Ga0134126_109481061 | 3300010396 | Terrestrial Soil | MPFAQSGEMRREISVQELGALLSEIDLSQAKRRKRYHGKRTEAA* |
| Ga0134126_130711322 | 3300010396 | Terrestrial Soil | FGDTGVTQGEKRREITAAELGALLSGIDLSHAKRRKRYRRGIGEAA* |
| Ga0126383_111072861 | 3300010398 | Tropical Forest Soil | EDGARERQREITAQELGALLSGIDLSVAKRRKRYRSAS* |
| Ga0134121_119699801 | 3300010401 | Terrestrial Soil | GTYAIPAAEGPQERRREITAQEFGALLSGIDLSQARRRKRYERKSAHAA* |
| Ga0134123_118843591 | 3300010403 | Terrestrial Soil | SELSYKRLEEGRYPVPFGAGDTERRREITVQELGALLSGIDLSTAKRRKRYQRDSI* |
| Ga0137392_101638442 | 3300011269 | Vadose Zone Soil | PFDKVAGSNDEARREITAQELGALLSGIDLSQAKRRKRYRRKSVEAA* |
| Ga0137392_104665861 | 3300011269 | Vadose Zone Soil | MPFEEADQPRREITAQELGAQLSGIDLSVAKRRKRYRRKSAEAA* |
| Ga0137393_110090922 | 3300011271 | Vadose Zone Soil | REITAQELGALLSGIDLSTARRRKRYQRKSAAAA* |
| Ga0120114_10952451 | 3300011998 | Permafrost | MPFGDEDDSRREITAQELGALLSGIDLSTAKRRKRYRRKSAEAA |
| Ga0136636_102685691 | 3300012044 | Polar Desert Sand | KRLEAGTYAMPFGEPGVSPRREITPPELAALLSGIDLQHTTRRKRYTRKST* |
| Ga0137389_105588362 | 3300012096 | Vadose Zone Soil | EGTYPMPFGRDQETRREITAQELGALLSRIDLSVAKRRKRYQRKSVEAA* |
| Ga0137365_112361181 | 3300012201 | Vadose Zone Soil | GDEPRREITAQELGALLSGIDLSVAKRRKRYRRKSAEAA* |
| Ga0137363_114066741 | 3300012202 | Vadose Zone Soil | IEEGTYALPFESSGERRRQITAQELGAVLSGIDLSQAKRRKRYQRSITEAA* |
| Ga0137363_114625491 | 3300012202 | Vadose Zone Soil | ESQREITAQELGALLSGIDLSVAKRRKRYRRKSAEAA* |
| Ga0137362_112568681 | 3300012205 | Vadose Zone Soil | TYAMPFGAEDETRREITAQELGALLSGIDLSTAKRRKRYRRKSVEAA* |
| Ga0137362_116457571 | 3300012205 | Vadose Zone Soil | AVWSKRLEEGIYAVPFGESAEERRREITAQELGALLSGIDLKQATRRKRYRRSD* |
| Ga0137378_110241812 | 3300012210 | Vadose Zone Soil | EPRREITAQELGALLSGIDLSVAKRRKRYQRKSVEAA* |
| Ga0137378_110314601 | 3300012210 | Vadose Zone Soil | LEEGTYAMPLADSAGEHRREITAQELGALVSGIDLSQARRRKRYQRPANPS* |
| Ga0137378_112805732 | 3300012210 | Vadose Zone Soil | VPFGDGDEERRREITAQELGALLSGIDLQQAPRRKRYRRSV* |
| Ga0137378_113470751 | 3300012210 | Vadose Zone Soil | SICPDSSEVRREITEAELGALSSGIDLSQAQRRKRYRRTASEHA* |
| Ga0137384_100695713 | 3300012357 | Vadose Zone Soil | LEQGTYAVPLAESAEERRREITAQELGALLSGIDLQHATRRKRYQRTA* |
| Ga0137384_107302471 | 3300012357 | Vadose Zone Soil | VPLAGSPEERRREITAQELGALLSGIDLEQAKRRKRYQRSA* |
| Ga0137384_107808941 | 3300012357 | Vadose Zone Soil | EPRREITAQELGALLSGIDLSVAKRRKRYRHKSAEAP* |
| Ga0137385_116327762 | 3300012359 | Vadose Zone Soil | AGEHRREITAQELGALLSGIDLSQARRRKRYQRPASPA* |
| Ga0137375_111265872 | 3300012360 | Vadose Zone Soil | MPFEEAGQRRREITAQELGALLSGIDLRQAQRRKRYARKRVEAA* |
| Ga0150984_1103547372 | 3300012469 | Avena Fatua Rhizosphere | GTYAVPFDEGEGQRREITAPELAAILSGIDLQQAARRRRYQRSK* |
| Ga0137317_10210111 | 3300012672 | Soil | AVPFGDGGTERGQEITAQELGALLSGIDLSAAKRKRYRRAGS* |
| Ga0157299_102631681 | 3300012899 | Soil | LEEGTYAMPFTQGGEMRRELSAQELGALLSGIDLSQAERRKRYRRKSVEAA* |
| Ga0137413_109337331 | 3300012924 | Vadose Zone Soil | EARREITAQELGALLSGIDLSTAKRRKRYRRKSVEAA* |
| Ga0137404_101470481 | 3300012929 | Vadose Zone Soil | KRLEEGTYAVPFAEDAQDRRREITAQELGALLSGIDLKQATRRKRYQRSV* |
| Ga0126375_101083572 | 3300012948 | Tropical Forest Soil | YVMPLAGSAEEQRREITAQELGALLSGIDLSQAKRRQRYQRPA* |
| Ga0164298_101934592 | 3300012955 | Soil | EEGTYAVPFGDASEERRREITAQELAALLSGIDLERATRRKRYRRST* |
| Ga0164298_113301742 | 3300012955 | Soil | MPVAESPGERRREITAQELGALLSGIDLKQVARRKRYQRLA* |
| Ga0164298_113752142 | 3300012955 | Soil | LEEGTYAVPFGDGALERQREITAQELGALLSGIDLSTAKRRKRYRRAS* |
| Ga0164301_103009501 | 3300012960 | Soil | RLEEGTYAVPFGDDGAERRREITALELAALLSGIDLERAARRKRYRRST* |
| Ga0164304_103152193 | 3300012986 | Soil | MPFGKGDERRAEITGRELSALLSGIDLSQAKRRKRYERERTNAA* |
| Ga0164306_108745182 | 3300012988 | Soil | LEDGTYGVPFEDGARERQREITAQELGALLSGIDLSTAKRRKR |
| Ga0164305_112732181 | 3300012989 | Soil | FDDSGEQRREITAQELGALLSGIDLNQAKRRKRYQRKITAVV* |
| Ga0157371_114150392 | 3300013102 | Corn Rhizosphere | YAMPFSESGEVRQEITAQELGALLSGIDLRQTKRRKRYRRTVSEAA* |
| Ga0157372_126674621 | 3300013307 | Corn Rhizosphere | KRREITAAELGAILSGIDLSEAKRRKRYRRDIAAAA* |
| Ga0157375_112121772 | 3300013308 | Miscanthus Rhizosphere | LEDGTYGVPFEYGARERQREITAQELGALLSGIDLSAAKRRKRDRREGV* |
| Ga0157375_137760351 | 3300013308 | Miscanthus Rhizosphere | KRLEEGTYAVPYGESVQERRREITVQELGALLSGIDLSTAKRRKRYRREGP* |
| Ga0175859_10699511 | 3300013314 | Moss Associated | FGDAAEKRREITAAELGAILSGIDLCDAKRRKRYQRSISAAA* |
| Ga0120125_10895822 | 3300014056 | Permafrost | WSKRLEEGTYTMPFGDGAEKRRQEITAQELGALLSGIDLQQATRRKRYRQSD* |
| Ga0120125_11259712 | 3300014056 | Permafrost | MQFGEEQEHRREITAQELGALLSGIDLSQAKRRKRYQRKSTEAA* |
| Ga0181518_106200501 | 3300014156 | Bog | YAVPFGDGDTERRREITAQELGALLSGIDLSTAKRRKRYGRKGI* |
| Ga0181521_104831441 | 3300014158 | Bog | KRLEEGTCAVPFGDGAEERRREITAQELGALLSGIDLNQAGRRKRYRRSE* |
| Ga0181530_104501161 | 3300014159 | Bog | AKRLEEGTYAMPFGDADDTDGEKRHEITAAELGALLSGIDLSHARRRKRYIRRASEAA* |
| Ga0181538_106646802 | 3300014162 | Bog | YAMPLGDSAAERRQEITVQELGALLSGIDLQQATRRKRYRRCE* |
| Ga0181532_1000414512 | 3300014164 | Bog | VWSKRLEEGTYAVPLGDCSEARQREITVQELGALLSGIDLQQATPRKRYRRSA* |
| Ga0181528_105569891 | 3300014167 | Bog | GTYAMPFGAEHEARREITAQELGALLSGIDLGAAQRRKRYRRRCPEAA* |
| Ga0181535_108917311 | 3300014199 | Bog | GTYAVPLGDGGGERRHEITAQELGALLSGIDLSTAKRRKRYRREGT* |
| Ga0181526_105177962 | 3300014200 | Bog | MPFEDAAEMRREITAAELSAILSGIDLSDAKRRKRYRRNISAAA* |
| Ga0157380_130647931 | 3300014326 | Switchgrass Rhizosphere | EEDEPRREITAQELGALLSGIDLSIAKRRKRYQRKSAEAA* |
| Ga0182016_100866874 | 3300014493 | Bog | AMPFGEEQERRREITAQELGALLSGIDLSQAKRRKRYQRKSAEAS* |
| Ga0182017_100983892 | 3300014494 | Fen | FGDGSAERQREITAQELGALLSGIDLSTAKRRKRYRRQDV* |
| Ga0182015_100693121 | 3300014495 | Palsa | MPLGEDDQERRKEITVQELGALLSGIDLQQAIPRKRYRRAT* |
| Ga0182015_101056161 | 3300014495 | Palsa | KRLEDGTYAVPFGDSAEERRREITVQELGALLSGIDLSQAKRRKRYQRTQ* |
| Ga0182015_103446592 | 3300014495 | Palsa | MPFGDVAEKRREITAAELGAILSGIDLSDAKRRKRYRRNISAAA* |
| Ga0182024_101995365 | 3300014501 | Permafrost | MNTFGEQEDRRREITAQELGALLSGIDLSQAKRRKRYQRKGTE |
| Ga0182024_102738383 | 3300014501 | Permafrost | AMPLAESADERRREITAQELGVLLSGIDLNQAKRRKRYQRSG* |
| Ga0182024_104506932 | 3300014501 | Permafrost | FGEQEDRRREITAQELGALLSGIDLSQAKRRKRYQRKGTEAP* |
| Ga0181525_108666922 | 3300014654 | Bog | LEEGTYAIPFGDGAAERRREISAQELGALLSGIDLSAATRRKRYRRANQ* |
| Ga0181522_102616522 | 3300014657 | Bog | AMPFGDAAEKRREITAAELGTILSGIDLSDAKRRKRYRRNISAAA* |
| Ga0137414_11514741 | 3300015051 | Vadose Zone Soil | VWAKRLEEGTYAMPFAKMNIVVRSPRRKLGALLSGIDLSQAKRRKRYQRKSTEAA* |
| Ga0137420_10961151 | 3300015054 | Vadose Zone Soil | KRLEQGTTYAVPLAESAEERRREITAQELGALLSGIDLQHATRRKRYQRTA* |
| Ga0137420_11111252 | 3300015054 | Vadose Zone Soil | KRLEQGTYAVPLAESAEERRREITAQELGALLSGIDLQHATRRKRYQRTA* |
| Ga0167633_1275092 | 3300015069 | Glacier Forefield Soil | EGTYAVPFGDSAEERRREITTQELGALLSGIDLKQATRRKRYRRST* |
| Ga0167622_10339041 | 3300015158 | Glacier Forefield Soil | IPFGASGEKRREITSAELGALLSGIDLKQAKRRKRYAGNIAEAA* |
| Ga0167651_10104452 | 3300015190 | Glacier Forefield Soil | MGQAVEEGTYAMPFGNEQERRREITAQELGALLSGIDLSQAKRRKRYWRKSVEAP* |
| Ga0137409_102829014 | 3300015245 | Vadose Zone Soil | LSYKRLEEGTYAVPFGDGAEERRQEITAQELGALPSGIDLKQATRRKRYRRSV* |
| Ga0182006_12004161 | 3300015261 | Rhizosphere | YAMPFTEGGEMRREISAQELGALLSGIDLSQARRRKRYQRESEAA* |
| Ga0137403_101798283 | 3300015264 | Vadose Zone Soil | TYAVPFAEDVQERRREITVQELGALLSGIDLKQATRRKRYQRSV* |
| Ga0132256_1024189661 | 3300015372 | Arabidopsis Rhizosphere | YAVPLAESAEERRREITAQELGALLSGIDLQQAKRRKRYQRSA* |
| Ga0132257_1031835001 | 3300015373 | Arabidopsis Rhizosphere | SKRLEEGTYAVPFGDGKGSRRAITAQELAAILSGIDLQQATRRRKRYRRSE* |
| Ga0132255_1003290555 | 3300015374 | Arabidopsis Rhizosphere | LEEGTYAVPFGDGGAERRREITAQELGALLSGIDLSTAKRRK |
| Ga0132255_1004709991 | 3300015374 | Arabidopsis Rhizosphere | VPFGDSAEERRREITAQELGALLSGIDLKQADRRKRYRHSS* |
| Ga0132255_1063170561 | 3300015374 | Arabidopsis Rhizosphere | AIPFGDGSTERRQEISAQELGALLSGIDLSAATRRKRYRRTNQ* |
| Ga0182036_104908011 | 3300016270 | Soil | RRREITAQELGALLSGIDLSQAHRRKRYARNRVEAA |
| Ga0182036_107174452 | 3300016270 | Soil | RREITAQELGALLSGIDLSQAKRRKRYRRKDTEAA |
| Ga0182041_107108362 | 3300016294 | Soil | RLEEGTYAVPLADSADEHRREITAQELGALLSGIDLSQAKRRKRYQRFA |
| Ga0182033_118312421 | 3300016319 | Soil | ERLEEGTYGIPLGAAGGERRREITVQELGVLLSGIDLQQATRRKRYQRSE |
| Ga0182035_118352932 | 3300016341 | Soil | WSKRLEEGTYTLPLADSADARRREITAQELGALLSGIDLSQAKWRQRYRYTAR |
| Ga0182032_112644651 | 3300016357 | Soil | VPFDNGAERRREITVQELGALLSGIDLSTAKRRKRYRRERT |
| Ga0187820_12307681 | 3300017924 | Freshwater Sediment | DQVRREITAQELGALLSGIDLSQAKRRKRYRRKAVEAA |
| Ga0187820_12889271 | 3300017924 | Freshwater Sediment | TYAMPFGEEDEARREITAQELGALLSGIDLSTAKRRKRYRRGSVEAA |
| Ga0187803_103404991 | 3300017934 | Freshwater Sediment | RLEDGTYAVPFGDEAIERRREITAQELGALLSGIDLSTAMRRKRYRRTGT |
| Ga0187850_103013322 | 3300017941 | Peatland | RHEITAAELGALLSGIDLSHAKRRKRYLRLASAAL |
| Ga0187847_101716751 | 3300017948 | Peatland | MPFEDAAEMRREITAAELSAILSGIDLSDAKRRKRYRRNISAAA |
| Ga0187847_101882982 | 3300017948 | Peatland | MLRYKRLEEGTYARPLGDGAAERRREITVQELGALLSGIDLQQAVRRKRYRRC |
| Ga0187779_113365811 | 3300017959 | Tropical Peatland | YAVEWAANGRAQRREITAQELGALLSGIDLSQASRRKRYQRPS |
| Ga0187783_110796992 | 3300017970 | Tropical Peatland | TYAIPFGDGAAERRREISAQELGALLSGIDLSAATRRKRYRRAYQ |
| Ga0187782_103503892 | 3300017975 | Tropical Peatland | MPFDDDSAERGREITARELAALLSGIDLSTATRRKRYRRRGT |
| Ga0187782_104572541 | 3300017975 | Tropical Peatland | EEGTYAIPFGDGAAERRREISAQELGALLSGIDLSAATRRKRYRRANQ |
| Ga0181520_102161232 | 3300017988 | Bog | VRGPPNKAMTQGTYAMPLGDGAAERRREITVQELGALLSGIDLQQATRRKRY |
| Ga0187868_11333082 | 3300018002 | Peatland | GAYAMPLATTAAEHRQEITAQELGALLSGIDLQQATRRKRYRRAA |
| Ga0187888_12378861 | 3300018008 | Peatland | GTYVVPFGDGGEARRREITVQELAALLSGIDLQRATRRKRYQRSV |
| Ga0187880_11675163 | 3300018016 | Peatland | LEEGTYAMPFGEEEERRREITAQELGALLSGIDLSQAKRRKRYHRNGTEAS |
| Ga0187864_100275791 | 3300018022 | Peatland | MPLATTAAEHRQEITAQELGALLSGIDLQQATRRKRYRRAA |
| Ga0187889_104044191 | 3300018023 | Peatland | AATLRLLGDDASAPRREITAQELGALWSGIDLSVARRRKRYRRKCVEAA |
| Ga0187857_100930182 | 3300018026 | Peatland | EEGTYAMPFGDADDTDGEKRHEITAAELGALLSGIDLSHARRRKRYIRRASEAV |
| Ga0187867_100944272 | 3300018033 | Peatland | MTQGTYAMPLGDGAAERRREITVQELGALLSGIDLQQAVRRKRYRRC |
| Ga0187863_100096321 | 3300018034 | Peatland | VRGPPNKAMTQGTYAMPLGDGAAERRREITVQELGALLSGIDLQQAVRRKRYRRC |
| Ga0187883_102640852 | 3300018037 | Peatland | GDTAEKRREITAAELGALLSGIDLSQAKRRKRYDRHIAAAA |
| Ga0187855_101389551 | 3300018038 | Peatland | PEARREITAPELAALLSGIDLSHVQRRKRYQRKITEAA |
| Ga0187871_100306775 | 3300018042 | Peatland | LEEGTYARPLGDGAAERRREITVQELGALLSGIDLQQAVRRK |
| Ga0187871_100769871 | 3300018042 | Peatland | RLEEGTYAMPVAATAAEHRQEITAQELGALLSGIDLPQAPRRKRYRRAA |
| Ga0187871_102837422 | 3300018042 | Peatland | PLGDGAAERRREITVQELGALLSGIDLQQAVRRKRYRRC |
| Ga0187887_101559972 | 3300018043 | Peatland | MPFGQDDEPRREITAQELGALLSGIDLSVAKRRKRYQQKCAEGL |
| Ga0187890_100729003 | 3300018044 | Peatland | LEEGTYALPVGESPEQVRREVTRQELGALLSGIDLASAVRRKRYKRPAA |
| Ga0187890_100811993 | 3300018044 | Peatland | EEGTYAMPFDDGGEKRREITAQELGAILSGIDLSQAKRRKRYQRKTAGNL |
| Ga0187890_108444521 | 3300018044 | Peatland | TYAVPIGDGGAERRREITTQELGALLSGIDLSTVKRRKRYRRAGS |
| Ga0187851_108710851 | 3300018046 | Peatland | FGEDQEPRREITAQELGALLSGIDLSVARRRKRYRRKCAEAA |
| Ga0184629_105724302 | 3300018084 | Groundwater Sediment | VPFGDSVEERRREITAQELGALLSGIDLKQATQRKRYRRST |
| Ga0187774_102625261 | 3300018089 | Tropical Peatland | YAVPFGDGAGERRREITAQELGALLSGIDLQQAARRKRYGRNIK |
| Ga0187770_113323412 | 3300018090 | Tropical Peatland | EEGTYAMPFSESEEVRREITAQELGALLSGIDLSQAKRRKRYHRNTASID |
| Ga0187770_116613231 | 3300018090 | Tropical Peatland | YAKPFSESGEVRQEITAQEMGALLSGIDLRQAKRRKRYRRTVSEAA |
| Ga0066662_102859171 | 3300018468 | Grasslands Soil | KRLEEGTYALPFSESGEIRREITAQELGALLSGIDLSQASRRKRYQPTA |
| Ga0066669_107604932 | 3300018482 | Grasslands Soil | SGEVQCEITAAELAALLSGIDLSRAKRRKRYRRKAAEGV |
| Ga0190264_116153051 | 3300019377 | Soil | RLEEGTYAMPFTEAGGEQRQEITAQELGAILSGIDLSQAKRRKRYNRGEPQPQRY |
| Ga0182031_10818181 | 3300019787 | Bog | EKRKRHEITAAELGALLSGIDLSHAKRRKRYVRQASEAA |
| Ga0193732_10462381 | 3300020012 | Soil | PSEGDGEKRREITAPELAALLSGIDLSQTKRRKRYSRNIAEAV |
| Ga0193726_11362131 | 3300020021 | Soil | MPFENATEKRREITAVELGAILSGIDLSDAKRRKRYQRNFSAAA |
| Ga0193716_12177021 | 3300020061 | Soil | GDAPEKRREITAAELGAILSGIDLSDAKRRKRYQRNISAAA |
| Ga0196971_10631011 | 3300020152 | Soil | LEEGTYAIPFTGAGGEQRQEITAQELGAILSGIDLTEAKRRKRYRRGNAEPA |
| Ga0179592_102885511 | 3300020199 | Vadose Zone Soil | SKRLEEGTYAVPFGDGAEERRQEITAQELGALLSGIDLKQATRRKRYRRSV |
| Ga0210401_1000066541 | 3300020583 | Soil | VWSKRLEEDTYAMPLSDSGEVRREITAQELGALSSGIDLSQARRRSTRTTCLYTGR |
| Ga0210377_102141041 | 3300021090 | Groundwater Sediment | EGAYAMPFGDGGAERQREITAQELAALLSGIDLARAARRKRYQRSV |
| Ga0210406_111743011 | 3300021168 | Soil | RVEEGTYAVPCGDDTEERRREITAQELGALLSGIDLQQATRRKRYRRSI |
| Ga0213881_104145421 | 3300021374 | Exposed Rock | PLAGEAGEKRREITAQELGALLSGIDLDRAKRRKRYERPS |
| Ga0213874_102730891 | 3300021377 | Plant Roots | SKRLEEGTYSVPFAGEAVEKRREITVQELGALLSGIDLERAEKRKRYQRSS |
| Ga0213876_106109901 | 3300021384 | Plant Roots | YAVPFGNADEECRREITAQELGAILSGIDLDQAARRKRYRRSA |
| Ga0210393_101226153 | 3300021401 | Soil | MPFGEEPERRREITAQELGALLSGIDLSQAKRRKRYHL |
| Ga0210393_107348651 | 3300021401 | Soil | KRREITASELGAILSGIDLSQAKRRKRYRRSIAEAA |
| Ga0210393_108514811 | 3300021401 | Soil | TYAMPFGGSGVIAAEKRHEITAAELGALLSGIDLSHAKRRKRYVRQVPEAA |
| Ga0210385_109709791 | 3300021402 | Soil | MPFGVAEKRREITAAELGALLSGIDLSQAKRRKRYRRSIAAAA |
| Ga0210389_105206592 | 3300021404 | Soil | EGTYAMPFEDGENAPRREITAQELGALLSGIDLSIAKRRKRYQRKHAAAA |
| Ga0210387_116539461 | 3300021405 | Soil | RLEEGTYAVPFAGEAGEKRREITVQELGAVLSGIDLDRAGKRKRYQRQS |
| Ga0210383_100328683 | 3300021407 | Soil | MPFGEEPERRREITAQELGALLSGIDLSQAKRRKRYHRKCVEAS |
| Ga0210394_113893172 | 3300021420 | Soil | QVRREITAQELGALLSGIDLNQAKRRKRYRRKAVEAA |
| Ga0213878_100413722 | 3300021444 | Bulk Soil | RREITAQELGALLSGIDLSQARRRKRYERKSGGAA |
| Ga0213878_104344931 | 3300021444 | Bulk Soil | SGEVRREISAQELGALLSGIDLSQARRRKRYRRKAIEAA |
| Ga0210392_110030261 | 3300021475 | Soil | FAGEAGEKRREITVQELGAVLSGIDLDRAGKRKRYQRQS |
| Ga0187846_100101891 | 3300021476 | Biofilm | SGGDHRREITAQELGALLSGIDLNQARRRKRYQRLASPA |
| Ga0187846_102674131 | 3300021476 | Biofilm | VPFGDGGGERRREITAQELGALLSGIDLSTARRRKRYRRTGA |
| Ga0210398_104474884 | 3300021477 | Soil | SYAAPFGKGDEPSYEITAQELGALLSGIDLSVARRRKCYQRKCTEAV |
| Ga0210402_109729172 | 3300021478 | Soil | VWAKQREEGTYAMPFSKSGEIGREITPPELAALLSGIDLSQTKQRNRYRRNVAEPA |
| Ga0210410_102082701 | 3300021479 | Soil | GTYAMPFSESGEVRQEITAQELGALLSGIDLRQAKRRKRYRRTVSEAA |
| Ga0210409_101490391 | 3300021559 | Soil | SGEVRREITAQELGALLSGIDLSQAKRRKRYRRKAVAAA |
| Ga0126371_102496021 | 3300021560 | Tropical Forest Soil | SKRLEEGTYAMPLADNAGEHGREITAQELGALLSGIDLSQARRRQRYQGPATSA |
| Ga0126371_112468231 | 3300021560 | Tropical Forest Soil | PFEDGGAERRREITAQELGAILSGIDLTQASRRKRYGKSV |
| Ga0126371_125049303 | 3300021560 | Tropical Forest Soil | MPFSESGEVRREITAQELGALLSGIDLSQAKRRKRYGRKAAEGA |
| Ga0224568_10242871 | 3300024220 | Plant Litter | LEEGTYAMPFGEEQERRREITAQELGALLSGIDLSQAKRRKRYHRKDADAV |
| Ga0228598_10100053 | 3300024227 | Rhizosphere | LEEGTYAMPFGEEPERRREITAQELGALLSGIDLSQAKRRKRYQRKGTEAL |
| Ga0228598_10242572 | 3300024227 | Rhizosphere | EGTYVMPFGEEPERRREITAQELGALLSGIDLSQAKRRKRYEHKGAETS |
| Ga0224556_11603113 | 3300024295 | Soil | KRLEEGSYAMPFGDSDATGGEKRQEITSAELGALLSGIDLSHAKRRKRYVRQVSEAL |
| Ga0208356_11025662 | 3300025504 | Arctic Peat Soil | GEKRREITAAELGAILSGIDMSDAKRRKRYRRRISAAA |
| Ga0208691_11433332 | 3300025612 | Peatland | EGTYAMPVAATAAEHRQEITAQELGALLSGIDLQQATRRKRYRRAA |
| Ga0208691_11589172 | 3300025612 | Peatland | YAVPFGDSAERRHEITVQELGALLSGIDLSAATRRKRYRRANQ |
| Ga0208220_11605031 | 3300025627 | Arctic Peat Soil | GEEDEARREITAQELGALLSGIDLSTAKRRKRYRRGSMEAA |
| Ga0208357_10238422 | 3300025703 | Arctic Peat Soil | KRHEITAAELAALLSGIDLSHAKRRKRYIRQASEAL |
| Ga0208357_11648622 | 3300025703 | Arctic Peat Soil | AEKQREITAAELSALLSGIDLNQAKCRKRYRRSIAAGA |
| Ga0208357_12197191 | 3300025703 | Arctic Peat Soil | AEKRREITAAELGALLSGIDLSHAKRRKRYVRQSIATA |
| Ga0209483_10385462 | 3300025862 | Arctic Peat Soil | TGGEKRHEITAAELAALLSGIDLSHAKRRKRYIRQASEAL |
| Ga0207692_102165672 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | AGTYAVPFTDGAAERRREITVQELGALLSGIDLQQAARRKRYERSV |
| Ga0207710_101198921 | 3300025900 | Switchgrass Rhizosphere | PFGDGGAERRREITAQELGALLSGIDLSTAKRRKRYQRKGA |
| Ga0207680_109759192 | 3300025903 | Switchgrass Rhizosphere | RLEEGTYAIPFTEEDGEQRRCEITAQELGAILSGIDLSQASRRKRYQRASAEPG |
| Ga0207699_109411832 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | VMPLGEDDQEHRKEITVQELGALLSGIDLQQATARKRYRRAT |
| Ga0207645_105220031 | 3300025907 | Miscanthus Rhizosphere | GAGDTERRREITVQELGALLSGIDLSTAKRRKRYQRDSI |
| Ga0207707_103898082 | 3300025912 | Corn Rhizosphere | MPFGDSAEKRREITAAELGALLSGIDLSHAKRRKRYVRQTIATS |
| Ga0207681_110413662 | 3300025923 | Switchgrass Rhizosphere | LSYKRLEEGRYPVPFGAGDTERRREITVQELGALLSGIDLSTAKRRKRYQRDSI |
| Ga0207700_103531952 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | EGTYALPFCESGEVRREITAQELAALLSGIDLEQAKRRKRYNLIA |
| Ga0207704_115893821 | 3300025938 | Miscanthus Rhizosphere | GDGDAERRREITAQELGALLSGIDLSTAKRHKRYQRPRQ |
| Ga0207661_107658481 | 3300025944 | Corn Rhizosphere | VPFEDGAQERQREITAQELGALLSGIDLSTAKRRKRYRRAS |
| Ga0208773_10264492 | 3300026034 | Rice Paddy Soil | VPFDDGDTERRREITAQELGALLSGIDLSTAKRRKRYRRAEM |
| Ga0207641_101818711 | 3300026088 | Switchgrass Rhizosphere | YAVPFDDGGAERRREITAQELGALLSGIDLSTAKRRKRYRRVGV |
| Ga0209871_10716131 | 3300026217 | Permafrost Soil | KRLEEGTYAVPFADSAEERRREITTQELGALLSGIDLKQATQRKRYRRST |
| Ga0209871_11002312 | 3300026217 | Permafrost Soil | MEGEKRREITAAELGALLSGIDLSQAKRRKRYQRRIVEAG |
| Ga0209863_100559502 | 3300026281 | Prmafrost Soil | MPFGDAGVSGEKRREITAAELGAILSGIDLSHARRRKRYVRQISEAL |
| Ga0209131_10935552 | 3300026320 | Grasslands Soil | GDEPRREITAQELGALLSGIDLSVAKRRKRYRRKSAEAP |
| Ga0257180_10357911 | 3300026354 | Soil | PFAEADELRREITAQELGALLSGIDLSTAKRRKRYRRKSVEAA |
| Ga0257153_11092891 | 3300026490 | Soil | EGTYAMPFGGEDEHRREITAQELGALLSGIDLSVAKRRKRYQRKSSEAA |
| Ga0209160_12483371 | 3300026532 | Soil | AVPFGDSAAQRQREITAQELGALLSGIDLKQATRRKRYCRSD |
| Ga0209648_103200072 | 3300026551 | Grasslands Soil | MRCRFSESDEVRREITAQELGALLSGIDLSQAKRRKRYRRNASEGA |
| Ga0209577_100553822 | 3300026552 | Soil | MPFEEASQRRREITAQELGALLSGIDLSQAHRRKRYARNRVEAA |
| Ga0207820_1132362 | 3300026809 | Tropical Forest Soil | LEEGTYAVPFGDGAERRREITAQELGALLSGIDLSTAKWRKRYRRESL |
| Ga0207852_10314592 | 3300026959 | Tropical Forest Soil | LEQAVGGVGTYAVPFGDGQERRREITAQELGAILSGIDLEHAARRKRYRRSA |
| Ga0207815_10179562 | 3300027014 | Tropical Forest Soil | PFGDGAERRREITAQELGALLSGIDLSTAKWRKRYRRESL |
| Ga0207762_10423741 | 3300027063 | Tropical Forest Soil | AVPLDDDARERRREITAQELGALLSGIDLTQATRRKRYSRG |
| Ga0208603_10057251 | 3300027109 | Forest Soil | SAGEHRREVTAQELGALLSGIDLSQARRRKRYQRPT |
| Ga0208994_10107992 | 3300027164 | Forest Soil | EEGSEARREITAQELGALLSGIDLSVARRRKRYQRKCGETE |
| Ga0209421_11017731 | 3300027432 | Forest Soil | DGEKRHEITAAELGALLSGIDLSHAKRRKRYVRQVSEAV |
| Ga0209221_11668842 | 3300027609 | Forest Soil | RREITAAELGAILSGIDLSDAKRRKRYQRNLSAAA |
| Ga0209330_10547061 | 3300027619 | Forest Soil | SAEKRREITAAELGALLSGIDLSQAKRRKRYQRSFAEAA |
| Ga0208044_11145861 | 3300027625 | Peatlands Soil | AKRLEQGTYALPFSESAARREISAQELGALLSGIDLGAAQRRKRYQRKCTEGA |
| Ga0209009_11333541 | 3300027667 | Forest Soil | YAMPFGEQNEPRREITAQELGALLSGIDLSVAKRRKRYQRKSAEAA |
| Ga0209447_101362812 | 3300027701 | Bog Forest Soil | MPFADSGVTGGEKRHEITAAELGALLSGIDLSHAKRRKRYVRHIAEAL |
| Ga0209908_101417531 | 3300027745 | Thawing Permafrost | MPFAEDDQPRREITAQELGALLSGIDLSVARRRKRYQRKSMEAA |
| Ga0209908_101523551 | 3300027745 | Thawing Permafrost | MPLGDGTEARRREITVQELGALLSGIDLQHATRRKRYRRFE |
| Ga0209772_100166143 | 3300027768 | Bog Forest Soil | EKRHEITAAELGALLSGIDLSQAKRRKRYLRKVSEAL |
| Ga0209074_105057992 | 3300027787 | Agricultural Soil | YAVPFEDGAQERQREITAQELGALLSGIDLSTAKRRKRYRRAN |
| Ga0209656_103811242 | 3300027812 | Bog Forest Soil | QVRREITAHELGALLSGIDLSEPKRRKRYERKAAEAA |
| Ga0209060_101895971 | 3300027826 | Surface Soil | SKRLEEGTYAIPFAEGGSERGREITAQELAALLSGIDLSTAPRRKRYQRTVA |
| Ga0209683_100508322 | 3300027840 | Wetland Sediment | FGDGAEERRREITAQELGALLSGIDLQQATRRKRYRRST |
| Ga0209274_100650062 | 3300027853 | Soil | LGDGAAERRREITVQELGALLSGIDLQQAVRRKRYRRPE |
| Ga0209274_103616682 | 3300027853 | Soil | KRLEEGTYVMPLGEDDQEHRKEITVQELGALLSGIDLQQATARKRYRRAT |
| Ga0209693_102164982 | 3300027855 | Soil | GKGDEPSYEITAQELGALLSGIDLSVARRQKRYQRKCTGAA |
| Ga0209701_106147943 | 3300027862 | Vadose Zone Soil | MPFGEEQEHRQEITAQELGALLSGIDLSQAKRRKRYRRKSVEAA |
| Ga0209167_103685421 | 3300027867 | Surface Soil | PFSEAGEVRQEITAQELGALLSGIDLSQAQRRKRYRRKATQAA |
| Ga0209169_100637973 | 3300027879 | Soil | FGEGCAERQREITAQELGALLSGIDLSTAKRRKRYRRKGA |
| Ga0209169_104508302 | 3300027879 | Soil | LEEGTYAIPSAADATERRREITTQELAALLSGIDLQQASRRKRYRR |
| Ga0209486_105691791 | 3300027886 | Agricultural Soil | EEGTYAMPFTEDGEMRREISAQELGALLSGIDLSKAKRRKRYRRKSVEAA |
| Ga0209380_103669512 | 3300027889 | Soil | MPLGEGSEERRREITVQELGALLSGIDLQQATRRKRYRRCE |
| Ga0209380_107249291 | 3300027889 | Soil | LWSKRLEEGTYAVPFEDGGEKPGREITPQELGAILSGIDLTQAARRKRYRKSD |
| Ga0207428_109925721 | 3300027907 | Populus Rhizosphere | GRYPVPFGAGDTERRREITVQELGALLSGIDLSTAKRRKRYQRDSI |
| Ga0209749_10509642 | 3300027958 | Bioremediated Contaminated Groundwater | GTYAVPFGDGDAERRREITAQELGAILSGIDLTYATRRKRYRQSV |
| Ga0302214_11369511 | 3300028736 | Fen | FGDGGTERRREITAQELGALLSGIDLSTAKRRKRYRRDGI |
| Ga0302266_100603051 | 3300028779 | Bog | EEGTYALPVGESPEQVRREVTTQELGALLSGIDLASAVRRKRYKRPAA |
| Ga0302278_102710712 | 3300028866 | Bog | TDGDKRQEITAAELGALLSGIDLSQAKRRKRYLRNASEAL |
| Ga0307308_106618581 | 3300028884 | Soil | VPFGDGAEERRREITTQELGALLSGIDLKQATRRKRYCQSD |
| Ga0222749_105140242 | 3300029636 | Soil | YAMPFGDEDDSQREITAQELGALLSGIDLSTAKRRKRYRRASPEAA |
| Ga0311327_107903412 | 3300029883 | Bog | EKRREITAAELGAILSGIDLSQAKRRKRYRRSIAAAA |
| Ga0311369_103207733 | 3300029910 | Palsa | EPRCEITAQELGALLSGIDLSVAKRRKRYRRKSTEAA |
| Ga0311369_103912012 | 3300029910 | Palsa | EEGTYAMPFGDSGVTSGEKRYEITAAELGALLSGIDLSHAKRRKRYVRQVSEAA |
| Ga0311359_105775041 | 3300029914 | Bog | MPFGDSDVTDETNRHEITAAELGALLSGIDLSHAKR |
| Ga0311359_108326992 | 3300029914 | Bog | MPFHDSGATDGDKRQEITAAELSALLSGIDLSQAKRRKRYLRNASEAL |
| Ga0311328_110948862 | 3300029939 | Bog | PYAMPFGDDAECRREISAQELGALLSGIDLSQAKRRKRYQRKSTEAS |
| Ga0311352_102711801 | 3300029944 | Palsa | DEPSYEITAQELGALLSGIDLSVARRQKRYQRRCTGAA |
| Ga0311352_109603801 | 3300029944 | Palsa | QPRREITAQELGALLSGIDLSVARRRKRYQRKSAEAA |
| Ga0311330_104183652 | 3300029945 | Bog | MPFGDSDVTDETNRHEITAAELGALLSGIDLSHAKRRKRYVRQVSEAL |
| Ga0311371_106550472 | 3300029951 | Palsa | GTYAMPFGDDHEARREITTQELGALLSGIDLSVAKRRKRYRRKCVEAA |
| Ga0311331_114525951 | 3300029954 | Bog | GTYAMPFGDDHEARREITAQELGALLSGIDLSVAQRRKRYRRKCAEAA |
| Ga0311342_107860382 | 3300029955 | Bog | KRLEEGTYAMPFGGSDVIAAEKRHEITAAELGALLSGIDLSHAKRRKRYVRQASEAA |
| Ga0311334_101502021 | 3300029987 | Fen | AVPFGDCGTERRREITAQELGALLSGIDLSTAKRRKRYRRDGI |
| Ga0302304_101647291 | 3300029993 | Palsa | EAGEVRQEITAQELGALLSGIDLSQAQRRKRYRRKAIEAA |
| Ga0311339_108395292 | 3300029999 | Palsa | KRREITAAELSAILSGIDLSDAKRRKRYRRNISAAA |
| Ga0311339_109799882 | 3300029999 | Palsa | KRLEEGTYAMPVAATAGACRQEITAQELGALLSGIDLQQTTRRKRYRRTA |
| Ga0311350_105086952 | 3300030002 | Fen | MPFSDSGATGGEKRQEITAAELGALLSGIDLTCARRRKRYLRQASEAL |
| Ga0311338_101092673 | 3300030007 | Palsa | MAFGEQNEPRREITAQELGTLLSGIDLSIAKRRKRYRCKSVEAA |
| Ga0311338_102400322 | 3300030007 | Palsa | EGTCALPFEESGERRREITAQELGALLSGIDLSQAKRRKRYQRSITEAA |
| Ga0311338_105581872 | 3300030007 | Palsa | SGEKRYEITAAELGALLSGIDLSHAKRRKRYVRQVSEAA |
| Ga0302274_100943691 | 3300030041 | Bog | SPEQVRREVTTQELGALLSGIDLASAVRRKRYKRPAA |
| Ga0302177_106335871 | 3300030053 | Palsa | LEEGTYAMAFGEQNEPRREITAQELGTLLSGIDLSIAKRRKRYRCKSVEAA |
| Ga0302182_100451712 | 3300030054 | Palsa | CALPFEESGERRREITAQELGALLSGIDLSQAKRRKRYRRSITEAA |
| Ga0311370_117208042 | 3300030503 | Palsa | LSYKRLEEGTYAVPFGDSAKTRRREITVQELGALLSGIDLSQAARRKRYQHPE |
| Ga0302192_100628762 | 3300030507 | Bog | YAMPFGDSDATGGEKRQEITSAELGALLSGIDLSHAKRRKRYVRQVSEAL |
| Ga0311372_122933262 | 3300030520 | Palsa | AMPFGETGEKRREITTAELGAILSGIDLSAAKRRKRFRRGISAAA |
| Ga0311355_111782782 | 3300030580 | Palsa | RRREITAQELGALLSGIDLSAAKRRKRYRRPSPPAA |
| Ga0311356_110348651 | 3300030617 | Palsa | LEQGTYAMPFSEAPEGRREITAQELGALLSGIDLSQAQRRKRYQRKSTEAA |
| Ga0311354_106252023 | 3300030618 | Palsa | EKRLEITAAELGAILSGIDLGNAKRRKRYRRSISAAA |
| Ga0268386_102547521 | 3300030619 | Soil | EEGTYEVPFGDGAAERRREITAQELGALLSGIDLSTAKRRKRYRRAGS |
| Ga0268386_110292112 | 3300030619 | Soil | VPWAEGGELRREITAQELGALLSGIDLRQAERRKRYRRAA |
| Ga0265746_10294451 | 3300030815 | Soil | MPFEDAAEKRREITAAELGAILSGIDLSDAKRRKRYRRNISAAA |
| Ga0265723_10018561 | 3300030872 | Soil | GERRREITTQELGALLSGIDLSHARRRKRYRRGIAEAA |
| Ga0302314_103740073 | 3300030906 | Palsa | QNKPRCEITAQELGALLSGIDLSVAKRRKRYRRKSTEAA |
| Ga0265760_101317921 | 3300031090 | Soil | LEEGTYAMPFGEDGSEPRREITGQELGALLSGIDLSVARRRKRYRRRCMETA |
| Ga0265760_101598042 | 3300031090 | Soil | MPFSEADEVRREITAAELGALLSGIDLSEAKRRKRYRRNGVDGA |
| Ga0170822_149613831 | 3300031122 | Forest Soil | LEEGTYEMPFGDSSDERRREITAQELGALLSGIDLEQAPRRKRYRRSV |
| Ga0302307_103717201 | 3300031233 | Palsa | DSGDTDREKRHEITAAELGALLSGIDLSHAKRRKRYVRQISEAA |
| Ga0302325_103767142 | 3300031234 | Palsa | ALPFEESGERRREITAQELGALLSGIDLSQAKRRKRYRRSITEAA |
| Ga0302325_104275941 | 3300031234 | Palsa | PFAEDDQTRREITAQELGALLSGIDLSVARRRKRYQRKSPEAA |
| Ga0302325_104930491 | 3300031234 | Palsa | MPVAATAAEHRQEITAQELGALLSGIDLQQATRRKRYRRAA |
| Ga0302325_108392911 | 3300031234 | Palsa | LEQGTYAMPFPEAGEVRREITAQELGALLSGIDLSQAQRRKRYRRKAIEAA |
| Ga0302325_108537162 | 3300031234 | Palsa | EEGTYAMPFGEEPERRREITAQELGALLSGIDLSQAKRRKRYQRKGAEAP |
| Ga0302325_112192281 | 3300031234 | Palsa | EKRHEITAAELGALLSGIDLSHAKRRKRYVRQVSEAA |
| Ga0302324_10000801211 | 3300031236 | Palsa | VPFGDGGEERQREITAQELGALLSGIDLSAAERRKRYRRAGT |
| Ga0302324_1012288882 | 3300031236 | Palsa | DVGEKRREITAAELGALLSGIDLSRAKRRKRYVRQVVEAA |
| Ga0302324_1026436262 | 3300031236 | Palsa | VMDLERRREITVPESGALLSGIDLSQAERRKRYQRKSTEPA |
| Ga0265332_103370892 | 3300031238 | Rhizosphere | GDTDREKRHEITAAELGALLSGIDLSHAKRRKRYLRPASEAL |
| Ga0265339_100610361 | 3300031249 | Rhizosphere | GTYAVPLGDGGGERRREITGQELAALLSGIDLSTAKRRKRYRREGT |
| Ga0302187_100839362 | 3300031259 | Bog | SDATGGEKRQEITSAELGALLSGIDLSHAKRRKRYVRQVSEAL |
| Ga0170820_153999011 | 3300031446 | Forest Soil | GTYAMPFSEVEEPRREITAQELGALLSGIDLSVAKRRKRYRRKSAEAA |
| Ga0302320_112536413 | 3300031524 | Bog | MPFEDGGEQRREITAQELGALLSGIDLSRADRRKRYRRGIAEAA |
| Ga0302320_115746451 | 3300031524 | Bog | MPFGDTAEKRREITAAELGAILSGIDLSQAKRRKRYRRSIAAAA |
| Ga0302326_107986402 | 3300031525 | Palsa | AMPFSEINESRCEISAQELGALLSGIDLSQAKRRKRYQLKSREAL |
| Ga0302326_113304231 | 3300031525 | Palsa | EKRRELTAAVLGAILSGIDLNDAKRRKRYRRNVSAAAKTLAFSA |
| Ga0302326_125748032 | 3300031525 | Palsa | GEMRREVSAQELGALLSGIDLSQAKRRKRYQRKSTEAA |
| Ga0302326_130916161 | 3300031525 | Palsa | FGDSGDTDREKRHEITAAELGALLSGIDLSHAKRRKRYLRQASEAA |
| Ga0318528_105366751 | 3300031561 | Soil | TYAVPFGDGSVERGREITAQELGALLSGIDLSTAKRRKRYRRADA |
| Ga0318561_100660581 | 3300031679 | Soil | LEEGTYAVPFDDGTERRREITAQELGALLSGIDLSTAKRRKRYRRVDV |
| Ga0318574_102148632 | 3300031680 | Soil | GTYAMPFGEAAAECRREITAQELGALLSGIDLRAATRRKRYRRANE |
| Ga0310686_1009980332 | 3300031708 | Soil | RLEEGTYAMPLGEGAEERRREITAQELGALLSGIDLQQATSRKRYRRFA |
| Ga0310686_1092081121 | 3300031708 | Soil | MPFGETGISGEKRREITAAELGAILSGIDLSDAKRRKRYRRGISAAA |
| Ga0310686_1094797511 | 3300031708 | Soil | MPFDDDGEKRREITAQELGAILSGIDLSQAKRRKRYQRKTTGEL |
| Ga0310686_1173259502 | 3300031708 | Soil | RIRCVGKTTYAMPFSELSESRCEISAQELGALSSGIDLSRAKRRKRYRLKASESP |
| Ga0310686_1189098182 | 3300031708 | Soil | LEEGTYAMPFGEEQERRREITAQELGALLSGIDLSQAKRRKRYQRKSTEAQ |
| Ga0318496_106230092 | 3300031713 | Soil | REITAQELGALLSGIDLSAAARRKRYRRESIKHFQ |
| Ga0310813_112968981 | 3300031716 | Soil | PFAGETGEKRQEITVQELGALLSGIDLGRAEKRKRYHRAS |
| Ga0307474_109783731 | 3300031718 | Hardwood Forest Soil | PFGDSAEHRREITAQELGALLSGIDLSTAKRRKRYRRADS |
| Ga0307474_116667052 | 3300031718 | Hardwood Forest Soil | LEEGTYVMPLAADTTERRREITTQELAALLSGIDLQQVSRRKRYQR |
| Ga0318557_104775702 | 3300031795 | Soil | SYAMPFGEAAAECRREITAQELGALLSGIDLRAATRRKRYRRANE |
| Ga0318576_105247331 | 3300031796 | Soil | YAMPLEEAGQRRREITAQELGALLSGIDLSQAHRRKRYARNRVEAA |
| Ga0318497_104249541 | 3300031805 | Soil | GSAEEQRREITAQELGALLSGIDLSQTKRRKRYQRPA |
| Ga0307478_104645831 | 3300031823 | Hardwood Forest Soil | FGEDADEPRREITAQELGALLSGIDLSVAKRRKRYRRKCMAAA |
| Ga0318512_104291812 | 3300031846 | Soil | EGTYAVPRADGVEERRREITAQELGALLSGIDLQEATRRKRYRRPT |
| Ga0318520_111154181 | 3300031897 | Soil | PFDDSGEQRREMTAQELGALLSGIDLSRAKRRKRYQRDIAAVV |
| Ga0311367_120905561 | 3300031918 | Fen | IPFVDDSPAEARREITAQELGAILSGIDLSTAARRKRYQRTHAEAA |
| Ga0308175_1010011151 | 3300031938 | Soil | KRLEEGTYAIPFGGGAAERRQEISAQELGALLSGIDLSAATRRKRYRRANQ |
| Ga0310916_102862702 | 3300031942 | Soil | LEEGTYAMPFDDSGEQRREMTAQELGALLSGIDLSRAKRRKRYQRDIAAVV |
| Ga0310916_105113452 | 3300031942 | Soil | LEEGTFAVPLDDDARERRREITAQELGALLSGIDLTQATRRKRYSRG |
| Ga0307479_116918861 | 3300031962 | Hardwood Forest Soil | PFSDSGEVRREITAQELGALLSGIDLSQARRRKRYRRELPESR |
| Ga0306922_118572032 | 3300032001 | Soil | GTYGVPFGAGEANRREITAQELGAILSGIDLAQAARRKRYGRVE |
| Ga0307416_1021228071 | 3300032002 | Rhizosphere | YAVPFGDGALERQREITAQELGALLSGIDLSTAKRRKRYRHAG |
| Ga0308173_101592072 | 3300032074 | Soil | EGTYAMPSAADAMERRREITTQELAALLSGIDLQQASRRKRYRR |
| Ga0308173_109954752 | 3300032074 | Soil | MPFGKEDDARCELSAQELSALLSGIDLSQAKRRKRYRREPFEAA |
| Ga0306924_102495201 | 3300032076 | Soil | APFAGEAGEKRREITAQELGALLSGIDLDRAEKRKRYQRPS |
| Ga0272424_10909321 | 3300032162 | Rock | MPFGESAEKRREITAAELGALLSGIDLSQAKRRKRYRLKSAEAA |
| Ga0306920_1003642653 | 3300032261 | Soil | WSKRLEEGTYAMPFGDAAAECRREITAQELGALLSGIDLRAATRRKRYRRANE |
| Ga0306920_1024427602 | 3300032261 | Soil | IWSKRLEEGTYGIPLGAAGGERRREITVQELGVLLSGIDLQQATRRKRYQRSE |
| Ga0306920_1032268942 | 3300032261 | Soil | YALPFFESGEVRREITAQELAALLSGIDLNRAKRRKRYNLIA |
| Ga0306920_1038828442 | 3300032261 | Soil | AVPFGDGGAERRREITAQELGALLSGIDLSTPKRRKRYRHTGS |
| Ga0348332_112548132 | 3300032515 | Plant Litter | AEADELRREITAQELGALLSGIVLSTAKRRKRYKRGSVEAA |
| Ga0335085_103168881 | 3300032770 | Soil | EAGEVRQEITAQELGALLSGIDLSQAQRRKRYRRKAIQAL |
| Ga0335078_101658182 | 3300032805 | Soil | LEDGTYAIPFGDGGAERRREIRAPELAALLSGIDLRTAKRRKRYQRTGT |
| Ga0335078_122247101 | 3300032805 | Soil | LEEGTYAVPFEDEARERQREITGQELGALLSGIDLSTAKRRKRYRRANS |
| Ga0335081_101383181 | 3300032892 | Soil | LEEGTYSVPFGDGGAERQREITAQELGALLSGIDLSTAKRRKRYERKGA |
| Ga0335081_103538593 | 3300032892 | Soil | FGDGAEERQREITAQELGALLSGIDLQQAARRKRYGRNIK |
| Ga0335081_106903862 | 3300032892 | Soil | PFEDGARERQREITAQELGALLSGIDLSTARRRKRYRCASS |
| Ga0335081_116005151 | 3300032892 | Soil | RLEQGTYAIPFTTGGTMRSEITAQELGALLSGIDLSRAQRRKRYARAGVEST |
| Ga0335081_126696732 | 3300032892 | Soil | EGTYAIPFADGGAERRREITAPELAALLSGIELSTAKRRKRYQRTGT |
| Ga0335074_102902773 | 3300032895 | Soil | FEDGTRERQREITAQELGALLSGIDLSSAKRRKRYRCAT |
| Ga0335072_115908691 | 3300032898 | Soil | AIPFDDSGAERRREITAQELAALLSGIELSTAKRRKRYQRRVT |
| Ga0335084_102161893 | 3300033004 | Soil | GTYAVPFEKEHKRREITAPELSAILSGIDLSQAQRRKRYRREMFEPEAA |
| Ga0335073_104044522 | 3300033134 | Soil | YAMPFGEDAHELRREITAQELGALLSGIDLSVAQRRKRYQKKCMGAP |
| Ga0307507_100535721 | 3300033179 | Ectomycorrhiza | LADNAGEHRREITAQELGALLSGIDLSQARRRKRYQRPASPT |
| Ga0318519_101580672 | 3300033290 | Soil | AEEPRREITAQELGALLSGIDLSQTKRRKRYQRPA |
| Ga0326728_108367052 | 3300033402 | Peat Soil | VWSKGLEEGPYAAPFGESGEERRREITAQELGVLLSGIDLQQVIRRKRYLRSAENSR |
| Ga0326727_108572701 | 3300033405 | Peat Soil | FGDDAGELRREITAQELGALLSGIDLSVAKRRKRYRRKCLEAA |
| Ga0310810_102470283 | 3300033412 | Soil | RLEEGTYAVPFDGAERRREITAQELGALLSGIDLSTAKRRRRYRRADV |
| Ga0334792_109254_604_738 | 3300033888 | Soil | MPFEDDGERRREITAQELGALLSGIDLSQASRRKRYRRNVAEAA |
| Ga0334827_211937_21_167 | 3300034065 | Soil | MPFSDSGAADGEKRHEITAAELGALLSGIDLSHAKRRKRYVRQASEAA |
| Ga0370483_0065786_2_118 | 3300034124 | Untreated Peat Soil | PERRREISAQELGALLSGIDLSQAKRRKRYQRKSAEAS |
| Ga0370490_0222149_2_136 | 3300034128 | Untreated Peat Soil | YAVPFGDGGAERRREITAQELGALLSGIDLSTAKRRKRYRRDSI |
| Ga0370515_0234396_632_778 | 3300034163 | Untreated Peat Soil | EEGTYALPVGENAAEVRREITTQELGALLSGIDLTNAVRRKRYKRPAA |
| Ga0370501_0023218_5_148 | 3300034195 | Untreated Peat Soil | MPFSEDAGDEEPRREITAQELGALLSGIDLSAAKRRKRYQRKSVEAA |
| Ga0334931_176912_299_421 | 3300034377 | Sub-Biocrust Soil | LAGEPKQEITAPELGALLSGIDLTTAPRRKRYRRISAHSS |
| ⦗Top⦘ |