


| Basic Information | |
|---|---|
| Family ID | F002883 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 523 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MSTLHHEDLLLSIFDEVQEAFPYLDEEKQIEIANNRFEDLCQ |
| Number of Associated Samples | 191 |
| Number of Associated Scaffolds | 523 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 47.41 % |
| % of genes near scaffold ends (potentially truncated) | 29.64 % |
| % of genes from short scaffolds (< 2000 bps) | 85.09 % |
| Associated GOLD sequencing projects | 157 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.63 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Predicted Viral (32.696 % of family members) |
| NCBI Taxonomy ID | 10239 (predicted) |
| Taxonomy | All Organisms → Viruses → Predicted Viral |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine (33.461 % of family members) |
| Environment Ontology (ENVO) | Unclassified (88.337 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (95.602 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 48.57% β-sheet: 0.00% Coil/Unstructured: 51.43% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.63 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 523 Family Scaffolds |
|---|---|---|
| PF12098 | DUF3574 | 3.06 |
| PF01467 | CTP_transf_like | 0.76 |
| PF04965 | GPW_gp25 | 0.57 |
| PF01050 | MannoseP_isomer | 0.57 |
| PF01555 | N6_N4_Mtase | 0.19 |
| PF16075 | DUF4815 | 0.19 |
| PF05488 | PAAR_motif | 0.19 |
| PF00245 | Alk_phosphatase | 0.19 |
| PF02675 | AdoMet_dc | 0.19 |
| PF13155 | Toprim_2 | 0.19 |
| PF13392 | HNH_3 | 0.19 |
| PF07230 | Portal_Gp20 | 0.19 |
| PF00856 | SET | 0.19 |
| COG ID | Name | Functional Category | % Frequency in 523 Family Scaffolds |
|---|---|---|---|
| COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 0.19 |
| COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 0.19 |
| COG1586 | S-adenosylmethionine decarboxylase | Amino acid transport and metabolism [E] | 0.19 |
| COG1785 | Alkaline phosphatase | Inorganic ion transport and metabolism [P] | 0.19 |
| COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 0.19 |
| COG4104 | Zn-binding Pro-Ala-Ala-Arg (PAAR) domain, involved in Type VI secretion | Intracellular trafficking, secretion, and vesicular transport [U] | 0.19 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 70.94 % |
| Unclassified | root | N/A | 29.06 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2014642000|2014650182 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → Lipsvirus | 976 | Open in IMG/M |
| 3300000973|BBAY93_10100899 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 734 | Open in IMG/M |
| 3300001778|ACM18_1118884 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 503 | Open in IMG/M |
| 3300001832|ACM6_1000141 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 825 | Open in IMG/M |
| 3300001945|GOS2241_1007727 | All Organisms → Viruses → Predicted Viral | 1427 | Open in IMG/M |
| 3300001945|GOS2241_1010413 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 1417 | Open in IMG/M |
| 3300001951|GOS2249_1032881 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 586 | Open in IMG/M |
| 3300001953|GOS2231_1002261 | Not Available | 1585 | Open in IMG/M |
| 3300001953|GOS2231_1016872 | All Organisms → Viruses → Predicted Viral | 1461 | Open in IMG/M |
| 3300001953|GOS2231_1027607 | All Organisms → Viruses → Predicted Viral | 1681 | Open in IMG/M |
| 3300001954|GOS2235_1000738 | All Organisms → Viruses → Predicted Viral | 1476 | Open in IMG/M |
| 3300001954|GOS2235_1021038 | All Organisms → Viruses → Predicted Viral | 1590 | Open in IMG/M |
| 3300001960|GOS2230_1002016 | All Organisms → Viruses → Predicted Viral | 1733 | Open in IMG/M |
| 3300001961|GOS2240_1003951 | All Organisms → Viruses → Predicted Viral | 1313 | Open in IMG/M |
| 3300001962|GOS2239_1005959 | All Organisms → Viruses → Predicted Viral | 1575 | Open in IMG/M |
| 3300001964|GOS2234_1017888 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 948 | Open in IMG/M |
| 3300001964|GOS2234_1060345 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 1794 | Open in IMG/M |
| 3300001966|GOS2245_1029338 | All Organisms → Viruses → Predicted Viral | 1057 | Open in IMG/M |
| 3300001967|GOS2242_1065837 | All Organisms → Viruses → Predicted Viral | 2033 | Open in IMG/M |
| 3300001969|GOS2233_1020496 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Kanaloavirus → unclassified Kanaloavirus → Kanaloavirus sp. | 1483 | Open in IMG/M |
| 3300001969|GOS2233_1100362 | Not Available | 1801 | Open in IMG/M |
| 3300002482|JGI25127J35165_1004027 | All Organisms → Viruses → Predicted Viral | 3933 | Open in IMG/M |
| 3300002482|JGI25127J35165_1011198 | All Organisms → Viruses → Predicted Viral | 2283 | Open in IMG/M |
| 3300002482|JGI25127J35165_1064057 | Not Available | 775 | Open in IMG/M |
| 3300002482|JGI25127J35165_1069555 | All Organisms → Viruses | 735 | Open in IMG/M |
| 3300002483|JGI25132J35274_1042675 | Not Available | 998 | Open in IMG/M |
| 3300002955|JGI26062J44793_1007561 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 1368 | Open in IMG/M |
| 3300002955|JGI26062J44793_1015833 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Kanaloavirus → unclassified Kanaloavirus → Kanaloavirus sp. | 900 | Open in IMG/M |
| 3300002955|JGI26062J44793_1028183 | All Organisms → Viruses | 663 | Open in IMG/M |
| 3300002955|JGI26062J44793_1037677 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 571 | Open in IMG/M |
| 3300003185|JGI26064J46334_1009157 | All Organisms → Viruses → Predicted Viral | 2125 | Open in IMG/M |
| 3300003185|JGI26064J46334_1061167 | Not Available | 713 | Open in IMG/M |
| 3300003185|JGI26064J46334_1103810 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → Lipsvirus | 541 | Open in IMG/M |
| 3300003185|JGI26064J46334_1111608 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → Lipsvirus | 521 | Open in IMG/M |
| 3300003185|JGI26064J46334_1118977 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 505 | Open in IMG/M |
| 3300004951|Ga0068513_1011817 | Not Available | 924 | Open in IMG/M |
| 3300004951|Ga0068513_1025534 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Kanaloavirus → unclassified Kanaloavirus → Kanaloavirus sp. | 640 | Open in IMG/M |
| 3300005057|Ga0068511_1003034 | All Organisms → Viruses → Predicted Viral | 1879 | Open in IMG/M |
| 3300005057|Ga0068511_1018827 | Not Available | 989 | Open in IMG/M |
| 3300005057|Ga0068511_1021055 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Kanaloavirus → unclassified Kanaloavirus → Kanaloavirus sp. | 949 | Open in IMG/M |
| 3300005057|Ga0068511_1022425 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 927 | Open in IMG/M |
| 3300005057|Ga0068511_1080217 | Not Available | 566 | Open in IMG/M |
| 3300005057|Ga0068511_1099619 | Not Available | 517 | Open in IMG/M |
| 3300005074|Ga0070431_1187606 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Kanaloavirus → unclassified Kanaloavirus → Kanaloavirus sp. | 726 | Open in IMG/M |
| 3300005074|Ga0070431_1258249 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Kanaloavirus → unclassified Kanaloavirus → Kanaloavirus sp. | 549 | Open in IMG/M |
| 3300005097|Ga0072505_1392268 | Not Available | 577 | Open in IMG/M |
| 3300005097|Ga0072505_1503817 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Kanaloavirus → unclassified Kanaloavirus → Kanaloavirus sp. | 645 | Open in IMG/M |
| 3300005404|Ga0066856_10173417 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 940 | Open in IMG/M |
| 3300005404|Ga0066856_10444203 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Kanaloavirus → unclassified Kanaloavirus → Kanaloavirus sp. | 553 | Open in IMG/M |
| 3300005432|Ga0066845_10051271 | All Organisms → Viruses → Predicted Viral | 1520 | Open in IMG/M |
| 3300005432|Ga0066845_10059166 | All Organisms → Viruses → Predicted Viral | 1420 | Open in IMG/M |
| 3300005432|Ga0066845_10060778 | All Organisms → Viruses → Predicted Viral | 1401 | Open in IMG/M |
| 3300005432|Ga0066845_10075667 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1260 | Open in IMG/M |
| 3300005432|Ga0066845_10218076 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Kanaloavirus → unclassified Kanaloavirus → Kanaloavirus sp. | 736 | Open in IMG/M |
| 3300005432|Ga0066845_10254315 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Kanaloavirus → unclassified Kanaloavirus → Kanaloavirus sp. | 678 | Open in IMG/M |
| 3300005432|Ga0066845_10257769 | Not Available | 673 | Open in IMG/M |
| 3300005432|Ga0066845_10339689 | Not Available | 581 | Open in IMG/M |
| 3300005432|Ga0066845_10380225 | Not Available | 546 | Open in IMG/M |
| 3300005432|Ga0066845_10398612 | Not Available | 532 | Open in IMG/M |
| 3300005433|Ga0066830_10058446 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → Lipsvirus | 794 | Open in IMG/M |
| 3300005433|Ga0066830_10112556 | Not Available | 581 | Open in IMG/M |
| 3300005433|Ga0066830_10114283 | Not Available | 577 | Open in IMG/M |
| 3300005523|Ga0066865_10007871 | All Organisms → Viruses → Predicted Viral | 3259 | Open in IMG/M |
| 3300005523|Ga0066865_10163358 | Not Available | 827 | Open in IMG/M |
| 3300005523|Ga0066865_10165270 | Not Available | 822 | Open in IMG/M |
| 3300005523|Ga0066865_10196450 | Not Available | 755 | Open in IMG/M |
| 3300005523|Ga0066865_10392412 | Not Available | 527 | Open in IMG/M |
| 3300005606|Ga0066835_10012078 | Not Available | 2221 | Open in IMG/M |
| 3300005606|Ga0066835_10069011 | Not Available | 1087 | Open in IMG/M |
| 3300005606|Ga0066835_10073671 | All Organisms → Viruses → Predicted Viral | 1057 | Open in IMG/M |
| 3300005606|Ga0066835_10082513 | All Organisms → Viruses → Predicted Viral | 1007 | Open in IMG/M |
| 3300005606|Ga0066835_10098777 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 931 | Open in IMG/M |
| 3300005606|Ga0066835_10122443 | Not Available | 846 | Open in IMG/M |
| 3300005606|Ga0066835_10181231 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Kanaloavirus → unclassified Kanaloavirus → Kanaloavirus sp. | 706 | Open in IMG/M |
| 3300005606|Ga0066835_10214728 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae | 652 | Open in IMG/M |
| 3300005606|Ga0066835_10238607 | Not Available | 620 | Open in IMG/M |
| 3300005606|Ga0066835_10327585 | Not Available | 532 | Open in IMG/M |
| 3300005608|Ga0066840_10024781 | All Organisms → Viruses → Predicted Viral | 1171 | Open in IMG/M |
| 3300005608|Ga0066840_10040280 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → Haifavirus → Haifavirus tim68 | 934 | Open in IMG/M |
| 3300005608|Ga0066840_10051717 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Kanaloavirus → unclassified Kanaloavirus → Kanaloavirus sp. | 830 | Open in IMG/M |
| 3300005608|Ga0066840_10051858 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → Lipsvirus | 828 | Open in IMG/M |
| 3300005608|Ga0066840_10057770 | Not Available | 787 | Open in IMG/M |
| 3300005934|Ga0066377_10077285 | Not Available | 978 | Open in IMG/M |
| 3300005934|Ga0066377_10089376 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Kanaloavirus → unclassified Kanaloavirus → Kanaloavirus sp. | 913 | Open in IMG/M |
| 3300005934|Ga0066377_10096323 | Not Available | 881 | Open in IMG/M |
| 3300005934|Ga0066377_10225427 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Kanaloavirus → unclassified Kanaloavirus → Kanaloavirus sp. | 577 | Open in IMG/M |
| 3300005934|Ga0066377_10280839 | Not Available | 516 | Open in IMG/M |
| 3300005960|Ga0066364_10037025 | All Organisms → Viruses → Predicted Viral | 1553 | Open in IMG/M |
| 3300005960|Ga0066364_10144008 | Not Available | 815 | Open in IMG/M |
| 3300005960|Ga0066364_10376630 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 501 | Open in IMG/M |
| 3300005971|Ga0066370_10042072 | All Organisms → Viruses → Predicted Viral | 1408 | Open in IMG/M |
| 3300005971|Ga0066370_10151228 | Not Available | 796 | Open in IMG/M |
| 3300005971|Ga0066370_10177018 | Not Available | 739 | Open in IMG/M |
| 3300005971|Ga0066370_10318498 | Not Available | 558 | Open in IMG/M |
| 3300005971|Ga0066370_10349706 | Not Available | 532 | Open in IMG/M |
| 3300005971|Ga0066370_10388382 | Not Available | 505 | Open in IMG/M |
| 3300006024|Ga0066371_10007929 | All Organisms → Viruses → Predicted Viral | 2776 | Open in IMG/M |
| 3300006024|Ga0066371_10153469 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Kanaloavirus → unclassified Kanaloavirus → Kanaloavirus sp. | 707 | Open in IMG/M |
| 3300006077|Ga0081594_1098475 | All Organisms → Viruses → Predicted Viral | 1387 | Open in IMG/M |
| 3300006077|Ga0081594_1138743 | All Organisms → Viruses → Predicted Viral | 1047 | Open in IMG/M |
| 3300006083|Ga0081762_1360758 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 609 | Open in IMG/M |
| 3300006305|Ga0068468_1000672 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 10845 | Open in IMG/M |
| 3300006305|Ga0068468_1002295 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 5928 | Open in IMG/M |
| 3300006305|Ga0068468_1015084 | All Organisms → Viruses → Predicted Viral | 2757 | Open in IMG/M |
| 3300006305|Ga0068468_1031719 | All Organisms → Viruses → Predicted Viral | 2161 | Open in IMG/M |
| 3300006305|Ga0068468_1039273 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2887 | Open in IMG/M |
| 3300006305|Ga0068468_1049869 | All Organisms → Viruses | 6429 | Open in IMG/M |
| 3300006305|Ga0068468_1059381 | All Organisms → Viruses → Predicted Viral | 1182 | Open in IMG/M |
| 3300006305|Ga0068468_1083728 | All Organisms → Viruses → Predicted Viral | 2568 | Open in IMG/M |
| 3300006305|Ga0068468_1094571 | Not Available | 866 | Open in IMG/M |
| 3300006305|Ga0068468_1107819 | All Organisms → Viruses → Predicted Viral | 1369 | Open in IMG/M |
| 3300006305|Ga0068468_1130455 | All Organisms → Viruses → Predicted Viral | 2029 | Open in IMG/M |
| 3300006305|Ga0068468_1130992 | All Organisms → Viruses → Predicted Viral | 1182 | Open in IMG/M |
| 3300006305|Ga0068468_1142178 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → Lipsvirus | 913 | Open in IMG/M |
| 3300006305|Ga0068468_1148599 | All Organisms → Viruses → Predicted Viral | 1225 | Open in IMG/M |
| 3300006329|Ga0068486_1012638 | All Organisms → Viruses | 10707 | Open in IMG/M |
| 3300006329|Ga0068486_1035991 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 698 | Open in IMG/M |
| 3300006329|Ga0068486_1036432 | All Organisms → Viruses → Predicted Viral | 2589 | Open in IMG/M |
| 3300006329|Ga0068486_1037597 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Libanvirus → unclassified Libanvirus → Libanvirus sp. | 922 | Open in IMG/M |
| 3300006329|Ga0068486_1130896 | All Organisms → Viruses → Predicted Viral | 1275 | Open in IMG/M |
| 3300006329|Ga0068486_1131667 | All Organisms → Viruses → Predicted Viral | 2827 | Open in IMG/M |
| 3300006329|Ga0068486_1149207 | All Organisms → Viruses → Predicted Viral | 1498 | Open in IMG/M |
| 3300006329|Ga0068486_1280943 | All Organisms → Viruses → Predicted Viral | 1301 | Open in IMG/M |
| 3300006329|Ga0068486_1320087 | Not Available | 762 | Open in IMG/M |
| 3300006329|Ga0068486_1354678 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 519 | Open in IMG/M |
| 3300006329|Ga0068486_1374864 | Not Available | 640 | Open in IMG/M |
| 3300006329|Ga0068486_1413632 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 833 | Open in IMG/M |
| 3300006329|Ga0068486_1446901 | All Organisms → Viruses → Predicted Viral | 1274 | Open in IMG/M |
| 3300006329|Ga0068486_1449463 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 670 | Open in IMG/M |
| 3300006329|Ga0068486_1477067 | Not Available | 544 | Open in IMG/M |
| 3300006334|Ga0099675_1086620 | All Organisms → Viruses → Predicted Viral | 1916 | Open in IMG/M |
| 3300006334|Ga0099675_1122224 | Not Available | 1369 | Open in IMG/M |
| 3300006334|Ga0099675_1401322 | All Organisms → Viruses → Predicted Viral | 2968 | Open in IMG/M |
| 3300006334|Ga0099675_1402657 | All Organisms → Viruses → Predicted Viral | 1058 | Open in IMG/M |
| 3300006334|Ga0099675_1402691 | All Organisms → Viruses → Predicted Viral | 1901 | Open in IMG/M |
| 3300006334|Ga0099675_1529952 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 1495 | Open in IMG/M |
| 3300006334|Ga0099675_1532269 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 815 | Open in IMG/M |
| 3300006334|Ga0099675_1532770 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 699 | Open in IMG/M |
| 3300006334|Ga0099675_1623473 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 834 | Open in IMG/M |
| 3300006345|Ga0099693_1021131 | All Organisms → Viruses → Predicted Viral | 2666 | Open in IMG/M |
| 3300006345|Ga0099693_1025782 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 5391 | Open in IMG/M |
| 3300006345|Ga0099693_1332710 | All Organisms → Viruses → Predicted Viral | 3533 | Open in IMG/M |
| 3300006345|Ga0099693_1345955 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 1019 | Open in IMG/M |
| 3300006345|Ga0099693_1368601 | All Organisms → Viruses → Predicted Viral | 1613 | Open in IMG/M |
| 3300006345|Ga0099693_1406463 | All Organisms → Viruses → Predicted Viral | 1383 | Open in IMG/M |
| 3300006345|Ga0099693_1418166 | Not Available | 903 | Open in IMG/M |
| 3300006345|Ga0099693_1441002 | All Organisms → Viruses → Predicted Viral | 1316 | Open in IMG/M |
| 3300006345|Ga0099693_1452923 | All Organisms → Viruses → Predicted Viral | 1126 | Open in IMG/M |
| 3300006350|Ga0099954_1016447 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 5793 | Open in IMG/M |
| 3300006350|Ga0099954_1017508 | All Organisms → Viruses → Predicted Viral | 2311 | Open in IMG/M |
| 3300006350|Ga0099954_1017509 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae | 809 | Open in IMG/M |
| 3300006350|Ga0099954_1018329 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 4402 | Open in IMG/M |
| 3300006350|Ga0099954_1049261 | All Organisms → Viruses → Predicted Viral | 1923 | Open in IMG/M |
| 3300006350|Ga0099954_1073879 | All Organisms → Viruses → Predicted Viral | 1820 | Open in IMG/M |
| 3300006350|Ga0099954_1254015 | All Organisms → Viruses → Predicted Viral | 1168 | Open in IMG/M |
| 3300006350|Ga0099954_1262198 | All Organisms → Viruses → Predicted Viral | 1038 | Open in IMG/M |
| 3300006350|Ga0099954_1267294 | Not Available | 628 | Open in IMG/M |
| 3300006350|Ga0099954_1299054 | All Organisms → Viruses → Predicted Viral | 1693 | Open in IMG/M |
| 3300006350|Ga0099954_1303644 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1229 | Open in IMG/M |
| 3300006350|Ga0099954_1308288 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 864 | Open in IMG/M |
| 3300006350|Ga0099954_1309351 | All Organisms → Viruses | 1094 | Open in IMG/M |
| 3300006350|Ga0099954_1338892 | All Organisms → Viruses → Predicted Viral | 1430 | Open in IMG/M |
| 3300006350|Ga0099954_1382194 | All Organisms → Viruses → Predicted Viral | 1669 | Open in IMG/M |
| 3300006350|Ga0099954_1388449 | All Organisms → Viruses → Predicted Viral | 1425 | Open in IMG/M |
| 3300006350|Ga0099954_1393972 | Not Available | 915 | Open in IMG/M |
| 3300006350|Ga0099954_1560689 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 663 | Open in IMG/M |
| 3300006350|Ga0099954_1575383 | Not Available | 526 | Open in IMG/M |
| 3300006350|Ga0099954_1576713 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 581 | Open in IMG/M |
| 3300006351|Ga0099953_1489141 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → Lipsvirus | 1534 | Open in IMG/M |
| 3300006351|Ga0099953_1548944 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 533 | Open in IMG/M |
| 3300006351|Ga0099953_1656150 | Not Available | 564 | Open in IMG/M |
| 3300006351|Ga0099953_1682448 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 675 | Open in IMG/M |
| 3300006377|Ga0079049_1333796 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → Lipsvirus | 902 | Open in IMG/M |
| 3300006413|Ga0099963_1028936 | All Organisms → Viruses → Predicted Viral | 1360 | Open in IMG/M |
| 3300006413|Ga0099963_1050084 | All Organisms → Viruses → Predicted Viral | 1076 | Open in IMG/M |
| 3300006413|Ga0099963_1055365 | Not Available | 625 | Open in IMG/M |
| 3300006413|Ga0099963_1219376 | All Organisms → Viruses → Predicted Viral | 1507 | Open in IMG/M |
| 3300006413|Ga0099963_1249283 | All Organisms → Viruses → Predicted Viral | 1406 | Open in IMG/M |
| 3300006413|Ga0099963_1447156 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 680 | Open in IMG/M |
| 3300006480|Ga0100226_1011637 | All Organisms → Viruses → Predicted Viral | 2059 | Open in IMG/M |
| 3300006480|Ga0100226_1012761 | All Organisms → Viruses → Predicted Viral | 1908 | Open in IMG/M |
| 3300006480|Ga0100226_1023780 | Not Available | 516 | Open in IMG/M |
| 3300006480|Ga0100226_1059877 | All Organisms → Viruses → Predicted Viral | 1047 | Open in IMG/M |
| 3300006480|Ga0100226_1102750 | Not Available | 864 | Open in IMG/M |
| 3300006480|Ga0100226_1323583 | All Organisms → Viruses → Predicted Viral | 1049 | Open in IMG/M |
| 3300006480|Ga0100226_1457917 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 992 | Open in IMG/M |
| 3300006480|Ga0100226_1465447 | All Organisms → Viruses → Predicted Viral | 1032 | Open in IMG/M |
| 3300006480|Ga0100226_1468063 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 669 | Open in IMG/M |
| 3300006481|Ga0100229_1037931 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 661 | Open in IMG/M |
| 3300006481|Ga0100229_1414769 | Not Available | 610 | Open in IMG/M |
| 3300006481|Ga0100229_1498289 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Kanaloavirus → unclassified Kanaloavirus → Kanaloavirus sp. | 729 | Open in IMG/M |
| 3300006481|Ga0100229_1590218 | All Organisms → Viruses → Predicted Viral | 1181 | Open in IMG/M |
| 3300006735|Ga0098038_1276460 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → Haifavirus → Haifavirus tim68 | 525 | Open in IMG/M |
| 3300006737|Ga0098037_1021012 | All Organisms → Viruses → Predicted Viral | 2439 | Open in IMG/M |
| 3300006737|Ga0098037_1141846 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → Haifavirus → Haifavirus tim68 | 811 | Open in IMG/M |
| 3300006737|Ga0098037_1244740 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Kanaloavirus → unclassified Kanaloavirus → Kanaloavirus sp. | 576 | Open in IMG/M |
| 3300006749|Ga0098042_1079591 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 850 | Open in IMG/M |
| 3300007113|Ga0101666_1066330 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Kanaloavirus → unclassified Kanaloavirus → Kanaloavirus sp. | 669 | Open in IMG/M |
| 3300007113|Ga0101666_1083323 | All Organisms → Viruses | 592 | Open in IMG/M |
| 3300007114|Ga0101668_1033370 | All Organisms → Viruses → Predicted Viral | 1035 | Open in IMG/M |
| 3300007116|Ga0101667_1020736 | All Organisms → Viruses → Predicted Viral | 1091 | Open in IMG/M |
| 3300007116|Ga0101667_1027172 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 976 | Open in IMG/M |
| 3300007116|Ga0101667_1043515 | All Organisms → Viruses | 798 | Open in IMG/M |
| 3300007133|Ga0101671_1013635 | All Organisms → Viruses → Predicted Viral | 1110 | Open in IMG/M |
| 3300007329|Ga0079240_1355024 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 620 | Open in IMG/M |
| 3300007333|Ga0079270_1125411 | Not Available | 575 | Open in IMG/M |
| 3300007333|Ga0079270_1154674 | Not Available | 954 | Open in IMG/M |
| 3300007333|Ga0079270_1437241 | Not Available | 518 | Open in IMG/M |
| 3300007334|Ga0079269_1473412 | Not Available | 947 | Open in IMG/M |
| 3300007337|Ga0079244_1323573 | Not Available | 639 | Open in IMG/M |
| 3300007608|Ga0102800_1297680 | All Organisms → Viruses → Predicted Viral | 1381 | Open in IMG/M |
| 3300007613|Ga0102799_1061153 | All Organisms → Viruses → Predicted Viral | 1405 | Open in IMG/M |
| 3300007613|Ga0102799_1407913 | Not Available | 691 | Open in IMG/M |
| 3300009342|Ga0103837_1003206 | Not Available | 764 | Open in IMG/M |
| 3300009536|Ga0129295_11744157 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 529 | Open in IMG/M |
| 3300009550|Ga0115013_10336252 | Not Available | 945 | Open in IMG/M |
| 3300009550|Ga0115013_11195644 | Not Available | 553 | Open in IMG/M |
| 3300009593|Ga0115011_10001376 | All Organisms → Viruses | 17495 | Open in IMG/M |
| 3300009790|Ga0115012_10068583 | All Organisms → Viruses → Predicted Viral | 2416 | Open in IMG/M |
| 3300009790|Ga0115012_10310651 | All Organisms → Viruses → Predicted Viral | 1189 | Open in IMG/M |
| 3300009790|Ga0115012_10488493 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 960 | Open in IMG/M |
| 3300009790|Ga0115012_10629419 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Kanaloavirus → unclassified Kanaloavirus → Kanaloavirus sp. | 853 | Open in IMG/M |
| 3300009790|Ga0115012_10750208 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 786 | Open in IMG/M |
| 3300009790|Ga0115012_11285540 | Not Available | 619 | Open in IMG/M |
| 3300009790|Ga0115012_11550910 | Not Available | 571 | Open in IMG/M |
| 3300010148|Ga0098043_1141907 | Not Available | 683 | Open in IMG/M |
| 3300011315|Ga0138402_1036793 | All Organisms → Viruses → Predicted Viral | 1489 | Open in IMG/M |
| 3300011315|Ga0138402_1140468 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → Lipsvirus | 549 | Open in IMG/M |
| 3300011326|Ga0138403_1067126 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → Lipsvirus | 526 | Open in IMG/M |
| 3300011326|Ga0138403_1074321 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Kanaloavirus → unclassified Kanaloavirus → Kanaloavirus sp. | 604 | Open in IMG/M |
| 3300011326|Ga0138403_1249312 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → Lipsvirus | 718 | Open in IMG/M |
| 3300011331|Ga0138384_1094288 | All Organisms → Viruses → Predicted Viral | 1236 | Open in IMG/M |
| 3300012919|Ga0160422_10017280 | All Organisms → Viruses → Predicted Viral | 4202 | Open in IMG/M |
| 3300012919|Ga0160422_10081005 | All Organisms → Viruses → Predicted Viral | 1899 | Open in IMG/M |
| 3300012919|Ga0160422_10107852 | All Organisms → Viruses → Predicted Viral | 1645 | Open in IMG/M |
| 3300012919|Ga0160422_10152014 | Not Available | 1386 | Open in IMG/M |
| 3300012919|Ga0160422_10242343 | All Organisms → Viruses → Predicted Viral | 1100 | Open in IMG/M |
| 3300012919|Ga0160422_10507734 | Not Available | 759 | Open in IMG/M |
| 3300012919|Ga0160422_10794841 | Not Available | 607 | Open in IMG/M |
| 3300012919|Ga0160422_11170491 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Kanaloavirus → unclassified Kanaloavirus → Kanaloavirus sp. | 500 | Open in IMG/M |
| 3300012920|Ga0160423_10155381 | All Organisms → Viruses → Predicted Viral | 1604 | Open in IMG/M |
| 3300012920|Ga0160423_11178368 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 511 | Open in IMG/M |
| 3300012928|Ga0163110_10009698 | All Organisms → Viruses | 5345 | Open in IMG/M |
| 3300012928|Ga0163110_10025585 | All Organisms → Viruses → Predicted Viral | 3525 | Open in IMG/M |
| 3300012928|Ga0163110_10041337 | All Organisms → Viruses → Predicted Viral | 2858 | Open in IMG/M |
| 3300012928|Ga0163110_10235235 | All Organisms → Viruses → Predicted Viral | 1314 | Open in IMG/M |
| 3300012928|Ga0163110_10822792 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae | 731 | Open in IMG/M |
| 3300012928|Ga0163110_11042172 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Libanvirus → unclassified Libanvirus → Cyanophage P-RSM6 | 653 | Open in IMG/M |
| 3300012928|Ga0163110_11190816 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Kanaloavirus → unclassified Kanaloavirus → Kanaloavirus sp. | 612 | Open in IMG/M |
| 3300012928|Ga0163110_11340115 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → Haifavirus → Haifavirus tim68 | 578 | Open in IMG/M |
| 3300012928|Ga0163110_11691901 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae | 516 | Open in IMG/M |
| 3300012928|Ga0163110_11784455 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Kanaloavirus → unclassified Kanaloavirus → Kanaloavirus sp. | 502 | Open in IMG/M |
| 3300012936|Ga0163109_10989540 | Not Available | 614 | Open in IMG/M |
| 3300012936|Ga0163109_11381333 | Not Available | 513 | Open in IMG/M |
| 3300012952|Ga0163180_10030193 | All Organisms → Viruses → Predicted Viral | 3156 | Open in IMG/M |
| 3300012952|Ga0163180_10140399 | All Organisms → Viruses → Predicted Viral | 1593 | Open in IMG/M |
| 3300012952|Ga0163180_10189415 | All Organisms → Viruses → Predicted Viral | 1397 | Open in IMG/M |
| 3300012952|Ga0163180_10219919 | Not Available | 1308 | Open in IMG/M |
| 3300012952|Ga0163180_10950518 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 684 | Open in IMG/M |
| 3300012952|Ga0163180_11329703 | Not Available | 593 | Open in IMG/M |
| 3300012952|Ga0163180_11410946 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 578 | Open in IMG/M |
| 3300012953|Ga0163179_10003342 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 10906 | Open in IMG/M |
| 3300012953|Ga0163179_10118180 | All Organisms → Viruses → Predicted Viral | 1941 | Open in IMG/M |
| 3300012953|Ga0163179_11362743 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Kanaloavirus → unclassified Kanaloavirus → Kanaloavirus sp. | 633 | Open in IMG/M |
| 3300012953|Ga0163179_12115585 | Not Available | 520 | Open in IMG/M |
| 3300012953|Ga0163179_12121542 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Kanaloavirus → unclassified Kanaloavirus → Kanaloavirus sp. | 519 | Open in IMG/M |
| 3300012954|Ga0163111_10326900 | All Organisms → Viruses → Predicted Viral | 1370 | Open in IMG/M |
| 3300012954|Ga0163111_10982906 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Kanaloavirus → unclassified Kanaloavirus → Kanaloavirus sp. | 814 | Open in IMG/M |
| 3300012954|Ga0163111_12685205 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → Haifavirus → Haifavirus tim68 | 508 | Open in IMG/M |
| 3300014030|Ga0116816_1063426 | Not Available | 511 | Open in IMG/M |
| 3300017720|Ga0181383_1006502 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 3161 | Open in IMG/M |
| 3300017720|Ga0181383_1133073 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Thaumasvirus → Thaumasvirus stim4 | 667 | Open in IMG/M |
| 3300017720|Ga0181383_1205455 | Not Available | 522 | Open in IMG/M |
| 3300017738|Ga0181428_1010314 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 2135 | Open in IMG/M |
| 3300017738|Ga0181428_1076868 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 779 | Open in IMG/M |
| 3300017738|Ga0181428_1120185 | Not Available | 616 | Open in IMG/M |
| 3300017738|Ga0181428_1147623 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Kanaloavirus → unclassified Kanaloavirus → Kanaloavirus sp. | 550 | Open in IMG/M |
| 3300017739|Ga0181433_1172255 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Kanaloavirus → unclassified Kanaloavirus → Kanaloavirus sp. | 504 | Open in IMG/M |
| 3300017741|Ga0181421_1062867 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 979 | Open in IMG/M |
| 3300017748|Ga0181393_1022799 | All Organisms → Viruses → Predicted Viral | 1815 | Open in IMG/M |
| 3300017750|Ga0181405_1009472 | All Organisms → Viruses → Predicted Viral | 2798 | Open in IMG/M |
| 3300017753|Ga0181407_1058323 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1001 | Open in IMG/M |
| 3300017755|Ga0181411_1062887 | All Organisms → Viruses → Predicted Viral | 1130 | Open in IMG/M |
| 3300017759|Ga0181414_1109262 | Not Available | 727 | Open in IMG/M |
| 3300017764|Ga0181385_1175364 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 648 | Open in IMG/M |
| 3300017765|Ga0181413_1033416 | All Organisms → Viruses → Predicted Viral | 1608 | Open in IMG/M |
| 3300017765|Ga0181413_1209040 | Not Available | 582 | Open in IMG/M |
| 3300017765|Ga0181413_1229834 | Not Available | 549 | Open in IMG/M |
| 3300017767|Ga0181406_1093962 | Not Available | 910 | Open in IMG/M |
| 3300017767|Ga0181406_1262100 | Not Available | 506 | Open in IMG/M |
| 3300017769|Ga0187221_1117819 | Not Available | 802 | Open in IMG/M |
| 3300017781|Ga0181423_1108173 | All Organisms → Viruses → Predicted Viral | 1086 | Open in IMG/M |
| 3300019025|Ga0193545_10088270 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Kanaloavirus → unclassified Kanaloavirus → Kanaloavirus sp. | 654 | Open in IMG/M |
| 3300020242|Ga0211701_1004572 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 993 | Open in IMG/M |
| 3300020242|Ga0211701_1027015 | Not Available | 518 | Open in IMG/M |
| 3300020245|Ga0211711_1026914 | Not Available | 938 | Open in IMG/M |
| 3300020246|Ga0211707_1005204 | All Organisms → Viruses → Predicted Viral | 1998 | Open in IMG/M |
| 3300020246|Ga0211707_1009325 | All Organisms → Viruses → Predicted Viral | 1448 | Open in IMG/M |
| 3300020246|Ga0211707_1009786 | All Organisms → Viruses → Predicted Viral | 1410 | Open in IMG/M |
| 3300020246|Ga0211707_1021534 | Not Available | 902 | Open in IMG/M |
| 3300020248|Ga0211584_1008744 | All Organisms → Viruses → Predicted Viral | 1471 | Open in IMG/M |
| 3300020248|Ga0211584_1050514 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 646 | Open in IMG/M |
| 3300020249|Ga0211635_1001934 | All Organisms → Viruses → Predicted Viral | 4371 | Open in IMG/M |
| 3300020249|Ga0211635_1034024 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 852 | Open in IMG/M |
| 3300020250|Ga0211627_1059225 | Not Available | 610 | Open in IMG/M |
| 3300020251|Ga0211700_1004422 | All Organisms → Viruses → Predicted Viral | 1768 | Open in IMG/M |
| 3300020251|Ga0211700_1016729 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Libanvirus → unclassified Libanvirus → Libanvirus sp. | 824 | Open in IMG/M |
| 3300020251|Ga0211700_1019265 | Not Available | 759 | Open in IMG/M |
| 3300020252|Ga0211696_1028969 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 679 | Open in IMG/M |
| 3300020255|Ga0211586_1003934 | All Organisms → Viruses → Predicted Viral | 3478 | Open in IMG/M |
| 3300020255|Ga0211586_1023169 | Not Available | 1139 | Open in IMG/M |
| 3300020255|Ga0211586_1073414 | Not Available | 533 | Open in IMG/M |
| 3300020257|Ga0211704_1003210 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 2329 | Open in IMG/M |
| 3300020257|Ga0211704_1008909 | Not Available | 1425 | Open in IMG/M |
| 3300020257|Ga0211704_1035850 | Not Available | 730 | Open in IMG/M |
| 3300020257|Ga0211704_1069381 | Not Available | 529 | Open in IMG/M |
| 3300020259|Ga0211633_1073160 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 554 | Open in IMG/M |
| 3300020260|Ga0211588_1023023 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Kanaloavirus → unclassified Kanaloavirus → Kanaloavirus sp. | 1018 | Open in IMG/M |
| 3300020260|Ga0211588_1052189 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → Lipsvirus | 679 | Open in IMG/M |
| 3300020260|Ga0211588_1072089 | Not Available | 576 | Open in IMG/M |
| 3300020261|Ga0211534_1040271 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 786 | Open in IMG/M |
| 3300020265|Ga0211533_1009447 | All Organisms → Viruses → Predicted Viral | 1825 | Open in IMG/M |
| 3300020265|Ga0211533_1059526 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Kanaloavirus → unclassified Kanaloavirus → Kanaloavirus sp. | 633 | Open in IMG/M |
| 3300020269|Ga0211484_1004171 | All Organisms → Viruses → Predicted Viral | 3514 | Open in IMG/M |
| 3300020269|Ga0211484_1010627 | All Organisms → Viruses → Predicted Viral | 1989 | Open in IMG/M |
| 3300020270|Ga0211671_1016735 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → Lipsvirus | 1459 | Open in IMG/M |
| 3300020274|Ga0211658_1036791 | All Organisms → Viruses → Predicted Viral | 1053 | Open in IMG/M |
| 3300020279|Ga0211634_1020221 | All Organisms → Viruses → Predicted Viral | 1769 | Open in IMG/M |
| 3300020281|Ga0211483_10026872 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → Lipsvirus | 1903 | Open in IMG/M |
| 3300020281|Ga0211483_10146191 | Not Available | 784 | Open in IMG/M |
| 3300020281|Ga0211483_10211830 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 644 | Open in IMG/M |
| 3300020281|Ga0211483_10237540 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 606 | Open in IMG/M |
| 3300020288|Ga0211619_1016052 | All Organisms → Viruses → Predicted Viral | 1148 | Open in IMG/M |
| 3300020296|Ga0211474_1001308 | Not Available | 6166 | Open in IMG/M |
| 3300020296|Ga0211474_1006597 | All Organisms → Viruses → Predicted Viral | 2362 | Open in IMG/M |
| 3300020296|Ga0211474_1007791 | All Organisms → Viruses → Predicted Viral | 2116 | Open in IMG/M |
| 3300020296|Ga0211474_1016730 | All Organisms → Viruses → Predicted Viral | 1303 | Open in IMG/M |
| 3300020297|Ga0211490_1024451 | Not Available | 1161 | Open in IMG/M |
| 3300020297|Ga0211490_1059066 | Not Available | 662 | Open in IMG/M |
| 3300020299|Ga0211615_1026299 | Not Available | 842 | Open in IMG/M |
| 3300020299|Ga0211615_1029863 | Not Available | 796 | Open in IMG/M |
| 3300020299|Ga0211615_1054408 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 610 | Open in IMG/M |
| 3300020299|Ga0211615_1055600 | Not Available | 604 | Open in IMG/M |
| 3300020301|Ga0211650_1057303 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 519 | Open in IMG/M |
| 3300020306|Ga0211616_1061727 | Not Available | 548 | Open in IMG/M |
| 3300020312|Ga0211542_1093914 | Not Available | 518 | Open in IMG/M |
| 3300020319|Ga0211517_1014148 | All Organisms → Viruses → Predicted Viral | 1623 | Open in IMG/M |
| 3300020319|Ga0211517_1041856 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Kanaloavirus → unclassified Kanaloavirus → Kanaloavirus sp. | 909 | Open in IMG/M |
| 3300020319|Ga0211517_1056408 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Kanaloavirus → unclassified Kanaloavirus → Kanaloavirus sp. | 772 | Open in IMG/M |
| 3300020343|Ga0211626_1078169 | Not Available | 799 | Open in IMG/M |
| 3300020345|Ga0211706_1001970 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 5778 | Open in IMG/M |
| 3300020345|Ga0211706_1124308 | Not Available | 511 | Open in IMG/M |
| 3300020367|Ga0211703_10043817 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1061 | Open in IMG/M |
| 3300020367|Ga0211703_10139842 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Kanaloavirus → unclassified Kanaloavirus → Kanaloavirus sp. | 624 | Open in IMG/M |
| 3300020370|Ga0211672_10136693 | Not Available | 751 | Open in IMG/M |
| 3300020370|Ga0211672_10220022 | Not Available | 587 | Open in IMG/M |
| 3300020377|Ga0211647_10056703 | All Organisms → Viruses → Predicted Viral | 1423 | Open in IMG/M |
| 3300020377|Ga0211647_10119975 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 889 | Open in IMG/M |
| 3300020380|Ga0211498_10188405 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → Lipsvirus | 780 | Open in IMG/M |
| 3300020384|Ga0211596_10039859 | All Organisms → Viruses → Predicted Viral | 1627 | Open in IMG/M |
| 3300020386|Ga0211582_10256120 | Not Available | 651 | Open in IMG/M |
| 3300020387|Ga0211590_10250946 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → Lipsvirus | 556 | Open in IMG/M |
| 3300020393|Ga0211618_10293775 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Kanaloavirus → unclassified Kanaloavirus → Kanaloavirus sp. | 542 | Open in IMG/M |
| 3300020401|Ga0211617_10004809 | Not Available | 6280 | Open in IMG/M |
| 3300020401|Ga0211617_10011037 | All Organisms → Viruses → Predicted Viral | 3958 | Open in IMG/M |
| 3300020401|Ga0211617_10167634 | Not Available | 916 | Open in IMG/M |
| 3300020403|Ga0211532_10358857 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 553 | Open in IMG/M |
| 3300020404|Ga0211659_10010815 | All Organisms → Viruses → Predicted Viral | 4584 | Open in IMG/M |
| 3300020404|Ga0211659_10050364 | All Organisms → Viruses → Predicted Viral | 1974 | Open in IMG/M |
| 3300020405|Ga0211496_10042952 | All Organisms → Viruses → Predicted Viral | 1620 | Open in IMG/M |
| 3300020405|Ga0211496_10153513 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 849 | Open in IMG/M |
| 3300020405|Ga0211496_10311315 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Kanaloavirus → unclassified Kanaloavirus → Kanaloavirus sp. | 588 | Open in IMG/M |
| 3300020406|Ga0211668_10038445 | All Organisms → Viruses → Predicted Viral | 2198 | Open in IMG/M |
| 3300020408|Ga0211651_10149188 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae | 934 | Open in IMG/M |
| 3300020408|Ga0211651_10199058 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 781 | Open in IMG/M |
| 3300020409|Ga0211472_10081961 | All Organisms → Viruses → Predicted Viral | 1265 | Open in IMG/M |
| 3300020409|Ga0211472_10426673 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Kanaloavirus → unclassified Kanaloavirus → Kanaloavirus sp. | 534 | Open in IMG/M |
| 3300020409|Ga0211472_10453213 | Not Available | 516 | Open in IMG/M |
| 3300020410|Ga0211699_10070163 | All Organisms → Viruses → Predicted Viral | 1296 | Open in IMG/M |
| 3300020410|Ga0211699_10087795 | All Organisms → Viruses → Predicted Viral | 1152 | Open in IMG/M |
| 3300020410|Ga0211699_10232699 | Not Available | 709 | Open in IMG/M |
| 3300020410|Ga0211699_10320005 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → Lipsvirus | 607 | Open in IMG/M |
| 3300020410|Ga0211699_10416870 | Not Available | 532 | Open in IMG/M |
| 3300020411|Ga0211587_10037907 | All Organisms → Viruses → Predicted Viral | 2261 | Open in IMG/M |
| 3300020411|Ga0211587_10105259 | All Organisms → Viruses → Predicted Viral | 1222 | Open in IMG/M |
| 3300020411|Ga0211587_10134074 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 1058 | Open in IMG/M |
| 3300020411|Ga0211587_10252284 | Not Available | 730 | Open in IMG/M |
| 3300020413|Ga0211516_10316025 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 700 | Open in IMG/M |
| 3300020413|Ga0211516_10426635 | Not Available | 586 | Open in IMG/M |
| 3300020416|Ga0211644_10037788 | All Organisms → Viruses → Predicted Viral | 1959 | Open in IMG/M |
| 3300020416|Ga0211644_10215467 | Not Available | 788 | Open in IMG/M |
| 3300020418|Ga0211557_10004500 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 8959 | Open in IMG/M |
| 3300020419|Ga0211512_10124803 | All Organisms → Viruses → Predicted Viral | 1199 | Open in IMG/M |
| 3300020419|Ga0211512_10236776 | Not Available | 834 | Open in IMG/M |
| 3300020419|Ga0211512_10437926 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 587 | Open in IMG/M |
| 3300020420|Ga0211580_10064465 | All Organisms → Viruses → Predicted Viral | 1550 | Open in IMG/M |
| 3300020420|Ga0211580_10067436 | All Organisms → Viruses → Predicted Viral | 1512 | Open in IMG/M |
| 3300020420|Ga0211580_10120977 | All Organisms → Viruses → Predicted Viral | 1094 | Open in IMG/M |
| 3300020424|Ga0211620_10346281 | Not Available | 632 | Open in IMG/M |
| 3300020424|Ga0211620_10383417 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 597 | Open in IMG/M |
| 3300020424|Ga0211620_10515557 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Kanaloavirus → unclassified Kanaloavirus → Kanaloavirus sp. | 501 | Open in IMG/M |
| 3300020426|Ga0211536_10083032 | All Organisms → Viruses → Predicted Viral | 1250 | Open in IMG/M |
| 3300020426|Ga0211536_10162112 | Not Available | 871 | Open in IMG/M |
| 3300020430|Ga0211622_10230511 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Kanaloavirus → unclassified Kanaloavirus → Kanaloavirus sp. | 794 | Open in IMG/M |
| 3300020430|Ga0211622_10435815 | Not Available | 561 | Open in IMG/M |
| 3300020433|Ga0211565_10012706 | All Organisms → Viruses → Predicted Viral | 3568 | Open in IMG/M |
| 3300020433|Ga0211565_10017722 | Not Available | 3000 | Open in IMG/M |
| 3300020433|Ga0211565_10024416 | All Organisms → Viruses → Predicted Viral | 2548 | Open in IMG/M |
| 3300020433|Ga0211565_10469329 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → Haifavirus → Haifavirus tim68 | 548 | Open in IMG/M |
| 3300020433|Ga0211565_10505431 | Not Available | 525 | Open in IMG/M |
| 3300020436|Ga0211708_10200453 | Not Available | 802 | Open in IMG/M |
| 3300020436|Ga0211708_10220177 | Not Available | 765 | Open in IMG/M |
| 3300020436|Ga0211708_10401865 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 562 | Open in IMG/M |
| 3300020437|Ga0211539_10134094 | Not Available | 1006 | Open in IMG/M |
| 3300020437|Ga0211539_10171877 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 887 | Open in IMG/M |
| 3300020437|Ga0211539_10403289 | Not Available | 570 | Open in IMG/M |
| 3300020437|Ga0211539_10472819 | Not Available | 522 | Open in IMG/M |
| 3300020437|Ga0211539_10494844 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Kanaloavirus → unclassified Kanaloavirus → Kanaloavirus sp. | 509 | Open in IMG/M |
| 3300020442|Ga0211559_10332102 | Not Available | 706 | Open in IMG/M |
| 3300020442|Ga0211559_10337817 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae | 700 | Open in IMG/M |
| 3300020442|Ga0211559_10532433 | Not Available | 535 | Open in IMG/M |
| 3300020448|Ga0211638_10006791 | All Organisms → Viruses → Predicted Viral | 4856 | Open in IMG/M |
| 3300020448|Ga0211638_10545165 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 546 | Open in IMG/M |
| 3300020448|Ga0211638_10545927 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Kanaloavirus → unclassified Kanaloavirus → Kanaloavirus sp. | 546 | Open in IMG/M |
| 3300020450|Ga0211641_10000125 | Not Available | 52754 | Open in IMG/M |
| 3300020450|Ga0211641_10066769 | All Organisms → Viruses → Predicted Viral | 1871 | Open in IMG/M |
| 3300020451|Ga0211473_10038960 | All Organisms → Viruses → Predicted Viral | 2371 | Open in IMG/M |
| 3300020451|Ga0211473_10334030 | Not Available | 777 | Open in IMG/M |
| 3300020451|Ga0211473_10418972 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Thaumasvirus → Thaumasvirus stim4 | 685 | Open in IMG/M |
| 3300020451|Ga0211473_10664271 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → Lipsvirus | 524 | Open in IMG/M |
| 3300020451|Ga0211473_10715799 | Not Available | 501 | Open in IMG/M |
| 3300020452|Ga0211545_10365045 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Tevenvirinae → Tequatrovirus | 658 | Open in IMG/M |
| 3300020454|Ga0211548_10079206 | All Organisms → Viruses → Predicted Viral | 1558 | Open in IMG/M |
| 3300020461|Ga0211535_10060376 | All Organisms → Viruses → Predicted Viral | 1590 | Open in IMG/M |
| 3300020462|Ga0211546_10295169 | Not Available | 810 | Open in IMG/M |
| 3300020467|Ga0211713_10034697 | All Organisms → Viruses → Predicted Viral | 2495 | Open in IMG/M |
| 3300020467|Ga0211713_10050227 | All Organisms → Viruses → Predicted Viral | 2039 | Open in IMG/M |
| 3300020467|Ga0211713_10147309 | All Organisms → Viruses → Predicted Viral | 1135 | Open in IMG/M |
| 3300020467|Ga0211713_10568880 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Kanaloavirus → unclassified Kanaloavirus → Kanaloavirus sp. | 551 | Open in IMG/M |
| 3300020467|Ga0211713_10654085 | Not Available | 511 | Open in IMG/M |
| 3300020468|Ga0211475_10006103 | Not Available | 8044 | Open in IMG/M |
| 3300020469|Ga0211577_10299479 | All Organisms → Viruses → Predicted Viral | 1020 | Open in IMG/M |
| 3300020470|Ga0211543_10023392 | All Organisms → Viruses → Predicted Viral | 3436 | Open in IMG/M |
| 3300020470|Ga0211543_10271474 | Not Available | 828 | Open in IMG/M |
| 3300020470|Ga0211543_10334152 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Kanaloavirus → unclassified Kanaloavirus → Kanaloavirus sp. | 733 | Open in IMG/M |
| 3300020471|Ga0211614_10018547 | All Organisms → Viruses → Predicted Viral | 2884 | Open in IMG/M |
| 3300020471|Ga0211614_10027546 | All Organisms → Viruses → Predicted Viral | 2360 | Open in IMG/M |
| 3300020471|Ga0211614_10293423 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Kanaloavirus → unclassified Kanaloavirus → Kanaloavirus sp. | 712 | Open in IMG/M |
| 3300020474|Ga0211547_10597935 | Not Available | 546 | Open in IMG/M |
| 3300020478|Ga0211503_10520875 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Kanaloavirus → unclassified Kanaloavirus → Kanaloavirus sp. | 626 | Open in IMG/M |
| 3300021791|Ga0226832_10429055 | Not Available | 560 | Open in IMG/M |
| 3300021792|Ga0226836_10657144 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 598 | Open in IMG/M |
| 3300021974|Ga0232645_1305850 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Kanaloavirus → unclassified Kanaloavirus → Kanaloavirus sp. | 532 | Open in IMG/M |
| 3300021977|Ga0232639_1047748 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Libanvirus → unclassified Libanvirus → Libanvirus sp. | 1609 | Open in IMG/M |
| 3300022074|Ga0224906_1130608 | Not Available | 721 | Open in IMG/M |
| 3300025086|Ga0208157_1000090 | All Organisms → Viruses | 60031 | Open in IMG/M |
| 3300025101|Ga0208159_1055916 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 801 | Open in IMG/M |
| 3300025127|Ga0209348_1001715 | All Organisms → Viruses | 10554 | Open in IMG/M |
| 3300025127|Ga0209348_1036511 | All Organisms → Viruses → Predicted Viral | 1731 | Open in IMG/M |
| 3300025127|Ga0209348_1043241 | All Organisms → Viruses → Predicted Viral | 1554 | Open in IMG/M |
| 3300025127|Ga0209348_1047509 | All Organisms → Viruses → Predicted Viral | 1462 | Open in IMG/M |
| 3300025127|Ga0209348_1056267 | All Organisms → Viruses → Predicted Viral | 1310 | Open in IMG/M |
| 3300025127|Ga0209348_1074246 | All Organisms → Viruses → Predicted Viral | 1096 | Open in IMG/M |
| 3300025127|Ga0209348_1078162 | All Organisms → Viruses → Predicted Viral | 1060 | Open in IMG/M |
| 3300025127|Ga0209348_1107934 | Not Available | 857 | Open in IMG/M |
| 3300025127|Ga0209348_1129356 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 758 | Open in IMG/M |
| 3300025127|Ga0209348_1158498 | Not Available | 660 | Open in IMG/M |
| 3300025127|Ga0209348_1161305 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae | 652 | Open in IMG/M |
| 3300025127|Ga0209348_1168749 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Kanaloavirus → unclassified Kanaloavirus → Kanaloavirus sp. | 632 | Open in IMG/M |
| 3300025127|Ga0209348_1197209 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → Haifavirus → Haifavirus tim68 | 564 | Open in IMG/M |
| 3300025127|Ga0209348_1218204 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Kanaloavirus → unclassified Kanaloavirus → Kanaloavirus sp. | 523 | Open in IMG/M |
| 3300025132|Ga0209232_1022790 | All Organisms → Viruses → Predicted Viral | 2450 | Open in IMG/M |
| 3300025151|Ga0209645_1003258 | All Organisms → Viruses | 7457 | Open in IMG/M |
| 3300025151|Ga0209645_1122261 | All Organisms → Viruses | 824 | Open in IMG/M |
| 3300025151|Ga0209645_1213838 | Not Available | 560 | Open in IMG/M |
| 3300026077|Ga0208749_1003829 | All Organisms → Viruses → Predicted Viral | 3230 | Open in IMG/M |
| 3300026077|Ga0208749_1015343 | All Organisms → Viruses → Predicted Viral | 1607 | Open in IMG/M |
| 3300026081|Ga0208390_1021931 | All Organisms → Viruses → Predicted Viral | 1848 | Open in IMG/M |
| 3300026081|Ga0208390_1024087 | Not Available | 1743 | Open in IMG/M |
| 3300026083|Ga0208878_1010632 | All Organisms → Viruses → Predicted Viral | 2710 | Open in IMG/M |
| 3300026083|Ga0208878_1078729 | Not Available | 827 | Open in IMG/M |
| 3300026093|Ga0208624_1033084 | All Organisms → Viruses → Predicted Viral | 1384 | Open in IMG/M |
| 3300026136|Ga0208763_1027099 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 871 | Open in IMG/M |
| 3300026189|Ga0208405_1002608 | Not Available | 3029 | Open in IMG/M |
| 3300026189|Ga0208405_1029072 | Not Available | 856 | Open in IMG/M |
| 3300026189|Ga0208405_1053970 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae | 602 | Open in IMG/M |
| 3300026189|Ga0208405_1061748 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Kanaloavirus → unclassified Kanaloavirus → Kanaloavirus sp. | 554 | Open in IMG/M |
| 3300026203|Ga0207985_1022315 | All Organisms → Viruses → Predicted Viral | 1664 | Open in IMG/M |
| 3300026203|Ga0207985_1045068 | All Organisms → Viruses → Predicted Viral | 1104 | Open in IMG/M |
| 3300026270|Ga0207993_1002135 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 7558 | Open in IMG/M |
| 3300026270|Ga0207993_1008381 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 3543 | Open in IMG/M |
| 3300026270|Ga0207993_1111950 | Not Available | 730 | Open in IMG/M |
| 3300026270|Ga0207993_1168141 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 565 | Open in IMG/M |
| 3300027702|Ga0209036_1051264 | All Organisms → Viruses → Predicted Viral | 1331 | Open in IMG/M |
| 3300027702|Ga0209036_1055794 | Not Available | 1262 | Open in IMG/M |
| 3300027702|Ga0209036_1078406 | All Organisms → Viruses → Predicted Viral | 1017 | Open in IMG/M |
| 3300027702|Ga0209036_1096615 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → Lipsvirus | 892 | Open in IMG/M |
| 3300027702|Ga0209036_1211932 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → Lipsvirus | 541 | Open in IMG/M |
| 3300027774|Ga0209433_10059518 | All Organisms → Viruses → Predicted Viral | 1373 | Open in IMG/M |
| 3300027774|Ga0209433_10227368 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → Haifavirus → Haifavirus tim68 | 701 | Open in IMG/M |
| 3300027830|Ga0209359_10316771 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 715 | Open in IMG/M |
| 3300027830|Ga0209359_10352040 | Not Available | 678 | Open in IMG/M |
| 3300027830|Ga0209359_10600388 | Not Available | 507 | Open in IMG/M |
| 3300029319|Ga0183748_1041039 | Not Available | 1390 | Open in IMG/M |
| 3300029319|Ga0183748_1042791 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Kanaloavirus → unclassified Kanaloavirus → Kanaloavirus sp. | 1345 | Open in IMG/M |
| 3300029319|Ga0183748_1066207 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → Lipsvirus | 949 | Open in IMG/M |
| 3300029319|Ga0183748_1136736 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Kanaloavirus → unclassified Kanaloavirus → Kanaloavirus sp. | 504 | Open in IMG/M |
| 3300029792|Ga0183826_1051069 | Not Available | 635 | Open in IMG/M |
| 3300030780|Ga0073988_12301137 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Kanaloavirus → unclassified Kanaloavirus → Kanaloavirus sp. | 502 | Open in IMG/M |
| 3300031785|Ga0310343_10030770 | All Organisms → Viruses → Predicted Viral | 3131 | Open in IMG/M |
| 3300031785|Ga0310343_10312215 | All Organisms → Viruses → Predicted Viral | 1116 | Open in IMG/M |
| 3300031785|Ga0310343_10312724 | All Organisms → Viruses → Predicted Viral | 1116 | Open in IMG/M |
| 3300031785|Ga0310343_10408154 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae | 986 | Open in IMG/M |
| 3300031785|Ga0310343_10778151 | Not Available | 718 | Open in IMG/M |
| 3300031785|Ga0310343_11060040 | Not Available | 613 | Open in IMG/M |
| 3300032011|Ga0315316_10143189 | All Organisms → Viruses → Predicted Viral | 1979 | Open in IMG/M |
| 3300032047|Ga0315330_10062897 | All Organisms → Viruses → Predicted Viral | 2471 | Open in IMG/M |
| 3300032047|Ga0315330_10290678 | All Organisms → Viruses → Predicted Viral | 1033 | Open in IMG/M |
| 3300032047|Ga0315330_10754814 | Not Available | 562 | Open in IMG/M |
| 3300032073|Ga0315315_10227152 | All Organisms → Viruses → Predicted Viral | 1742 | Open in IMG/M |
| 3300032820|Ga0310342_100164903 | All Organisms → Viruses → Predicted Viral | 2188 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 33.46% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 27.53% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 14.53% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 4.59% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 3.25% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine | 2.87% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 2.29% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 1.72% |
| Marine Water | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Water | 1.53% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Seawater | 1.53% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 1.34% |
| Volcanic Co2 Seep Seawater | Environmental → Aquatic → Marine → Volcanic → Unclassified → Volcanic Co2 Seep Seawater | 1.15% |
| Hydrothermal Vent Fluids | Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Hydrothermal Vent Fluids | 0.76% |
| Marine Benthic Sponge Stylissa Massa Associated | Host-Associated → Porifera → Unclassified → Unclassified → Unclassified → Marine Benthic Sponge Stylissa Massa Associated | 0.76% |
| Marine Plankton | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Plankton | 0.38% |
| Diffuse Hydrothermal Fluid | Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Diffuse Hydrothermal Fluid | 0.38% |
| River Water | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water | 0.19% |
| Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Marine | 0.19% |
| Diffuse Hydrothermal Flow Volcanic Vent | Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Diffuse Hydrothermal Flow Volcanic Vent | 0.19% |
| Volcanic Co2 Seeps | Environmental → Aquatic → Marine → Volcanic → Unclassified → Volcanic Co2 Seeps | 0.19% |
| Macroalgal Surface | Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface | 0.19% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 0.96% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2014642000 | Marine planktonic communities from Hawaii Ocean Times Series Station (HOT/ALOHA) - 2_Upper_euphotic_70m | Environmental | Open in IMG/M |
| 3300000973 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY93 | Host-Associated | Open in IMG/M |
| 3300001778 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - ACM18, ROCA_DNA027_0.2um_3g | Environmental | Open in IMG/M |
| 3300001832 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - ACM6, ROCA_DNA131_0.2um_27b | Environmental | Open in IMG/M |
| 3300001945 | Marine microbial communities from Galapagos, Equador - GS026 | Environmental | Open in IMG/M |
| 3300001951 | Marine microbial communities from North Seamore Island, Equador - GS034 | Environmental | Open in IMG/M |
| 3300001953 | Marine microbial communities from Key West, Florida, USA - GS015 | Environmental | Open in IMG/M |
| 3300001954 | Marine microbial communities from Colon, Panama - GS019 | Environmental | Open in IMG/M |
| 3300001960 | Marine microbial communities from South of Charleston, South Carolina, USA - GS014 | Environmental | Open in IMG/M |
| 3300001961 | Marine microbial communities from Dirty Rock, Cocos Island, Costa Rica - GS025 | Environmental | Open in IMG/M |
| 3300001962 | Marine microbial communities from Cocos Island, Costa Rica - GS023 | Environmental | Open in IMG/M |
| 3300001964 | Marine microbial communities from Rosario Bank, Honduras - GS018 | Environmental | Open in IMG/M |
| 3300001966 | Marine microbial communities from Roca Redonda, Equador - GS030 | Environmental | Open in IMG/M |
| 3300001967 | Marine microbial communities from Devil's Crown, Floreana Island, Equador - GS027 | Environmental | Open in IMG/M |
| 3300001969 | Marine microbial communities from Yucatan Channel, Mexico - GS017 | Environmental | Open in IMG/M |
| 3300002482 | Marine viral communities from the Pacific Ocean - ETNP_2_30 | Environmental | Open in IMG/M |
| 3300002483 | Marine viral communities from the Pacific Ocean - ETNP_6_30 | Environmental | Open in IMG/M |
| 3300002955 | Marine microbial communities from the Southern Atlantic Ocean, analyzing organic carbon cycling - DCM_A/KNORR_S2/LV | Environmental | Open in IMG/M |
| 3300003185 | Marine microbial communities from the Southern Atlantic Ocean, analyzing organic carbon cycling - Surface_A/KNORR_S2/LV | Environmental | Open in IMG/M |
| 3300004951 | Marine water microbial communities from the East Sea, Korea with extracellular vesicles - East-Sea-EVs | Environmental | Open in IMG/M |
| 3300005057 | Marine water microbial communities from the East Sea, Korea with extracellular vesicles - East-Sea-0.2um | Environmental | Open in IMG/M |
| 3300005074 | Marine benthic sponge Stylissa massa associated microbial communities from Guam, USA | Host-Associated | Open in IMG/M |
| 3300005097 | MiSeq S massa metagenome | Host-Associated | Open in IMG/M |
| 3300005404 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV205 | Environmental | Open in IMG/M |
| 3300005432 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201310SV78 | Environmental | Open in IMG/M |
| 3300005433 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF45B | Environmental | Open in IMG/M |
| 3300005523 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F12-01SV265 | Environmental | Open in IMG/M |
| 3300005606 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV84 | Environmental | Open in IMG/M |
| 3300005608 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302PF84A | Environmental | Open in IMG/M |
| 3300005934 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S23_td_SurfaceB_ad_5m_LV_B | Environmental | Open in IMG/M |
| 3300005960 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S7_td_SurfaceA_ad_6m_LV_A | Environmental | Open in IMG/M |
| 3300005971 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_SurfaceA_ad_5m_LV_A | Environmental | Open in IMG/M |
| 3300006024 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_DCM_ad_63m_LV_B | Environmental | Open in IMG/M |
| 3300006077 | Microbial communities in diffuse hydrothermal fluids of Manus Basin, Bismarck Sea ? fluid B | Environmental | Open in IMG/M |
| 3300006083 | Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample FS908_Marker33_DNA | Environmental | Open in IMG/M |
| 3300006305 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_1_0025m | Environmental | Open in IMG/M |
| 3300006329 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT233_1_0500m | Environmental | Open in IMG/M |
| 3300006334 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT224_1_0025m | Environmental | Open in IMG/M |
| 3300006345 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT224_1_0075m | Environmental | Open in IMG/M |
| 3300006350 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT225_1_0075m | Environmental | Open in IMG/M |
| 3300006351 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT225_1_0045m | Environmental | Open in IMG/M |
| 3300006377 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - KN S5 Surf_A metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006413 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_2_0025m | Environmental | Open in IMG/M |
| 3300006480 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT231_1_0075m | Environmental | Open in IMG/M |
| 3300006481 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT231_2_0025m | Environmental | Open in IMG/M |
| 3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
| 3300006737 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG | Environmental | Open in IMG/M |
| 3300006749 | Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG | Environmental | Open in IMG/M |
| 3300007113 | Seawater microbiome, Papua New Guinea CO2 seep, Upa-Upasina 'bubble' site, Water-is | Environmental | Open in IMG/M |
| 3300007114 | Seawater microbiome, Papua New Guinea CO2 seep, Upa-Upasina 'bubble', waterEBis4 | Environmental | Open in IMG/M |
| 3300007116 | Seawater microbiome, Papua New Guinea CO2 seep, Upa-Upasina 'bubble' site, waterEBis3 | Environmental | Open in IMG/M |
| 3300007133 | Seawater microbiome, Papua New Guinea CO2 seep, Dobu 'bubble', water-ds | Environmental | Open in IMG/M |
| 3300007329 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - KN S5 c16 Surf_B metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300007333 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - KN S12 Surf_B metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300007334 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - KN S12 Surf_A metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300007337 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - KN S7 Surf_B metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300007608 | Marine microbial communities from the Southern Atlantic ocean - KN S19 Surf_B metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300007613 | Marine microbial communities from the Southern Atlantic ocean - KN S19 Surf_A metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009342 | Microbial communities of water from the North Atlantic ocean - ACM59 | Environmental | Open in IMG/M |
| 3300009536 | Marine microbial communities associated with Trichodesmium colonies (puff morphology) from Station ALOHA, North Pacific Subtropical Gyre ? E19 | Environmental | Open in IMG/M |
| 3300009550 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 Metagenome | Environmental | Open in IMG/M |
| 3300009593 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome | Environmental | Open in IMG/M |
| 3300009790 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT10 Metagenome | Environmental | Open in IMG/M |
| 3300010148 | Marine viral communities from the Subarctic Pacific Ocean - 9B_ETSP_OMZ_AT15188_CsCl metaG | Environmental | Open in IMG/M |
| 3300011315 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - KN S21 Surf_A metaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011326 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - KN S21 Surf_B metaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011331 | Marine microbial communities from the Southern Atlantic ocean - KN S17 Surf_B metaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300012919 | Marine microbial communities from the Central Pacific Ocean - Fk160115 60m metaG | Environmental | Open in IMG/M |
| 3300012920 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaG | Environmental | Open in IMG/M |
| 3300012928 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St17 metaG | Environmental | Open in IMG/M |
| 3300012936 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St13 metaG | Environmental | Open in IMG/M |
| 3300012952 | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 4 Metagenome | Environmental | Open in IMG/M |
| 3300012953 | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 Metagenome | Environmental | Open in IMG/M |
| 3300012954 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaG | Environmental | Open in IMG/M |
| 3300014030 | Marine hypoxic microbial communities from the Gulf of Mexico, USA - 11m_Station1_GOM_Metagenome | Environmental | Open in IMG/M |
| 3300017720 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 | Environmental | Open in IMG/M |
| 3300017738 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 51 SPOT_SRF_2014-02-12 | Environmental | Open in IMG/M |
| 3300017739 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 | Environmental | Open in IMG/M |
| 3300017741 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 44 SPOT_SRF_2013-06-19 | Environmental | Open in IMG/M |
| 3300017748 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 16 SPOT_SRF_2010-10-21 | Environmental | Open in IMG/M |
| 3300017750 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 28 SPOT_SRF_2011-11-29 | Environmental | Open in IMG/M |
| 3300017753 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 30 SPOT_SRF_2012-01-26 | Environmental | Open in IMG/M |
| 3300017755 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 34 SPOT_SRF_2012-07-09 | Environmental | Open in IMG/M |
| 3300017759 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 37 SPOT_SRF_2012-11-28 | Environmental | Open in IMG/M |
| 3300017764 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 8 SPOT_SRF_2010-02-11 | Environmental | Open in IMG/M |
| 3300017765 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 36 SPOT_SRF_2012-09-28 | Environmental | Open in IMG/M |
| 3300017767 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 29 SPOT_SRF_2011-12-20 | Environmental | Open in IMG/M |
| 3300017769 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 (version 2) | Environmental | Open in IMG/M |
| 3300017781 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14 | Environmental | Open in IMG/M |
| 3300019025 | Metatranscriptome of marine prokaryotic communities collected during Tara Oceans survey from station TARA_151 - TARA_B100001565 (ERX1399745-ERR1328126) | Environmental | Open in IMG/M |
| 3300020242 | Marine prokaryotic communities collected during Tara Oceans survey from station TARA_076 - TARA_B100000513 (ERX555995-ERR599010) | Environmental | Open in IMG/M |
| 3300020245 | Marine microbial communities from Tara Oceans - TARA_B100000459 (ERX556111-ERR599135) | Environmental | Open in IMG/M |
| 3300020246 | Marine microbial communities from Tara Oceans - TARA_B100000424 (ERX555934-ERR599105) | Environmental | Open in IMG/M |
| 3300020248 | Marine microbial communities from Tara Oceans - TARA_B100000123 (ERX556118-ERR599141) | Environmental | Open in IMG/M |
| 3300020249 | Marine microbial communities from Tara Oceans - TARA_B100000482 (ERX556038-ERR599056) | Environmental | Open in IMG/M |
| 3300020250 | Marine microbial communities from Tara Oceans - TARA_B100000475 (ERX555986-ERR599129) | Environmental | Open in IMG/M |
| 3300020251 | Marine microbial communities from Tara Oceans - TARA_B100000519 (ERX555940-ERR599040) | Environmental | Open in IMG/M |
| 3300020252 | Marine prokaryotic communities collected during Tara Oceans survey from station TARA_078 - TARA_B100000524 (ERX555968-ERR599022) | Environmental | Open in IMG/M |
| 3300020255 | Marine microbial communities from Tara Oceans - TARA_B100000131 (ERX556136-ERR599013) | Environmental | Open in IMG/M |
| 3300020257 | Marine microbial communities from Tara Oceans - TARA_B100000508 (ERX555911-ERR599048) | Environmental | Open in IMG/M |
| 3300020259 | Marine microbial communities from Tara Oceans - TARA_B100000482 (ERX556041-ERR599103) | Environmental | Open in IMG/M |
| 3300020260 | Marine microbial communities from Tara Oceans - TARA_B100000405 (ERX556087-ERR599025) | Environmental | Open in IMG/M |
| 3300020261 | Marine microbial communities from Tara Oceans - TARA_B100000401 (ERX556096-ERR598970) | Environmental | Open in IMG/M |
| 3300020265 | Marine microbial communities from Tara Oceans - TARA_B100000401 (ERX556012-ERR599088) | Environmental | Open in IMG/M |
| 3300020269 | Marine microbial communities from Tara Oceans - TARA_A100001035 (ERX556080-ERR599041) | Environmental | Open in IMG/M |
| 3300020270 | Marine microbial communities from Tara Oceans - TARA_B100001029 (ERX555928-ERR599042) | Environmental | Open in IMG/M |
| 3300020274 | Marine microbial communities from Tara Oceans - TARA_B100000900 (ERX556029-ERR598943) | Environmental | Open in IMG/M |
| 3300020279 | Marine microbial communities from Tara Oceans - TARA_B100000482 (ERX555939-ERR599017) | Environmental | Open in IMG/M |
| 3300020281 | Marine microbial communities from Tara Oceans - TARA_A100001035 (ERX556022-ERR599116) | Environmental | Open in IMG/M |
| 3300020288 | Marine microbial communities from Tara Oceans - TARA_B100000161 (ERX556132-ERR599045) | Environmental | Open in IMG/M |
| 3300020296 | Marine microbial communities from Tara Oceans - TARA_A100000164 (ERX556002-ERR599140) | Environmental | Open in IMG/M |
| 3300020297 | Marine microbial communities from Tara Oceans - TARA_B000000437 (ERX555970-ERR598979) | Environmental | Open in IMG/M |
| 3300020299 | Marine microbial communities from Tara Oceans - TARA_B100000214 (ERX555923-ERR599016) | Environmental | Open in IMG/M |
| 3300020301 | Marine microbial communities from Tara Oceans - TARA_B100000925 (ERX556086-ERR598997) | Environmental | Open in IMG/M |
| 3300020306 | Marine microbial communities from Tara Oceans - TARA_B100000212 (ERX556014-ERR599098) | Environmental | Open in IMG/M |
| 3300020312 | Marine microbial communities from Tara Oceans - TARA_B100000287 (ERX556125-ERR598977) | Environmental | Open in IMG/M |
| 3300020319 | Marine microbial communities from Tara Oceans - TARA_S200000501 (ERX556039-ERR599073) | Environmental | Open in IMG/M |
| 3300020343 | Marine microbial communities from Tara Oceans - TARA_B100000475 (ERX555975-ERR599174) | Environmental | Open in IMG/M |
| 3300020345 | Marine microbial communities from Tara Oceans - TARA_B100000427 (ERX556079-ERR599137) | Environmental | Open in IMG/M |
| 3300020367 | Marine microbial communities from Tara Oceans - TARA_B100000508 (ERX556112-ERR599005) | Environmental | Open in IMG/M |
| 3300020370 | Marine microbial communities from Tara Oceans - TARA_B100001029 (ERX556065-ERR599079) | Environmental | Open in IMG/M |
| 3300020377 | Marine microbial communities from Tara Oceans - TARA_B100000927 (ERX556007-ERR599065) | Environmental | Open in IMG/M |
| 3300020380 | Marine microbial communities from Tara Oceans - TARA_B000000565 (ERX555945-ERR599058) | Environmental | Open in IMG/M |
| 3300020384 | Marine microbial communities from Tara Oceans - TARA_B000000441 (ERX556023-ERR599110) | Environmental | Open in IMG/M |
| 3300020386 | Marine microbial communities from Tara Oceans - TARA_B100000609 (ERX555990-ERR599038) | Environmental | Open in IMG/M |
| 3300020387 | Marine microbial communities from Tara Oceans - TARA_B100000405 (ERX556119-ERR599023) | Environmental | Open in IMG/M |
| 3300020393 | Marine microbial communities from Tara Oceans - TARA_B100000161 (ERX556105-ERR599054) | Environmental | Open in IMG/M |
| 3300020401 | Marine microbial communities from Tara Oceans - TARA_B100000212 (ERX555985-ERR599139) | Environmental | Open in IMG/M |
| 3300020403 | Marine microbial communities from Tara Oceans - TARA_B100000085 (ERX556015-ERR599145) | Environmental | Open in IMG/M |
| 3300020404 | Marine microbial communities from Tara Oceans - TARA_B100000900 (ERX555954-ERR598978) | Environmental | Open in IMG/M |
| 3300020405 | Marine microbial communities from Tara Oceans - TARA_B000000532 (ERX556129-ERR599012) | Environmental | Open in IMG/M |
| 3300020406 | Marine microbial communities from Tara Oceans - TARA_B100000886 (ERX555926-ERR599024) | Environmental | Open in IMG/M |
| 3300020408 | Marine microbial communities from Tara Oceans - TARA_B100000925 (ERX555963-ERR599118) | Environmental | Open in IMG/M |
| 3300020409 | Marine microbial communities from Tara Oceans - TARA_A100001403 (ERX555912-ERR599106) | Environmental | Open in IMG/M |
| 3300020410 | Marine microbial communities from Tara Oceans - TARA_B100000519 (ERX555959-ERR599148) | Environmental | Open in IMG/M |
| 3300020411 | Marine microbial communities from Tara Oceans - TARA_B100000131 (ERX556098-ERR599130) | Environmental | Open in IMG/M |
| 3300020413 | Marine microbial communities from Tara Oceans - TARA_S200000501 (ERX555962-ERR599092) | Environmental | Open in IMG/M |
| 3300020416 | Marine microbial communities from Tara Oceans - TARA_B100001109 (ERX556137-ERR599039) | Environmental | Open in IMG/M |
| 3300020418 | Marine microbial communities from Tara Oceans - TARA_B100002051 (ERX556028-ERR599136) | Environmental | Open in IMG/M |
| 3300020419 | Marine microbial communities from Tara Oceans - TARA_X000000263 (ERX555964-ERR598955) | Environmental | Open in IMG/M |
| 3300020420 | Marine microbial communities from Tara Oceans - TARA_B100001248 (ERX556094-ERR599142) | Environmental | Open in IMG/M |
| 3300020424 | Marine microbial communities from Tara Oceans - TARA_B100000242 (ERX556056-ERR599138) | Environmental | Open in IMG/M |
| 3300020426 | Marine microbial communities from Tara Oceans - TARA_B100000378 (ERX555992-ERR599112) | Environmental | Open in IMG/M |
| 3300020430 | Marine microbial communities from Tara Oceans - TARA_B100000683 (ERX556126-ERR599160) | Environmental | Open in IMG/M |
| 3300020433 | Marine microbial communities from Tara Oceans - TARA_B100001989 (ERX556106-ERR599030) | Environmental | Open in IMG/M |
| 3300020436 | Marine microbial communities from Tara Oceans - TARA_B100000424 (ERX556009-ERR598984) | Environmental | Open in IMG/M |
| 3300020437 | Marine microbial communities from Tara Oceans - TARA_B100000282 (ERX555906-ERR599074) | Environmental | Open in IMG/M |
| 3300020442 | Marine microbial communities from Tara Oceans - TARA_B100002019 (ERX556121-ERR599162) | Environmental | Open in IMG/M |
| 3300020448 | Marine microbial communities from Tara Oceans - TARA_B100000941 (ERX555919-ERR598954) | Environmental | Open in IMG/M |
| 3300020450 | Marine microbial communities from Tara Oceans - TARA_B100000575 (ERX555933-ERR599077) | Environmental | Open in IMG/M |
| 3300020451 | Marine microbial communities from Tara Oceans - TARA_B100001778 (ERX555927-ERR598996) | Environmental | Open in IMG/M |
| 3300020452 | Marine microbial communities from Tara Oceans - TARA_B100001173 (ERX556054-ERR599078) | Environmental | Open in IMG/M |
| 3300020454 | Marine microbial communities from Tara Oceans - TARA_B100001769 (ERX556037-ERR599170) | Environmental | Open in IMG/M |
| 3300020461 | Marine microbial communities from Tara Oceans - TARA_B100000401 (ERX556127-ERR599150) | Environmental | Open in IMG/M |
| 3300020462 | Marine microbial communities from Tara Oceans - TARA_B100001559 (ERX556040-ERR598986) | Environmental | Open in IMG/M |
| 3300020467 | Marine microbial communities from Tara Oceans - TARA_B100000945 (ERX555966-ERR598957) | Environmental | Open in IMG/M |
| 3300020468 | Marine microbial communities from Tara Oceans - TARA_A100000164 (ERX555914-ERR598993) | Environmental | Open in IMG/M |
| 3300020469 | Marine microbial communities from Tara Oceans - TARA_B100001093 (ERX555967-ERR599052) | Environmental | Open in IMG/M |
| 3300020470 | Marine microbial communities from Tara Oceans - TARA_B100000287 (ERX555976-ERR599053) | Environmental | Open in IMG/M |
| 3300020471 | Marine microbial communities from Tara Oceans - TARA_B100000214 (ERX556063-ERR599002) | Environmental | Open in IMG/M |
| 3300020474 | Marine prokaryotic communities collected during Tara Oceans survey from station TARA_151 - TARA_B100001564 (ERX555957-ERR598976) | Environmental | Open in IMG/M |
| 3300020478 | Marine microbial communities from Tara Oceans - TARA_B100000029 (ERX556025-ERR599111) | Environmental | Open in IMG/M |
| 3300021791 | Hydrothermal fluids microbial communities from Mariana Back-Arc Basin vent fields, Pacific Ocean - Daikoku_FS921 150_kmer | Environmental | Open in IMG/M |
| 3300021792 | Hydrothermal fluids microbial communities from Mariana Back-Arc Basin vent fields, Pacific Ocean - Illium_FS922 150_kmer | Environmental | Open in IMG/M |
| 3300021974 | Hydrothermal fluids microbial communities from Mariana Back-Arc Basin vent fields, Pacific Ocean - Perseverance_FS929 _150kmer | Environmental | Open in IMG/M |
| 3300021977 | Hydrothermal fluids microbial communities from Mariana Back-Arc Basin vent fields, Pacific Ocean - Hafa_FS925 _150kmer | Environmental | Open in IMG/M |
| 3300022074 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2) | Environmental | Open in IMG/M |
| 3300025086 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025101 | Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025127 | Marine viral communities from the Pacific Ocean - ETNP_2_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025132 | Marine viral communities from the Pacific Ocean - ETNP_2_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300025151 | Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300026077 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_DCM_ad_63m_LV_B (SPAdes) | Environmental | Open in IMG/M |
| 3300026081 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S7_td_SurfaceA_ad_6m_LV_A (SPAdes) | Environmental | Open in IMG/M |
| 3300026083 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_SurfaceA_ad_5m_LV_A (SPAdes) | Environmental | Open in IMG/M |
| 3300026093 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S23_td_DCM_ad_71m_LV_A (SPAdes) | Environmental | Open in IMG/M |
| 3300026136 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF45B (SPAdes) | Environmental | Open in IMG/M |
| 3300026189 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302PF84A (SPAdes) | Environmental | Open in IMG/M |
| 3300026203 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV84 (SPAdes) | Environmental | Open in IMG/M |
| 3300026270 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F12-01SV265 (SPAdes) | Environmental | Open in IMG/M |
| 3300027702 | Marine microbial communities from the Southern Atlantic Ocean, analyzing organic carbon cycling - DCM_A/KNORR_S2/LV (SPAdes) | Environmental | Open in IMG/M |
| 3300027774 | Marine microbial communities from oxygen minimum zone in mesopelagic equatorial Pacific - METZYME_5_50m (SPAdes) | Environmental | Open in IMG/M |
| 3300027830 | Marine microbial communities from the Southern Atlantic Ocean, analyzing organic carbon cycling - Surface_A/KNORR_S2/LV (SPAdes) | Environmental | Open in IMG/M |
| 3300029319 | Marine viral communities collected during Tara Oceans survey from station TARA_032 - TARA_A100001516 | Environmental | Open in IMG/M |
| 3300029792 | Marine giant viral communities collected during Tara Oceans survey from station TARA_041 - TARA_Y100000052 | Environmental | Open in IMG/M |
| 3300030780 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S19_0.2 metaT (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031785 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-25_MG | Environmental | Open in IMG/M |
| 3300032011 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 3416 | Environmental | Open in IMG/M |
| 3300032047 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 34915 | Environmental | Open in IMG/M |
| 3300032073 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 3416 | Environmental | Open in IMG/M |
| 3300032820 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - S1503-DNA-20-500_MG | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| 2014653994 | 2014642000 | Marine | MSTLHHEDLLWDIFDEVIENFPYLDEEKQIEIANKRFEELCQ |
| BBAY93_101008992 | 3300000973 | Macroalgal Surface | MSCLQNELLLESIFEEVQECFPYYDEEKQIEIAKQRFEDLCHPY* |
| ACM18_11188842 | 3300001778 | Marine Plankton | MSTLHHEDHLLTIFEEVQEAFPYLDEEKQIEIANNRFQELCQ* |
| ACM6_10001412 | 3300001832 | Marine Plankton | MSTLHHEDMLLDIFDQVQEAFPYLDEEKQIEIANNRFQDLCQ* |
| GOS2241_10077276 | 3300001945 | Marine | MSCLQNELLLESIFEEVQECFPYYDEEKQIEIAKKRFDDLCR* |
| GOS2241_10104131 | 3300001945 | Marine | MSCLQNELILESLFEEVQEAFPYLSEEKQIEMHKK |
| GOS2249_10328811 | 3300001951 | Marine | MSCLQNELLLETIFEEVQECFPYYDEEKQIEIAKQRFDDLCQ* |
| GOS2231_10022616 | 3300001953 | Marine | HHEDLLLQIFDEVQEAFPYLDEEKQIEIANNRFQEICQ* |
| GOS2231_10168724 | 3300001953 | Marine | MSTLHHEDLLLSIFDEVCENFPYLDEEKQIEIANKRFEELCQ* |
| GOS2231_10276075 | 3300001953 | Marine | MSTLHHEDLLLTIFEEVQEAFPYLDEDKQIEIANNRFQEVCQ* |
| GOS2235_10007383 | 3300001954 | Marine | MLLDIFEEVQANFPYLDEDKQIEIANQRFEDLLQ* |
| GOS2235_10210386 | 3300001954 | Marine | ISFSMSTLHHEDLLLTIFEEVQECFPYYDEDKQIEIANKRFEELCQ* |
| GOS2230_10020161 | 3300001960 | Marine | GNFIFMSTLHHEDLLLTIFEEVQEAFPYLDEDKQIEIANNRFQEVCQ* |
| GOS2240_10039512 | 3300001961 | Marine | MSCLQNELLLESIFEEVQECFPYYDEEKQIEIAKKRFDDLCQ* |
| GOS2239_10059591 | 3300001962 | Marine | MSCLQNELLLESIFEEVQECFPYYDEEKQIEIAKQR |
| GOS2234_10178883 | 3300001964 | Marine | MSTLHHEDLLWDIYDEVCENFPYLDEEKQIEIAHKRFEELCQ* |
| GOS2234_10603457 | 3300001964 | Marine | MSTLHHEDLLLTIFEEVQEAFPYLDEDKQIEIANDRFQEMCI* |
| GOS2245_10293386 | 3300001966 | Marine | MLLDIFEEVQENFPYLDEEKQIEIANNRFQDLCQ* |
| GOS2242_10658374 | 3300001967 | Marine | DLLLSIFDEVCEAFPYLDEEKQIEIANNRFQEMCQ* |
| GOS2233_10204964 | 3300001969 | Marine | MSTLHHEDLLLQIFDEVQEAFPYLDEEKQIEIANNRFQEMCQ* |
| GOS2233_11003624 | 3300001969 | Marine | MSTLHHEDLLLQIFDEVQEAFPYLDEEKQIEIANNRFQEICQ* |
| JGI25127J35165_10040275 | 3300002482 | Marine | MSTXHHEDMLLEIFEDVKEAFPYMEEEKQIEIANNRFYDMCQ* |
| JGI25127J35165_10111983 | 3300002482 | Marine | MSCLQNEELLEQIFEEVQEAFPYLSTGKQIEIANNRFEDLCQ* |
| JGI25127J35165_10640572 | 3300002482 | Marine | MSTLHHEDLLLSIFDEVQEEFPYLDEDKQIEIANQRFEDMCR* |
| JGI25127J35165_10695553 | 3300002482 | Marine | MSTLHHEDLLLSIFEEVQEAFPYLDEEKQIEIANNRFEDLCQ* |
| JGI25132J35274_10426753 | 3300002483 | Marine | MSTLHHEDMLLEIFEDVKEAFPYLDEDKQIEIANNRFHDLCQ* |
| JGI26062J44793_10075612 | 3300002955 | Marine | MSTLHHEDLLLTIFEEVQEAFPYLDEEKQIEIANNRFQELCI* |
| JGI26062J44793_10158332 | 3300002955 | Marine | MSTLHHEDMLLEIFDEVQENFPYLEEDKQIEIANNRFQELCQ* |
| JGI26062J44793_10281831 | 3300002955 | Marine | MSTLHHEDMLLDIFEEVQENFPYLDEDKQIEIANNRFQELCQ* |
| JGI26062J44793_10376773 | 3300002955 | Marine | MSTLHHEDMLLDIFEEVQENFPYLDEEKQIEIANNRFQDLLQ* |
| JGI26064J46334_10091579 | 3300003185 | Marine | MSTLHHEDMLLEIFDEVQENFPYLDEEKQIEIANNRFQELCQ* |
| JGI26064J46334_10611671 | 3300003185 | Marine | MSTLHHEDLLWDIFDEVIENFPYLDEEKQIEIANKRFEEMCQ* |
| JGI26064J46334_11038103 | 3300003185 | Marine | MSTLHHEDLLLTIFEEVQEAFPYLDEDKQIEIANNRFQEMCI* |
| JGI26064J46334_11116081 | 3300003185 | Marine | TLHHEDLLLSIFEEVQEAFPYLDEDKQIEIANKTFEDRLL* |
| JGI26064J46334_11189772 | 3300003185 | Marine | MSTLHHEDLLLTIFEEVQEAFPYLDEEKQIEIANNRFQEICQ* |
| Ga0068513_10118173 | 3300004951 | Marine Water | MSTLHHEDMLLQIFDEVQEAFPYLDEEKQIEIANNKFQELCQ* |
| Ga0068513_10255342 | 3300004951 | Marine Water | MSTLHHEDMLLDIFEEVQENFPYLDEEKQIEIANNRFQELCQ* |
| Ga0068511_10030342 | 3300005057 | Marine Water | MSTLHHEDLLLTIFEEVQEAFPYYDEDKQIEIANNRFEELCQ* |
| Ga0068511_10188272 | 3300005057 | Marine Water | MSTLHHEDLLLSIFEEVQEAFPYLDEDKQIEIANNRFWELAQ* |
| Ga0068511_10210553 | 3300005057 | Marine Water | MSTLAHEDMLLDIFEEVQANFPYLDEDKQIEIANQRFEDLLQ* |
| Ga0068511_10224253 | 3300005057 | Marine Water | MSTLHHEDMLLQIFDEVQEAFPYLDEEKQIEIANNRFQDLCQ* |
| Ga0068511_10802172 | 3300005057 | Marine Water | MSCLQNELLLESIFEEVQECFPYYDEEKQIEIAKKRFDDLCHSY* |
| Ga0068511_10996192 | 3300005057 | Marine Water | MSTLHHEDLLWDIFDEVCENFPYLDEEKQIEIANKRFEELCQ* |
| Ga0070431_11876062 | 3300005074 | Marine Benthic Sponge Stylissa Massa Associated | MSTQHHEDMLLQIFDEVCEAFPYLDEEKQIEIANNRFQELCQ* |
| Ga0070431_12582492 | 3300005074 | Marine Benthic Sponge Stylissa Massa Associated | MSTLTHEDMLLQIFDEVQEAFPYLDEEKQIEIANKRFEDLCQ* |
| Ga0072505_13922681 | 3300005097 | Marine Benthic Sponge Stylissa Massa Associated | MSTLHHEDMLLQIFDEVCEAFPYLDEEKQIEIANNRFQVMPMNIGD |
| Ga0072505_15038173 | 3300005097 | Marine Benthic Sponge Stylissa Massa Associated | MSTLTHEDMLLQIFDELQEAFPYLDEEKQIEIANNRFQELCQ* |
| Ga0066856_101734173 | 3300005404 | Marine | MSVLHHEEILLSIFEEVKEEFPQMDEEKQIEITNERFAERCQ* |
| Ga0066856_104442032 | 3300005404 | Marine | MSTLHHEDMLLDIFEEVQENFPYLDEDKQIEIANQRFEDLLQ* |
| Ga0066845_100512716 | 3300005432 | Marine | MSTLHHEDMLLQIFDEVQEAFPYYDEEKQIEIANNRFQELCQ* |
| Ga0066845_100591663 | 3300005432 | Marine | MSTLHHEDMLLDIFEEVQANFPYLDEDKQIEIANQRFEDLLQ* |
| Ga0066845_100607781 | 3300005432 | Marine | MSTLHHEDLLLSIFDEVCEAFPYYDEEKQIEIANKRFEDMCQ* |
| Ga0066845_100756673 | 3300005432 | Marine | MSTLHHEDLLWDIYDEVIENFPYLSEEKQIELAHKKFEELCQ* |
| Ga0066845_102180763 | 3300005432 | Marine | MSTLHHEDLLLTIFEEVQEAFPYLDEDQQIEIANNRFQEVCQ* |
| Ga0066845_102543152 | 3300005432 | Marine | MSTLQHEDMLLDIFEEVQANFPYLDEDKQIEIANQRFEDLLQ* |
| Ga0066845_102577692 | 3300005432 | Marine | MSTLHHEDLLLQIFDEVQEAFPYLDEEKQIEIANNRFQEMCI* |
| Ga0066845_103396893 | 3300005432 | Marine | FFLSMSTLHHEDLLLSIFEEVQECFPYYDEEKQAKIAVQRFEDLCQ* |
| Ga0066845_103802252 | 3300005432 | Marine | MSTLHHEDLLLTIFEEVQECFPYYDEDKQIEIANKRFEELCQ* |
| Ga0066845_103986121 | 3300005432 | Marine | MSTLHHEDLLLTIFDEVCEAFPYYDEDKQIEIANKRFEELCQ* |
| Ga0066830_100584461 | 3300005433 | Marine | FQIMSTLHHEDLLWDIYDEVIENFPYLSEEKQIELAHKKFEELCQ* |
| Ga0066830_101125562 | 3300005433 | Marine | MSTLHHEDLLWDIYDEVVENFPYLDEEKQIEIANKRFEELCQ* |
| Ga0066830_101142832 | 3300005433 | Marine | MSTLHHEDLLLSIFEEVQECFPYYDEEKQAKIAVQRFEDLCQ* |
| Ga0066865_100078715 | 3300005523 | Marine | MSTLHHEDILLSIFDEVCEEFPNYDEDRQIQIANQRFEDICQ* |
| Ga0066865_101633584 | 3300005523 | Marine | HEDLLLTIFEEVQEAFPYLDEDQQIEIANNRFQEVCQ* |
| Ga0066865_101652703 | 3300005523 | Marine | MSVLHHEDMLLQIFDEVQEAFPYLDEDKQIEIANKRFEDMCQ* |
| Ga0066865_101964503 | 3300005523 | Marine | MSVLHHEDLLISIFEEVQEAFPYLNEDKQIEIANKRFEDLCQ* |
| Ga0066865_103924122 | 3300005523 | Marine | MSTLHHEDLLLSIFEEVQEAFPYLDEDKQIEIANKRFDEVCV* |
| Ga0066835_100120786 | 3300005606 | Marine | MSTLHHEDLLLSIFDEVQEAFPYLDEEKQIEIANNRFQEICQ* |
| Ga0066835_100690114 | 3300005606 | Marine | MSTLHHEDLLLTIFDEVCEAFPYLDEDKQIEIANRRFEELCQ* |
| Ga0066835_100736714 | 3300005606 | Marine | MSTLHHEDLLLTIFDEVCEAFPYLDEDKQIEIANRRF |
| Ga0066835_100825132 | 3300005606 | Marine | MSTLHHEDLLLTIFEEVQEAFPYLDEEKQIEIANNRFQEMCI* |
| Ga0066835_100987771 | 3300005606 | Marine | MSTLHHEDMLLDIFEEVQENFPYLDEEKQIEIANNRFQDLCQ* |
| Ga0066835_101224431 | 3300005606 | Marine | HEDMLLEIFEDVKEAFPYMEEEKQIEIANNRFYDMCQ* |
| Ga0066835_101812313 | 3300005606 | Marine | MSTLTHEDMLLDIFEEVQENFPYLDEDKQIEIANKRFEDLCQ* |
| Ga0066835_102147282 | 3300005606 | Marine | MSTLHHEDLLLSIFEEVQEAFPYLDEEKQIEIANNRFEDMCQ* |
| Ga0066835_102386073 | 3300005606 | Marine | MSTLTHEDMLLDIFEEVQENFPYLDEDKQIEIANKRFEDLCQ*CMNL |
| Ga0066835_103275851 | 3300005606 | Marine | MSVLHHEDMLLQIFDEVQEAFPYLDEDKQIEIANQRFEDMCQ* |
| Ga0066840_100247814 | 3300005608 | Marine | MSCLQNELLLETIFEEVQEAFPYYDEEKQIEIANNRFQELCQ* |
| Ga0066840_100402801 | 3300005608 | Marine | HEDMLLDIFEEVQENFPYLDEEKQIEIANNRFQDLCQ* |
| Ga0066840_100517172 | 3300005608 | Marine | MSTLHHEDLLLSIFDEVQEAFPYLDEEKQIEIANNRFQEMCQ* |
| Ga0066840_100518581 | 3300005608 | Marine | MSTLHHEDLLLTIFEEVQEAFPYLDEEKQIEIANNRFQEICI* |
| Ga0066840_100577702 | 3300005608 | Marine | MSTLHHEDLLLSIFDEVQEAFPYLDEEKQIEIANNKFAELCQ* |
| Ga0066840_101402043 | 3300005608 | Marine | MVHFRQTLIMSNSANTELLETIFEEVQEAFPYYDEEKQIEIANN |
| Ga0066377_100772853 | 3300005934 | Marine | MSTLHHEDLLWDIFDEVIENFPYLDEEKQIEIANKRFEELCQ* |
| Ga0066377_100893763 | 3300005934 | Marine | MSTLHHEDMLLQIFDEVQEAFPYLDEEKQIEIANNRFQELCQ* |
| Ga0066377_100963233 | 3300005934 | Marine | MSTLHHEDLLLTIFEEVQEAFPYLDEDQQIEIANNRFQGVCQ* |
| Ga0066377_102254272 | 3300005934 | Marine | MSTLTHEDMLLDIFDQVQEAFPYLDEEKQIEIANQRFEDLCQ* |
| Ga0066377_102808391 | 3300005934 | Marine | MSTLHHEDLLLTIFEEVQEAFPYLDEDKQIEIANNRFQE |
| Ga0066364_100370256 | 3300005960 | Marine | MSTLHHEDLLLSIFDEVQEAFPYLDEEKQIEIANNKFEELCQ* |
| Ga0066364_101440081 | 3300005960 | Marine | MSTLHHEDLLLTIFEEVQECFPYYDEDKQIEIANNRFEELCQ* |
| Ga0066364_103766301 | 3300005960 | Marine | MSTLHHEDLLWDIFDEVCENFPYLDEEKQIEIANKKFEELCQ* |
| Ga0066370_100420723 | 3300005971 | Marine | MSTLHHEDMLLDIFEEVQEAFPYLDEEKQIEIANNKFQELCQ* |
| Ga0066370_101512283 | 3300005971 | Marine | MSTLHHEDLLLSIFDEVQEAFPYLDEDKQIEIANQRFEDMCE* |
| Ga0066370_101770183 | 3300005971 | Marine | MSTLHHEDLLLSIFDEVQEAFPYLDEDKQIEIANQRFEDMCQ* |
| Ga0066370_103184981 | 3300005971 | Marine | MSTLHHEDLLWDIYDEVCENFPYLDEEKQIEIANKRFEELCQ* |
| Ga0066370_103497063 | 3300005971 | Marine | MSTLHHEDLLLTIFEEVQEAFPYLDEDKQIEIANNRFQELCI* |
| Ga0066370_103883821 | 3300005971 | Marine | SFSMSTLHHEDLLLTIFEEVQECFPYYDEDKQIEIANKRFEELCQ* |
| Ga0066371_1000792912 | 3300006024 | Marine | MSVLHHEEILLSIFEEVKEEFPYMDEEKQIEITNERFAERCQ* |
| Ga0066371_101534692 | 3300006024 | Marine | MSTLHHEDMLLEIFDEVQENFPYLDEDKQIEIANNRFQELCQ* |
| Ga0081594_10984751 | 3300006077 | Diffuse Hydrothermal Fluid | MSTLHHEDLLWQIFEEVQEAFPYYDEEKQIEIANNRFQELCQ* |
| Ga0081594_11387432 | 3300006077 | Diffuse Hydrothermal Fluid | MSTLQNEELLEQIFEEVKEAFPYLSTGKQIEIANNRFEELCQ* |
| Ga0081762_13607581 | 3300006083 | Diffuse Hydrothermal Flow Volcanic Vent | MSTLTHEDMLLDIFDEVQENFPYLDEDKQIEIANKRFEDLCQ* |
| Ga0068468_100067215 | 3300006305 | Marine | MSTLTHEDMLLEIFDEVQEAFPYYDEEKQIEIANKRFEDLCQ* |
| Ga0068468_100229510 | 3300006305 | Marine | MSTLHHEELLLQIFDEVQEAFPYLDEEKQIEIANNRFQEMCI* |
| Ga0068468_10150845 | 3300006305 | Marine | MSTLHHEDLLLTIFEEVQEAFPYLDEEKQIEIANNRFQEVCQ* |
| Ga0068468_10317193 | 3300006305 | Marine | MSCLQNELLLESIFEEVQECFPYYDEAKQIEIAQQRFDDLCQ* |
| Ga0068468_103927310 | 3300006305 | Marine | MSTLTHEDMLLQIFDEVQEAFPYYDEEKQIEIANKRFEDLCQ* |
| Ga0068468_10498699 | 3300006305 | Marine | MSTLHHEDMLLQIFDEVQEAFPYYEEEKQIEIANNRFQELCQ* |
| Ga0068468_10593812 | 3300006305 | Marine | MSTLHHEDLLWQIFEEVQEAFPYYDEEKQIEIANNRFQDLCQ* |
| Ga0068468_10837285 | 3300006305 | Marine | MSTLHHEDMLLEIFDEVCEAFPYLDEEKQIEIANNKFQELCQ* |
| Ga0068468_10945712 | 3300006305 | Marine | MSCLQNEMLLESIFEEVQEAFPYYDEAKQIEIAQQRFDDLCQ* |
| Ga0068468_11078193 | 3300006305 | Marine | MSTLSHEDLLLSIFDEVQEAFPYLDEEKQIEIANNRFQDLCQ* |
| Ga0068468_11304552 | 3300006305 | Marine | MSTLHHEDMLLDIFAEVQEAFPYLDEEKQIEIANNRFQDLCQ* |
| Ga0068468_11309924 | 3300006305 | Marine | MSTLHHEDLLLSIFDEVCEEFPYLNEDKQIELANQRFEDMCE* |
| Ga0068468_11421781 | 3300006305 | Marine | TLHHEDLLLTIFEEVQEAFPYLDEDKQIEIANNRFQEMCI* |
| Ga0068468_11485992 | 3300006305 | Marine | MSTLHHEDLLLSIFDEVCEAFPYLDEDKQIEIANQRFEDLCQ* |
| Ga0068486_101263813 | 3300006329 | Marine | MSVLHHAEILENIFEEVQEAFPYLDEDKQIEIANQRFQDMCQ* |
| Ga0068486_10359913 | 3300006329 | Marine | MSCLQNELLLETIFEEVQECFPYYDEEKQIEIAKQRF |
| Ga0068486_10364326 | 3300006329 | Marine | MSTLHHEDMLLHIFEEVQENFPYLDEEKQIEIANNRFQELCQ* |
| Ga0068486_10375973 | 3300006329 | Marine | MSTLHHEDLLLSIFDEVCEAFPYLDEEKQIEIANNRFEELCQ* |
| Ga0068486_11308964 | 3300006329 | Marine | MSVLHHAEILENIFDEVVEAFPYLDEDKQIEIANKRFEEMCQ* |
| Ga0068486_11316677 | 3300006329 | Marine | MSVLHHEDMLLQIFDEVQEAFPYLDEEKQIEIANKRFDDMCQ* |
| Ga0068486_11492076 | 3300006329 | Marine | MSTLHHEDMLLEIFDEVCEAFPYLDEEKQIEIANNRFQELCQ* |
| Ga0068486_12809434 | 3300006329 | Marine | MSTLHHEDMLLQIFDDVQEAFPYYDEEKQIEIANNRFQELCQ* |
| Ga0068486_13200871 | 3300006329 | Marine | ETPPMSTLHHEDLLLSIFDEVCEAFPYLDEDKQIEIANQRFEDMCQ* |
| Ga0068486_13546782 | 3300006329 | Marine | MSCLQNEMLLESIFEEVQECFPYYDEAKQIEIAQQRFDDLCQ* |
| Ga0068486_13748643 | 3300006329 | Marine | MSTLHHEDMLLEIFDEVQEAFPYYDEEKQIEIANKRFEDLCQ* |
| Ga0068486_14136324 | 3300006329 | Marine | MSTLHHEDLLWQIFDEVQEAFPYLDEEKQIEIANNRFQEICQ* |
| Ga0068486_14469014 | 3300006329 | Marine | MSTLHHEDMLLDIFEEVKENFPYLDEEKQIEIANNKFQELCQ* |
| Ga0068486_14494632 | 3300006329 | Marine | MSCLQNEMLLESIFEEVQECFPYFDEAKQIEIAQQRFDDLCQ* |
| Ga0068486_14770673 | 3300006329 | Marine | MSTLHHEDMLLQIFDEVQEAFPYLDEEKQIEIANNRF |
| Ga0099675_10866205 | 3300006334 | Marine | MSTLHHEDLLLSIFDEVCEEFPYLNEDKQIEIANQRFEDMCE* |
| Ga0099675_11222241 | 3300006334 | Marine | MSTLHHEDLLLTIFEEVQEAFPYLDEDKQIEIANNRFQELCQ* |
| Ga0099675_14013229 | 3300006334 | Marine | MSTLHHEDMLLEIFDEVQEAFPYLDEEKQIEIANNKFQELCQ* |
| Ga0099675_14026571 | 3300006334 | Marine | MSTLHHEDLLLSIFDEVWEAFPYLDEDKQIEIANQRFEDMCE* |
| Ga0099675_14026913 | 3300006334 | Marine | MSTLHHEDLLLSIFDEVCEEFPLLNEDKQIEIANQRFEDMCE* |
| Ga0099675_15299526 | 3300006334 | Marine | MSTLHHEDLLLTIFDEVCEAFPYLDEEKQIEIANKRFEELCQ* |
| Ga0099675_15322693 | 3300006334 | Marine | MSCLQNEMLLESIFEEVQECFPYQDEAKQIEIAQQRFDDLCQ* |
| Ga0099675_15327702 | 3300006334 | Marine | MSTLHHEDLLWQIFDEVQEAFPYLDEEKQIEIANNRFQDLCQ* |
| Ga0099675_16234731 | 3300006334 | Marine | MSTLHHEELLLQIFDEVQEAFPYLDEEKQIEIANNRFQEICQ* |
| Ga0099693_10211314 | 3300006345 | Marine | MSTLTHEDMLLQIFDEVQEAFPYYEEEKQIEIANKRFEDLCQ* |
| Ga0099693_102578216 | 3300006345 | Marine | MSTLHHEDLLLSIFDEVQEAFPYLDEEKQIEIANNRFEDLCQ* |
| Ga0099693_13327109 | 3300006345 | Marine | MSTLHHEDLLLSIFDEVQEAFPYLDEDKQIEIANQRFEDICQ* |
| Ga0099693_13459553 | 3300006345 | Marine | MSTPHHEDLLWDIFDEVIENFPYLDEEKQIEIANKRFEELCQ* |
| Ga0099693_13686013 | 3300006345 | Marine | MSTLTHEDMLLEIFDEVQEAFPYYDEEKQIEIANKRFEELCQ* |
| Ga0099693_14064634 | 3300006345 | Marine | MSPLHHEDLLLTIFEEVQEAFPYYDEDKQIEIANNRFEELCQ* |
| Ga0099693_14181663 | 3300006345 | Marine | MSTLHHEDLLLSIFDEVQEAFPYLDEDKQIEIANQR |
| Ga0099693_14410024 | 3300006345 | Marine | MSTLTHEDMLLQIFDEVQEAFPYYDEEKQIEIANNRFQEVCQ* |
| Ga0099693_14529233 | 3300006345 | Marine | MYTLHHEDLLLTIFDEVCEAFPYLDEDKQIEIANQRFEDLCQ* |
| Ga0099954_101644715 | 3300006350 | Marine | MSVLHHEDMLLQIFEEVQEAFPYYDEEKQIEIANQRFQDMCQ* |
| Ga0099954_10175085 | 3300006350 | Marine | MSTLHHEDLLWQIFDEVQEAFPYYDEEKQIEIANNRFQDLCQ* |
| Ga0099954_10175092 | 3300006350 | Marine | MSTLHHEDLLWQIFDEVCEAFPYYDEEKQIEIANNRFQDLCQ* |
| Ga0099954_10183292 | 3300006350 | Marine | MSTLHHEDLLWDIFDEVVENFPYLDEEKQIEIANKRFEELCQ* |
| Ga0099954_10492614 | 3300006350 | Marine | MSTLHHEDLLLSIFDEVCEAFPYLDEDKQIEIANNRFQEMCI* |
| Ga0099954_10738794 | 3300006350 | Marine | MSTLHHEDMLLQIYDEVQEAFPYLDEEKQIEIANKRFEDLCQ* |
| Ga0099954_12540151 | 3300006350 | Marine | KTSMSTLHHEDMLLQIFDEVQEAFPYLDEEKQIEIANNRFQDLCQ* |
| Ga0099954_12621982 | 3300006350 | Marine | MYSLGPFLKTMSTLHHEDMLLQIFDEVCEAFPYLDEEKQIEIANNRFQELCQ* |
| Ga0099954_12672943 | 3300006350 | Marine | MSTLHHEDMLLQIFDEVQEAFPYLDEEKQIEIANNKF |
| Ga0099954_12990543 | 3300006350 | Marine | MSTLHHEDLLLSIFDEVCEAFPYLDEEKQIEIANNRFQELCI* |
| Ga0099954_13036442 | 3300006350 | Marine | MSTLTHEDMLLQIFDEVQEAFPYYDEEKQIEIANNRFQDLCQ* |
| Ga0099954_13082881 | 3300006350 | Marine | KQNFKIMSTLHHEDMLLQIFDEVCEAFPYLDEEKQIEIANNRFQELCQ* |
| Ga0099954_13093513 | 3300006350 | Marine | MSTLTHEDMLLQIFDEVQEAFPYYDEEKQIEIANNKFQELCQ* |
| Ga0099954_13388925 | 3300006350 | Marine | MSTLHHEDMLLEIFDEVCEAFPYLDEEKQIEIANNKKVSS |
| Ga0099954_13821944 | 3300006350 | Marine | MSTLTHEDMLLDIFDQVQEAFPYLDEEKQIEIANNRFQDLCQ* |
| Ga0099954_13884493 | 3300006350 | Marine | MSTLHHEDLLLTIFEEVQEAFPYLDEEKQIEIANNRFQEVCI* |
| Ga0099954_13939724 | 3300006350 | Marine | MSDLHHAEILENIFEEVQEAFPYLDEDKQIEIANQRFQDMCQ* |
| Ga0099954_15606891 | 3300006350 | Marine | MSCLQNELLLETIFEEVQECFPYYDEAKQIEIAQQRFDDLCQ* |
| Ga0099954_15753831 | 3300006350 | Marine | KEDLKMSCLQNEMLLESIFEEVQECFPYYDEAKQIEIAQQRFDDLCQ* |
| Ga0099954_15767131 | 3300006350 | Marine | MSTLHHEDLLLQIFDEVQEAFPYLDEEKQIEIANNRFQEIC |
| Ga0099953_14891411 | 3300006351 | Marine | GNLIFMSTLHHEDLLLTIFEEVQEAFPYLDEEKQIEIANNRFQEMCI* |
| Ga0099953_15489443 | 3300006351 | Marine | MSTLTHEDMLLDIFDQVQEAFPYLDEEKQIEIANQRFEDLCQ*QELNFLY*LA |
| Ga0099953_16561503 | 3300006351 | Marine | MSTLHHEDLLITIFEEVQEAFPYLDEDKQIEIANQRFEDMCE* |
| Ga0099953_16824482 | 3300006351 | Marine | MSTLHHEDLLLTIFEEVQEAFPYLDEEKQIEIANNRFQELCQ* |
| Ga0079049_13337961 | 3300006377 | Marine | TLHHEDLLLTIFEEVQEAFPYLDEEKQIEIANNRFQELCI* |
| Ga0099963_10289364 | 3300006413 | Marine | MSTLHHEDLLLTIFEEVQEAFPYLDEEKQIEIANNRFQDLCQ* |
| Ga0099963_10500842 | 3300006413 | Marine | MSTLHHEDMLLQIFDEVCEAFPYLDEEKQIEIANNRFQELCQ* |
| Ga0099963_10553653 | 3300006413 | Marine | MSTLHHEDLLLTIFEEVQEAFPYLDEDKQIEIANNRFWEIAQ* |
| Ga0099963_12193762 | 3300006413 | Marine | MSTLHHEDMLLQIFDEVQEAFPYLDEEKQIEIANKRFEDLCQ* |
| Ga0099963_12492833 | 3300006413 | Marine | MSTLHHEDMLLQIFDEVQEAFPYYDEEKQIEIANKRFEDLCQ* |
| Ga0099963_14471563 | 3300006413 | Marine | EVTTTKSMSTLHHEDMLLQIFDEVQEAFPYLDEEKQIEIANNRFQDLCQ* |
| Ga0100226_10116379 | 3300006480 | Marine | MSTLTHEDLLLEIFDEVQEAFPYYDEEKQIEIANKRFEDLCQ* |
| Ga0100226_10127616 | 3300006480 | Marine | MSTLTHEDMLLEIFDEVQEAFPYYDEEKQIEIANKRFQDLCQ* |
| Ga0100226_10237802 | 3300006480 | Marine | MSTLHHEDLLLTIFEEVQEAFPYLDEDKQIEIANNRFQEICQ* |
| Ga0100226_10598774 | 3300006480 | Marine | MSTLHHEDMLLEIFDEVQENFPYLDEEKQIEIANNKFQELCQ* |
| Ga0100226_11027504 | 3300006480 | Marine | IMSTLHHEDLLWLIFDEVQEAFPYLDEEKQIEIANNRFQDLCQ* |
| Ga0100226_13235835 | 3300006480 | Marine | SNPLLIMSTLTHEDMLLQIFDEVQEAFPYYDEEKQIEIANKRFEDLCQ* |
| Ga0100226_14579174 | 3300006480 | Marine | LLIMSTLHHEAMLLQIFDEVQEAFPYLDEEKQIEIANNRFQELCQ* |
| Ga0100226_14654473 | 3300006480 | Marine | MSTLHHEDLLFQIFDEVCEAFPYLDEEKQIEIANNKFQELCQ* |
| Ga0100226_14680633 | 3300006480 | Marine | MCCLQNELLLESIFEEVQECFPYYDEEKQIEIAKQRFDDLCQ* |
| Ga0100229_10379312 | 3300006481 | Marine | MSTLHHEDLLLTIFEEVQEAFPYLDEEKQIEIANNKFQELCQ* |
| Ga0100229_14147693 | 3300006481 | Marine | MSTLHHEDMLLEIFDEVQENFPYLDEEKQIEIANNRFQDLCQ* |
| Ga0100229_14982892 | 3300006481 | Marine | MSTLHHEDMLLEIFDEVCEAFPYLDEEKQIEIANNRFQDLCQ* |
| Ga0100229_15902182 | 3300006481 | Marine | MSCLQNEMLLESIFEEVQECFPYYDEEKQIEIAKQRFEDTIPY* |
| Ga0098038_12764603 | 3300006735 | Marine | MSTLHHEDMLLQIFDEVCEAFPYYDEEKQIEIANNRFQELCQ* |
| Ga0098037_102101210 | 3300006737 | Marine | MSTQHHEDMLLEIFDEVQEAFPYYDEEKQIEIANNRFQELCQ* |
| Ga0098037_11418461 | 3300006737 | Marine | MSTLHHEDMLLQIFDEVCEAFPYYDEDKQIEIANNRFQELCQ* |
| Ga0098037_12447404 | 3300006737 | Marine | MSTLHHEDMLLEIFDEVQEAFPYYDEEKQIEIANNRFQELCQ* |
| Ga0098042_10795911 | 3300006749 | Marine | KHYIKQGLKTMSTLHHEDMLLEIFDEVQENFPYLDEEKQIEIANNRFQELCQ* |
| Ga0101666_10663301 | 3300007113 | Volcanic Co2 Seep Seawater | TLSSNHLLIMSTLHHEDMLLQIFDEVQEAFPYLDEEKQIEIANNKFQELCQ* |
| Ga0101666_10833232 | 3300007113 | Volcanic Co2 Seep Seawater | MSTPHHEDLILSIFEEVEEAFPYLTEEQQANIAVQRFEDLCQ* |
| Ga0101668_10333702 | 3300007114 | Volcanic Co2 Seep Seawater | MSTLHHEDLLWDIFDEVCENFPYLDEEKQIEIANKRFEEMCQ* |
| Ga0101667_10207362 | 3300007116 | Volcanic Co2 Seep Seawater | MSTLHHEDMLLQIFEEVQENFPYLDEEKQIEIANNRFQDLLQ* |
| Ga0101667_10271721 | 3300007116 | Volcanic Co2 Seep Seawater | LIMSTLHHEDMLLQIFDEVQEAFPYLDEEKQIEIANNKFQELCQ* |
| Ga0101667_10435152 | 3300007116 | Volcanic Co2 Seep Seawater | MSTPHHEDLILSIFEEVEEAFPYLNEEQQANIAVQRFEDLCQRAN* |
| Ga0101671_10136354 | 3300007133 | Volcanic Co2 Seeps | MSTLHHEDMLLQIFDEVQEAFPYLDEEKQIEIANQRFEDLLQ* |
| Ga0079240_13550241 | 3300007329 | Marine | TLHHEDMLLEIFDEVCEAFPYLDEEKQIEIANNKFQELCQ* |
| Ga0079270_11254112 | 3300007333 | Marine | MSTLHHEDMLLQIFDEVQEAFPYLDEEKQIEIANNRFQDL |
| Ga0079270_11546743 | 3300007333 | Marine | MSTLHHEDMLLDIFDQVQEAFPYLDEEKQIEIANQRFEDLLQ* |
| Ga0079270_14372413 | 3300007333 | Marine | MSTLAHEDMLLDIFDQVQEAFPYLDEEKQIEIANQRFEDLLQ* |
| Ga0079269_14734121 | 3300007334 | Marine | MSTLHHEDMLLDIFEEVQEAFPYLDEEKQIEIANNRFQDLLQ* |
| Ga0079244_13235732 | 3300007337 | Marine | MSTLHHEDMLLQIFDEVQEAFPYLDEEKQIEIANNKFQELCQ*CMNLTDTT |
| Ga0102800_12976801 | 3300007608 | Marine | PPMSTQHHEDLLLSIFDEVCEAFPYLDEEQQIEIANNRFQEICQ* |
| Ga0102799_10611535 | 3300007613 | Marine | HHEDLLLSIFDEVCEAFPYLDEDKQIEIANQRFEDLCQ* |
| Ga0102799_14079131 | 3300007613 | Marine | IFMSTLHHEDLLLTIFEEVQEAFPYLDEDKQIEIANNRFQEMCI* |
| Ga0103837_10032063 | 3300009342 | River Water | MSTLHHEDMLLQIFDEVCEAFPYLDEEKQIEIANNRFWELAQ* |
| Ga0129295_117441571 | 3300009536 | Marine | MSTLHHEDMLLEIFDEVCEAFPYLDEEKQIEIANNKFQELYQ* |
| Ga0115013_103362524 | 3300009550 | Marine | MSTLHHEDMLLEIFDEVQEAFPYYDEEKQIEIANNRFQ |
| Ga0115013_111956441 | 3300009550 | Marine | TMSTLHHEDMLLEIFDEVQEAFPYYDEEKQIEIANNRFQELCQ* |
| Ga0115011_1000137619 | 3300009593 | Marine | MSTQHHEDRLLDIFQEIKEAFPYLNEDKQIELANKRFEDELI* |
| Ga0115012_100685833 | 3300009790 | Marine | MSTQHHEDRLLDIFQEIKEAFPYLDEDKQIELANKRFEDELI* |
| Ga0115012_103106512 | 3300009790 | Marine | MSTLHHEDLILSIFEEVQEVFPYLTEEQQAKIAVQRFEDLCQ* |
| Ga0115012_104884932 | 3300009790 | Marine | MSTLHHEDLLWSIFDEVCEEFPNYDEDKRIEIANQRFEDLCQ* |
| Ga0115012_106294192 | 3300009790 | Marine | MSTLHHEDLLLSIFDEVCEAFPYLDEEKQIEIANNRFEEMCQ* |
| Ga0115012_107502084 | 3300009790 | Marine | NPFQIMSTLHHEDLLWDIFDEVIENFPYLDEEKQIEIANKRFEELCQ* |
| Ga0115012_112855401 | 3300009790 | Marine | MSTLHHEDMLLQIFDEVCEAFPYLDEEKQIEIANKRFEEICQ* |
| Ga0115012_115509102 | 3300009790 | Marine | MSTLHHEDMLLEIFEDVKEAFPYLDEEKQIEIANNRFYDMCQ* |
| Ga0098043_11419071 | 3300010148 | Marine | MSTLHHEDMLLEIFDEVQENFPYLDEDKQIEIANNRFQE |
| Ga0138402_10367934 | 3300011315 | Marine | MSTLHHEDMLLDIFEEVQEAFPYLDEEKQIEIANNRFQDLCQ* |
| Ga0138402_11404681 | 3300011315 | Marine | EDLLLTIFEEVQEAFPYLDEDKQIEIANNRFQELCI* |
| Ga0138403_10671262 | 3300011326 | Marine | MSTLHHEDLLLSIFEEVQEAFPYLDEEKQIEIANNRFWEIAQ* |
| Ga0138403_10743211 | 3300011326 | Marine | LIMSTLHHEDMLLQIFDEVQEAFPYLDEEKQIEIANNRFQDLCQ* |
| Ga0138403_12493121 | 3300011326 | Marine | GNFIIMSTLHHEDLLLTIFEEVQEAFPYLDEDKQIEIANNRFWEIAQ* |
| Ga0138384_10942881 | 3300011331 | Marine | STLHHEDMLLEIFDEVQENFPYLDEEKQIEIANNRFQELCQ* |
| Ga0160422_1001728013 | 3300012919 | Seawater | ERTYKGVIIMSTLHHEDMLLEIFEDVKEAFPYLDEDKQIEIANNRFQDLCQ* |
| Ga0160422_100810052 | 3300012919 | Seawater | MSTLHHEDLLWDIYDEVIENFPYLDEEKQIELAHKKFEELCQ* |
| Ga0160422_101078525 | 3300012919 | Seawater | MSTLHHEDLLLSIFDEVCEAFPYLDEDKQIEIANQRFEDMCQ* |
| Ga0160422_101520142 | 3300012919 | Seawater | MSVLHHEDLLISIFEEVQEAFPYLSEDKQIEIANKRFEDLCQ* |
| Ga0160422_102423431 | 3300012919 | Seawater | MSTLHHEDLLLSIFDEVCEAFPYLDEDKQIEIANARFEDLCQ* |
| Ga0160422_105077341 | 3300012919 | Seawater | MSTLYHEDMLLQIFDEVCEAFPYLDEDKQIEIANQRFEDMCQ* |
| Ga0160422_107948411 | 3300012919 | Seawater | LHHEDLLLTIFEEVQECFPYYDEDKQIEIANKRFEELCQ* |
| Ga0160422_111704911 | 3300012919 | Seawater | MSTLHHEDLLLSIFDEVCEAFPYLDEDKQIEIANAR |
| Ga0160423_101553812 | 3300012920 | Surface Seawater | MSTLHHEDLLLSIFDEVCEAFPYLDEDKQIEIANKRFEDMCQ* |
| Ga0160423_111783681 | 3300012920 | Surface Seawater | CLQNELLLETIFEEVQECFPYYDEEKQIEIAKKRFDDLCQ* |
| Ga0163110_1000969810 | 3300012928 | Surface Seawater | MSTLHHEDMLLQIFDEVCEAFPYLDEEKQIEIANARFDEVCQ* |
| Ga0163110_1002558513 | 3300012928 | Surface Seawater | LSMSTLHHEDLLLSIFDEVCEAFPYLDEEKQIEIANNRFQELCQ* |
| Ga0163110_100413374 | 3300012928 | Surface Seawater | MSTLHHEDMLLQIFDEVKEAFPYYDEEKQIEIANQRFQDMCQ* |
| Ga0163110_102352352 | 3300012928 | Surface Seawater | MSTLHHEDLLLSIFDEVCEAFPYLDEEKQIEIANNRFQELCQ* |
| Ga0163110_108227922 | 3300012928 | Surface Seawater | MSTLHHEDLLLSIFEEVQEAFPYYDEEKQIEIANNRFQELCQ* |
| Ga0163110_110421721 | 3300012928 | Surface Seawater | MSTQHHEDMLLQIFDEVCEAFPYLDEEQQIEIANNRFQDMCQ* |
| Ga0163110_111908161 | 3300012928 | Surface Seawater | NLIFMSTLHHEDLLLSIFDEVQEAFPYLDEEKQIEIANNRFQDLCQ* |
| Ga0163110_113401151 | 3300012928 | Surface Seawater | MSTLHHEDMLLQIFDEVCEAFPYYDEEKQIEIANNRFEELCQ* |
| Ga0163110_116919013 | 3300012928 | Surface Seawater | HEDLLWDIYDEVIENFPYLSEEKQIELAHKKFEEMCQ* |
| Ga0163110_117844553 | 3300012928 | Surface Seawater | STLHHEDLLLSIFDEVCEAFPYLDEDKQIEIANNRFEELCQ* |
| Ga0163109_109895402 | 3300012936 | Surface Seawater | MSCLQNELLLETIFEEVQECFPYYDEEKQIEIAKKRFDDLCQ* |
| Ga0163109_113813332 | 3300012936 | Surface Seawater | MSTLHHEDMLLQIFDEVCEAFPYLDEEKQIEIANNRFQE |
| Ga0163180_100301937 | 3300012952 | Seawater | MSTLHHEDMLLEIFEDVKEAFPYMDEEKQIEIANNRFYDMCQ* |
| Ga0163180_101403994 | 3300012952 | Seawater | MSTLHHEDLLLSIFDEVCEAFPYLDEDKQIEIANQRFEDICQ* |
| Ga0163180_101894153 | 3300012952 | Seawater | MSCLQNEELLEDIFEEVKEAFPYLSTGKQIEIANNRFEDLCQ* |
| Ga0163180_102199194 | 3300012952 | Seawater | MSTLHHEDLLWDIYDEVIENFPYLDEEKQIEIANKRFEEMCQ* |
| Ga0163180_109505183 | 3300012952 | Seawater | EDLLWDIFDEVIENFPYLDEEKQIEIANKRFEELCQ* |
| Ga0163180_113297032 | 3300012952 | Seawater | MSTLHHEDLLWDIFDEVCENFPYLDEEKQIEIANNRF |
| Ga0163180_114109461 | 3300012952 | Seawater | MSTLHHEDLLWDIFDEVVENFPYLDEEKQIEIANKKFEELCQ* |
| Ga0163179_1000334220 | 3300012953 | Seawater | MSTLHHETILETIFEEVQECFPFLTEEAQIELANKRFEESAQ* |
| Ga0163179_101181802 | 3300012953 | Seawater | MSTLHHEDMLLEIFDEVCEAFPYLDEEKQIEIANNRFQYELCQ* |
| Ga0163179_113627432 | 3300012953 | Seawater | MSTLTHEDMLLEIFDEVQEAFPYYDEDKQIEIANKRFEDLCQ* |
| Ga0163179_121155851 | 3300012953 | Seawater | MSTLTHEDMLLDIFEEVQENFPYLDEEKQIEIANNRFQELCQ* |
| Ga0163179_121215423 | 3300012953 | Seawater | MSTLHHEDLLLQIFDEVQEAFPYLDEEKQIEIANNRFYEVCQ* |
| Ga0163111_103269003 | 3300012954 | Surface Seawater | MSTLHHEDLLWDIYDEVIENFPYLDEEKQIEIANKRFEELCQ* |
| Ga0163111_109829061 | 3300012954 | Surface Seawater | NKQNTMSTLHHEDMLLQIFDEVQEAFPYYDEEKQIEIANNRFQELCQ* |
| Ga0163111_126852051 | 3300012954 | Surface Seawater | TLHHEDMLLQIFDEVCEAFPYLDEEKQIEIANNRFQELCQ* |
| Ga0116816_10634262 | 3300014030 | Marine | MSTLHHEDLILSIFEEVQEAFPYLSEEQQAKIAVQRF |
| Ga0181383_10065025 | 3300017720 | Seawater | MSTLHHEDLLLTIFEEVQEAFPYLDEDVQIMLANNRFEEQCQ |
| Ga0181383_11330732 | 3300017720 | Seawater | MSTLQNEELLEQIFEEVKEAFPYLSTGKQIEIANNRFEDLCQ |
| Ga0181383_12054551 | 3300017720 | Seawater | MSTLTHEDMLLEIFDEVQENFPYLDEDKQIEIANKRFEDL |
| Ga0181428_10103142 | 3300017738 | Seawater | MSTLHHEDLLLTIFEEVQEAFPFLEEDVQIMIANNRFEEMCQ |
| Ga0181428_10768681 | 3300017738 | Seawater | DMLLDIFDEVQENFPYLDEDKQIEIANKRFEDLCQ |
| Ga0181428_11201852 | 3300017738 | Seawater | MSTLHHEDMLLEIFDEVQEAFPYLDEDKQIEIANNRFEEQCQ |
| Ga0181428_11476231 | 3300017738 | Seawater | NIMSTLTHADMLLDIFDEVQENFPYLDEDKQIEIANKRFEDLCQ |
| Ga0181433_11722551 | 3300017739 | Seawater | THEDMLLDIFDEVQENFPYLDEDKQIEIANKRFEDLCQ |
| Ga0181421_10628672 | 3300017741 | Seawater | MSTLTHEDMLLDIFDEVQENFPYLDEDKQIEIANNRFQELCQ |
| Ga0181393_10227991 | 3300017748 | Seawater | GETLTHEDMLLDIFDEVQENFPYLDEDKQIEIANKRFEDLCQ |
| Ga0181405_100947210 | 3300017750 | Seawater | MSTLTHEDMLLEIFDEVCEAFPYYDEDKQIEIANKRFEDLCQ |
| Ga0181407_10583231 | 3300017753 | Seawater | LLIIMSTLTHEDMLLDIFDEVQENFPYLDEDKQIEIANKRFEDLCQ |
| Ga0181411_10628875 | 3300017755 | Seawater | DMLLDIFDEVQENFPYLDEDKQIEIANNRFQELCQ |
| Ga0181414_11092623 | 3300017759 | Seawater | MSTLTHEDMLLDIFDEVQENFPYLDEDKQIEIAKKRLEDLFQ |
| Ga0181385_11753641 | 3300017764 | Seawater | TLSSNHLLIIMSTLTHEDMLLDIFDEVQENFPYLDEDKQIEIANKRFEDLCQ |
| Ga0181413_10334164 | 3300017765 | Seawater | MSTLYHEDLLLSIFEEVQEAFPYYDEEKQIEIANNRFEELCQ |
| Ga0181413_12090403 | 3300017765 | Seawater | MSTLTHEDMLLDIFDEVQENFPYLDEDKQIEIANKRFEDLCQXCMN |
| Ga0181413_12298341 | 3300017765 | Seawater | MSTLTHEDMLLEIFDEVQEAFPYYDEEKQIEIANNRFQELCQ |
| Ga0181406_10939623 | 3300017767 | Seawater | MSTLHHEDLLLTIFDEVQEAFPYLDEDKQIEIANNRFEEQCQ |
| Ga0181406_12621002 | 3300017767 | Seawater | MSTLHHEDMLLQIFDEVCEAFPYLDEEKQIEIANNRFQYELCQ |
| Ga0187221_11178194 | 3300017769 | Seawater | MSTLTHEDMLLEIFDEVCEAFPYYDEDKQIEIANNRFQ |
| Ga0181423_11081733 | 3300017781 | Seawater | MSTLHHEDMLLDIFDEVQENFPYLDEDKQIEIANKRFEDLCQ |
| Ga0193545_100882701 | 3300019025 | Marine | MSTLTHEDMLLDIFEEVQENFPYLDEDKQIEIANKRFEDLCQ |
| Ga0211701_10045723 | 3300020242 | Marine | MSTLHHEDLLLTIFEEVQEAFPYLDEEKQIEIANNRFQELCI |
| Ga0211701_10270152 | 3300020242 | Marine | MSTLHHEDLLLSIFDEVCEEFPYLNEDKQIELANQRFEDMCEXMIILRTNSL |
| Ga0211711_10269144 | 3300020245 | Marine | MSTLHHEDMLLQIFDEVCEAFPYYDEEKQIEIANNRFQ |
| Ga0211707_10052044 | 3300020246 | Marine | MSTLHHEDMLLEIFEDVKEAFPYLDEDKQIEIANNRFHDLCQ |
| Ga0211707_10093255 | 3300020246 | Marine | MSTLHHEDLLLSIFDEVCEAFPYLDEDKQIEIANNRFEELCQ |
| Ga0211707_10097862 | 3300020246 | Marine | MSTLHHEAILETIFEEVQEAFPYLDEDKQIEIANQRFQDMCQ |
| Ga0211707_10215341 | 3300020246 | Marine | KYGNFIFMSTLHHEDLLLTIFEEVQEAFPYLDEDQQIEIANNRFQEVCQ |
| Ga0211584_10087444 | 3300020248 | Marine | MSTLHHEDMLLDIFEEVQEAFPYLDEEKQIEIANNKFQELCQ |
| Ga0211584_10505143 | 3300020248 | Marine | MSTLHHEDLLLQIFDEVQEAFPYLDEEKQIEIANNRFQEICQ |
| Ga0211635_10019346 | 3300020249 | Marine | MSTLHHEDLLLSIFDEVCEAFPYLDEDKQIEIANQRFEDLAQ |
| Ga0211635_10340241 | 3300020249 | Marine | QGLKTMSTLTHEDMLLDIFDEVQENFPYLDEDKQIEIANKRFEDLCQ |
| Ga0211627_10592251 | 3300020250 | Marine | MSTLHHEDMLLQIFDEVCEAFPYYDEEKQIEIANNRFQELCQ |
| Ga0211700_10044225 | 3300020251 | Marine | MSTLHHEDLLLSIFDEVQEAFPYLDEEKQIEIANNKFEELCQ |
| Ga0211700_10167291 | 3300020251 | Marine | MSTLHHEDLLLTIFEEVQEAFPYLDEEKQIEIANNRFQEVCQ |
| Ga0211700_10192653 | 3300020251 | Marine | MSTLHHEDLLLSIFDEVCEEFPYLNEDKQIELANQRFEDMCE |
| Ga0211696_10289693 | 3300020252 | Marine | MSTLHHEDLLWDIFDEVVENFPYLDEEKQIEIANQRFEDMCQ |
| Ga0211586_10039349 | 3300020255 | Marine | MSTLHHEDLLWDIFDEVCENFPYLDEEKQIEIANKRFEELCQ |
| Ga0211586_10231692 | 3300020255 | Marine | MSTLHHEDLLLTIFEEVQEAFPYLDEDKQIEIANNRFQEMCI |
| Ga0211586_10734141 | 3300020255 | Marine | MSTLHHEDILLSIFEEVQEAFPYLDEEKQIEIANNRFEEVCQ |
| Ga0211704_10032107 | 3300020257 | Marine | DLLLTIFEEVQEAFPYLDEDKQIEIANNRFQEIAQ |
| Ga0211704_10089093 | 3300020257 | Marine | MSTLHHEDLLLTIFEEVQEAFPYLDEDKQIEIANNRFQELCI |
| Ga0211704_10358501 | 3300020257 | Marine | MSTLHHEAILETIFEEVQEAFPYLDEDKQIEIANQRFQD |
| Ga0211704_10693811 | 3300020257 | Marine | MSCLQNELLLESIFEEVQEAFPYLDEAKQIEIAKNRFDDL |
| Ga0211633_10731602 | 3300020259 | Marine | MSTLHHEDLLLTIFDEVCEAFPYLDEEKQIEIANNRFQEMCQ |
| Ga0211588_10230235 | 3300020260 | Marine | MSTLHHEDLLLQIFDEVQEAFPYLDEEKQIEIANNRFQEMCV |
| Ga0211588_10521892 | 3300020260 | Marine | MSTLHHEDLLLTIFEEVQEAFPYLDEDQQIEIANNRFQEVCQ |
| Ga0211588_10720891 | 3300020260 | Marine | MSTLHHEDLLLSIFDEVQEAFPYLDEDKQIEIANQRFEDMCE |
| Ga0211534_10402711 | 3300020261 | Marine | MSTLHHEDLLLTIFEEVQECFPYYDEDKQIEIANNRFEELCQ |
| Ga0211533_10094474 | 3300020265 | Marine | MSTLHHEDLLLQIFDEVQEAFPYLDEEKQIEIANNRFQEM |
| Ga0211533_10595262 | 3300020265 | Marine | MSTLTHEDMLLEIFDEVQEAFPYYDEEKQIEIANKRFEDLCQ |
| Ga0211484_10041711 | 3300020269 | Marine | MSTLHHEDLLLQIFDEVQEAFPYLDEEKQIEIANNRFQEMC |
| Ga0211484_10106274 | 3300020269 | Marine | MSTLHHEDLLLSIFDEVCEAFPYLDEDKQIEIANQRFEDLCQ |
| Ga0211671_10167353 | 3300020270 | Marine | MSTLHHEDLLLSIFDEVQEAFPYLDEDKQIEIANQRFEELCQ |
| Ga0211658_10367914 | 3300020274 | Marine | MSTLHHEDLLLQIFDEVCEAFPYYDEDKQIEIANNRFQELCQ |
| Ga0211634_10202216 | 3300020279 | Marine | MSTLHHEDLLLSIFDEVCEAFPYLDEDKQIEIANQRFEEMGQ |
| Ga0211483_100268721 | 3300020281 | Marine | MSTLHHEDLLLTIFEEVQEAFPYLDEDKQIEIANNRFWDLAQ |
| Ga0211483_101461911 | 3300020281 | Marine | SQPMSTLHHEDLLLSIFDEVCEAFPYLDEDKQIEIANQRFEDLCQ |
| Ga0211483_102118302 | 3300020281 | Marine | MSTLHHEDMLLDIFEEVQENFPYLDEEKQIEIANNRFQELCQ |
| Ga0211483_102375404 | 3300020281 | Marine | MSTLHHEDMLLDIFDQVQEAFPYLDEEKQIEIANQRFEDLLQ |
| Ga0211619_10160524 | 3300020288 | Marine | MSTLHHEDLLWQIFEEVQEAFPYYDEEKQIEIANNRFQELCQ |
| Ga0211474_10013084 | 3300020296 | Marine | MSTLHHESILETIFEEVQEAFPYMTEEVQIMIANQRFEDMCQ |
| Ga0211474_10065975 | 3300020296 | Marine | MSTLHHEDLLLQIFDEVQEAFPYLDEEKQIEIANNRFYEVCQ |
| Ga0211474_10077913 | 3300020296 | Marine | MSCLQNEELLEDIFEEVKEAFPYLSTGKQIEIANNRFEDLCQ |
| Ga0211474_10167304 | 3300020296 | Marine | MSTLHHEDMLLEIFEDVKEAFPYMEEEKQIEIANNRFYDMCQ |
| Ga0211490_10244514 | 3300020297 | Marine | MSTLHHEDLLLTIFEEVQEAFPYLDEDKQIEIANNRFQELC |
| Ga0211490_10590661 | 3300020297 | Marine | MSTLHHEDLLLQIFDEVQEAFPYLDEEKQIEIANNRFQE |
| Ga0211615_10262991 | 3300020299 | Marine | MSVLHHEDLLISIFEEVQEAFPYLNEDKQIEIANKRFEDMSQ |
| Ga0211615_10298631 | 3300020299 | Marine | MSVLHHEDMLLQIFEEVQEAFPYYDEEKQIEIANQRFQDMCQ |
| Ga0211615_10544082 | 3300020299 | Marine | MSTLHHEDLLWDILDEVIENFPYLDEEKQIEIANQRFEDMCQ |
| Ga0211615_10556002 | 3300020299 | Marine | MSVLHHAEILENIFEEVQEAFPYLDEDKQIEIANQRFQDMCQ |
| Ga0211650_10573033 | 3300020301 | Marine | QIMSTLHHEDLLWDILDEVIENFPYLDEEKQIEIANQRFEDMCQ |
| Ga0211616_10617273 | 3300020306 | Marine | MSTLHHEEILLSIFDEVQEAFPYLDEEKQIEIANNRFQDMCQ |
| Ga0211542_10939141 | 3300020312 | Marine | MSTLHHEDLLLTIFEEVQEAFPYLDEDKQIEIANNRFWELAQ |
| Ga0211517_10141482 | 3300020319 | Marine | MSTLTHEDMLLDIFDEVQENFPYLDEDKQIEIANKRFEDLCQ |
| Ga0211517_10418562 | 3300020319 | Marine | MSTLHHETILETIFEEVQECFPFLTEEAQIELANKRFEESAQ |
| Ga0211517_10564084 | 3300020319 | Marine | MSTLHHEDMLLEIFDEVCEAFPYYDEEKQIEIANNKFQELCQ |
| Ga0211626_10781692 | 3300020343 | Marine | MSTLHHEDLLLSIFEEVQEAFPYYDEEKQIEIANNRFQEMCQ |
| Ga0211706_100197011 | 3300020345 | Marine | MSVLHHEEILLSIFEEVKEEFPYMDEEKQIEITNERFAERCQ |
| Ga0211706_11243082 | 3300020345 | Marine | MSTLHHEDMLLDIFEEVQENFPYLDEEKQIEIANN |
| Ga0211703_100438172 | 3300020367 | Marine | MSTLHHEDLLLTIFEEVQEAFPYLDEDKQIEIANNRFQEIAQ |
| Ga0211703_101398422 | 3300020367 | Marine | MSTLHHEDMLLQIFDEVCEAFPYLDEEKQIEIANNKFQELCQ |
| Ga0211672_101366932 | 3300020370 | Marine | MSTLHHEDLLLSIFDEVQEAFPYLDEDKQIEIANQRFEDLAQ |
| Ga0211672_102200221 | 3300020370 | Marine | MSTLHHEDLLLSIFDEVCEEFPLLNEDKQIELANQRFEDMCEXMIILRTNSL |
| Ga0211647_100567034 | 3300020377 | Marine | MSTLHHEDLLLSIFDEVQEAFPYLDEEKQIEIANNRFQDLCQ |
| Ga0211647_101199751 | 3300020377 | Marine | MSTLHHEDLLLSIFDEVCEAFPYLDEDKQIEIANARFEDMCQ |
| Ga0211498_101884054 | 3300020380 | Marine | MSTLHHEDLLLSIFEEVQEAFPYLDEDKQIEIANKTFEDRLL |
| Ga0211596_100398593 | 3300020384 | Marine | MSTLHHEDLLLTIFEEVQEAFPYYDEDKQIEIANKRFEELCQ |
| Ga0211582_102561203 | 3300020386 | Marine | MSTLHHEDMLLDIFEEVQENFPYLDEEKQIEIANNRFQELCQXCTNLTDT |
| Ga0211590_102509464 | 3300020387 | Marine | STLHHEDLLLTIFEEVQEAFPYLDEEKQIEIANNRFQELCI |
| Ga0211618_102937753 | 3300020393 | Marine | NYGNLIFMSTLHHEDLLLTIFEEVQEAFPYLDEEKQIEIANNRFQDMCL |
| Ga0211617_1000480915 | 3300020401 | Marine | MSTLHHEDLLLQIFDEVQEAFPYYDEEKQIEIANQRFQDMCQ |
| Ga0211617_100110378 | 3300020401 | Marine | MSTLHHEDLLLSIFDEVCEAFPYLDEDKQIEIANKRFEDMCQ |
| Ga0211617_101676342 | 3300020401 | Marine | MSVLHHEDMLLQIFDEVQEAFPYLDEDKQIEIANKRFEDMCQ |
| Ga0211532_103588571 | 3300020403 | Marine | MSTLHHEDMLLQIFDEVQEAFPYLDEEKQIEIANNRFQ |
| Ga0211659_1001081511 | 3300020404 | Marine | MSTLHHEDILLQIFDEVCEAFPYLDEEKQIEIANNRFEDLCQ |
| Ga0211659_100503645 | 3300020404 | Marine | MSTLHHEDMLLEIFDEVQENFPYLDEEKQIEIANNRFQELCQ |
| Ga0211496_100429523 | 3300020405 | Marine | MSTLHHEDLLWQIFEEVQEAFPYYDEEKQIEIANNRFQDLCQ |
| Ga0211496_101535133 | 3300020405 | Marine | MSTLHHEDMLLQIFDEVQEAFPYYDEEKQIEIANNRFQELCQ |
| Ga0211496_103113153 | 3300020405 | Marine | STLHHEDMLLDIFEEVQENFPYLDEDKQIEIANQRFEDLLQ |
| Ga0211668_100384453 | 3300020406 | Marine | MSTLHHEDLLLSIFDEVCEAFPYLDEDKQIEIANQRFEDMCE |
| Ga0211651_101491882 | 3300020408 | Marine | MSCLQNELLLETIFEEVQEAFPYYDEEKQIEIANNRFQELCQ |
| Ga0211651_101990583 | 3300020408 | Marine | TQEFPTMSTLHHEDLLLSIFDEVCEAFPYLDEDKQIEIANARFEDLCQ |
| Ga0211472_100819613 | 3300020409 | Marine | MSTQHHEDMLLQIFDEVCEAFPYLDEEQQIEIANNRFQEICQ |
| Ga0211472_104266732 | 3300020409 | Marine | MSTQHHEDMLLQIFDEVQEAFPYLDEEKQIEIANNRFQDLCQ |
| Ga0211472_104532132 | 3300020409 | Marine | MSTLHHEDLLWDIFDEVIENFPYLDEEKQIEIANKRFEEL |
| Ga0211699_100701631 | 3300020410 | Marine | MSTLHHEDLLLSIFDEVQEAFPYLDEEKQIEIANNKFEE |
| Ga0211699_100877953 | 3300020410 | Marine | MSTLHHEDLLLSIFDEVQEAFPYLDEEKQIEIANNRFEDLCQ |
| Ga0211699_102326992 | 3300020410 | Marine | MSCLQNEMLLESIFEEVQECFPYYDEAKQIEIAQQRFDDLCQ |
| Ga0211699_103200051 | 3300020410 | Marine | DLLLTIFEEVQEAFPYLDEDKQIEIANNRFQELCI |
| Ga0211699_104168703 | 3300020410 | Marine | MSTLHHEDMLLEIFDEVCEAFPYLDEEKQIEIANNKFQEL |
| Ga0211587_100379072 | 3300020411 | Marine | MSTLHHEDLLLSIFEEVQEAFPYLDEDKQIEIANKRFDEVCV |
| Ga0211587_101052593 | 3300020411 | Marine | MSCLQNELLLETIFEEVQEAFPYLDEEKQIEIANNRFQEKH |
| Ga0211587_101340742 | 3300020411 | Marine | MSTLHHEDLLLSIFEEVQEAFPYLDEDKQIEIANNRFEEVCQ |
| Ga0211587_102522841 | 3300020411 | Marine | MSTLHHEDMLLDIFEEVQENFPYLDEDKQIEIANQKFEDLLQ |
| Ga0211516_103160252 | 3300020413 | Marine | HHEDLLLTIFEEVQEAFPYLEEDVQIMLANKRFEDMCQ |
| Ga0211516_104266353 | 3300020413 | Marine | EDLLLSIFDEVCEAFPYLDEDKQIEIANQRFEEMGQ |
| Ga0211644_100377883 | 3300020416 | Marine | MSTLHHEDMLLEIFDEVQENFPYLDEEKQIEIANNRFQDLCQ |
| Ga0211644_102154675 | 3300020416 | Marine | PMSTLHHEDILLQIFDEVCEAFPYLDEEKQIEIANNRFEDLCQ |
| Ga0211557_1000450013 | 3300020418 | Marine | MSVLHHEDLLISIFEEVQEAFPYLDEDKQIEIANKKFEDLCQ |
| Ga0211512_101248033 | 3300020419 | Marine | MSTLHHEDMLLEIFDEVQEAFPYYDEEKQIEIANNRFQELCQ |
| Ga0211512_102367761 | 3300020419 | Marine | MSTLHHEDMLLQIFDEVCEAFPYYDEEKQIEIANNRF |
| Ga0211512_104379263 | 3300020419 | Marine | MSTLHHEDLLWDIFDEVVENFPYLDEEKQIEIANNRFEEMCQ |
| Ga0211580_100644657 | 3300020420 | Marine | MSCLQNEELLEQIFEEVQEAFPYLSTGKQIEIANNRFEDLCQ |
| Ga0211580_100674365 | 3300020420 | Marine | MSTLHHEDMLLEIFDEVCEAFPYYDEEKQIEIANNRFQELCQ |
| Ga0211580_101209774 | 3300020420 | Marine | MSTLQNEELLEQIFEEVKEAFPYLSTGKQIEIANN |
| Ga0211620_103462812 | 3300020424 | Marine | MSTLHHEDLLLSIFDEVCEAFPYLDEEKQIEIANNRFEELCQ |
| Ga0211620_103834172 | 3300020424 | Marine | HEDMLLQIFDEVQEAFPYLDEEKQIEIANNRFQELCQ |
| Ga0211620_105155573 | 3300020424 | Marine | LHHEDLLLQIFDEVQEAFPYLDEEKQIEIANNRFQEMCI |
| Ga0211536_100830321 | 3300020426 | Marine | DMLLQIFDEVQEAFPYLDEEKQIEIANNKFQELCQ |
| Ga0211536_101621121 | 3300020426 | Marine | HEDLLLTIFEEVQEAFPYLDEEKQIEIANNRFQEVCQ |
| Ga0211622_102305112 | 3300020430 | Marine | MSTLHHEDLLLSIFDEVQEAFPYLDEDKQIEIANARFEDLCQ |
| Ga0211622_104358152 | 3300020430 | Marine | MSTLHHEEILLNIFDEVQEAFPYLDEEKQIEIANNRFQDMCQ |
| Ga0211565_100127064 | 3300020433 | Marine | MSTLHHEDLLWQIFEEVQEAFPYYDEEKQIEIANNRFQDMCQ |
| Ga0211565_100177225 | 3300020433 | Marine | MSTLHHEDLLLTIFEEVQEAFPYLDEEKQIEIANNRFQDMCLXLN |
| Ga0211565_100244163 | 3300020433 | Marine | MSTLHHEEILLQIFDEVCEAFPYLDEEKQIEIANNRFQDLCQ |
| Ga0211565_104693291 | 3300020433 | Marine | NTMSTLHHEDLLLAIFDEVCEAFPYLDEEKQIEIANNKFQELCQ |
| Ga0211565_105054312 | 3300020433 | Marine | MSVLHHEDLLISIFEEVQEAFPYLNEDKQIEIAKKRFEDLCQ |
| Ga0211708_102004533 | 3300020436 | Marine | MSTLHHEDLLWDIYDEVIENFPYLDEEKQIEIANKRFEELCQ |
| Ga0211708_102201775 | 3300020436 | Marine | EDLLLTIFEEVQECFPYYDEDKQIEIANKRFEELCQ |
| Ga0211708_104018652 | 3300020436 | Marine | MSCLQNELLLESIFEEVQECFPYYDEEKQIEIAKQRFEDLCHPY |
| Ga0211539_101340941 | 3300020437 | Marine | MSTLHHEDMLLQIFDEVCEAFPYLDEEKQIEIANNRF |
| Ga0211539_101718771 | 3300020437 | Marine | MSTLHHEDLLLSIFDEVCEAFPYLDEDKQIEIANK |
| Ga0211539_104032892 | 3300020437 | Marine | MSTLHHEDLLLTIFEEVQEAFPYLDEDKQIEIANNRF |
| Ga0211539_104728192 | 3300020437 | Marine | MSTLHHEDLLLSIFDEVQEAFPYLDEDKQIEIANQRFEDLCQ |
| Ga0211539_104948442 | 3300020437 | Marine | MSTLHHEDMLLDIFEEVQENFPYLDEEKQIEIANNRFQDLLQ |
| Ga0211559_103321022 | 3300020442 | Marine | MSTLHHEDILLSIFDEVCEEFPNYDEDRQIQIANQRFEDICQ |
| Ga0211559_103378171 | 3300020442 | Marine | QNELLLESIFEEVQECFPYYDEEKQIEIAKQRFDDLCQ |
| Ga0211559_105324332 | 3300020442 | Marine | MSTLHHEDLLLSIFDEVCEAFPYLDEEKQIEIANNRFQEMCQXS |
| Ga0211638_100067913 | 3300020448 | Marine | MSTLHHEELLLQIFDEVQEAFPYLDEEKQIEIANNRFQEMCI |
| Ga0211638_105451652 | 3300020448 | Marine | MSCLQNELLLESIFEEVQECFPYYDEAKQIEIAQKRFDDLCQ |
| Ga0211638_105459272 | 3300020448 | Marine | MSTLHHEDMLLEIFDEVQEAFPYLDEEKQIEIANNRFQDLCQ |
| Ga0211641_1000012522 | 3300020450 | Marine | MSTLHHEDLLLQIFDEVQEAFPYYDEEKQIEIANKRFEEQCQ |
| Ga0211641_100667692 | 3300020450 | Marine | MSTLHHEDLLLSIFDEVQEAFPYLDEDKQIEIANNRFEDLCQ |
| Ga0211473_100389605 | 3300020451 | Marine | MSTLHHEDMLLEIFEDVKEAFPYMDEEKQIEIANNRFYDMCQ |
| Ga0211473_103340303 | 3300020451 | Marine | MSTLHHEELLLQIFDEVQEAFPYLDEEKQIEIANNRFYEVCQ |
| Ga0211473_104189723 | 3300020451 | Marine | MSTLQNEELLEDIFEEVKEAFPYLSTGKQIEIANNRFEDLCQ |
| Ga0211473_106642714 | 3300020451 | Marine | EDLLLSIFEEVQEAFPYYDEEKQIEIANNRFQEMCQ |
| Ga0211473_107157992 | 3300020451 | Marine | MSCLQNELLLESIFEEVQECFPYYDEEKQIEIAKNRFDDLCQ |
| Ga0211545_103650451 | 3300020452 | Marine | EDLLLSIFDEVCEAFPYLDEDKQIEIANQRFEDLAQ |
| Ga0211548_100792062 | 3300020454 | Marine | MSTLTHEDMLLDIFDEVQEAFPYYDEDKQIEIANKRFEDLCQ |
| Ga0211535_100603762 | 3300020461 | Marine | MSTLHHEDLLLSIFDEVCEAFPYLDEEKQIEIANQRFEDMCQ |
| Ga0211546_102951691 | 3300020462 | Marine | EDMLLDIFDEVQEAFPYYDEDKQIEIANKRFEDLCQ |
| Ga0211713_100346974 | 3300020467 | Marine | MSTLHHEDLLLSIFDEVCEAFPYLDEDKQIEIANQRFEELCQ |
| Ga0211713_100502271 | 3300020467 | Marine | MSTLHHEDLLLSIFDEVCEEFPLLNEDKQIELANQRFEDMCE |
| Ga0211713_101473094 | 3300020467 | Marine | MSTLHHEDMLLEIFDEVQEAFPYYDEEKQIEIANKRFE |
| Ga0211713_105688802 | 3300020467 | Marine | MSTLQHEDMLLQIFDEVCEAFPYLDEEKQIEIANNRFQDLCQ |
| Ga0211713_106540852 | 3300020467 | Marine | MSTLHHEDMLLEIFDEVQEAFPYLDEEKQIEIANNKFQELCQ |
| Ga0211475_100061037 | 3300020468 | Marine | MSTLHHEDLLLNIFEEVQEAFPYLDEDQQIEIANNRFQEVCQ |
| Ga0211577_102994792 | 3300020469 | Marine | MSTLHHEDLLLTIFEEVQEAFPYLEEDVQIMIANKRFEDICQ |
| Ga0211543_100233927 | 3300020470 | Marine | MSTLHHEDLLLSIFDEVCEAFPYLDEEKQIEIANNRFQEMCQ |
| Ga0211543_102714743 | 3300020470 | Marine | MSTLHHEDMLLDIFEEVQENFPYLDEDRQIEIANQRFEDLLQ |
| Ga0211543_103341522 | 3300020470 | Marine | MSTLHHEDLLLSIFDEVCEEFPYLDEEKQIQIANNRFEDLCQ |
| Ga0211614_100185476 | 3300020471 | Marine | MSTLHHEDLLLSIFDEVCEAFPYLDEDKRIEIANQRFEDMCQ |
| Ga0211614_100275466 | 3300020471 | Marine | MSTLHHEDLLLSIFDEVCEAFPYLDEEKQIEIANQRFEDICQ |
| Ga0211614_102934231 | 3300020471 | Marine | STLHHEDLLLTIFEEVQEAFPYLDEEQQIEIANNRFQEVCI |
| Ga0211547_105979351 | 3300020474 | Marine | LHHEDLLLSIFDEVCEAFPYLDEDKQIEIANQRFEDLAQ |
| Ga0211503_105208752 | 3300020478 | Marine | MSTLHHEDMLLEIFDEVQENFPYLDEDKQIEIANQRFEDLLQ |
| Ga0226832_104290552 | 3300021791 | Hydrothermal Vent Fluids | MSTLHHEDMLLQIFDEVQEAFPYLDEEKQIEIANNRFWEIAQ |
| Ga0226836_106571441 | 3300021792 | Hydrothermal Vent Fluids | TLHHEDLLWDIYDEVIENFPYLSEDDQIKKTYELFEELAQ |
| Ga0232645_13058502 | 3300021974 | Hydrothermal Vent Fluids | NLIFMSTLHHEDLLLTIFEEVQENFPYLDEEKQIEIANNRFQELCQ |
| Ga0232639_10477484 | 3300021977 | Hydrothermal Vent Fluids | MSTQHHEDMLLQIFDEVCEAFPYLDEEKQIEIANNRFQELCQ |
| Ga0224906_10108352 | 3300022074 | Seawater | MSTLHHESILETIFEEVLIDFPTLDEDVQIMIANKRFEDMCQ |
| Ga0224906_11306082 | 3300022074 | Seawater | MSTLQNTIILETIFEEVQDAFPYLDEDKQIEIANQRFEDMCQ |
| Ga0208157_100009040 | 3300025086 | Marine | MSTLHHEDMLLEIFDEVQENFPYLDEDKQIEIANNRFQELCQ |
| Ga0208159_10559161 | 3300025101 | Marine | LKTMSTLHHEDMLLEIFDEVQENFPYLDEEKQIEIANNRFQELCQ |
| Ga0209348_100171512 | 3300025127 | Marine | MSTLHHEDLLLTIFDEVCEAFPYLDEDKQIEIANRRFEELCQ |
| Ga0209348_10365116 | 3300025127 | Marine | MSTLHHEDMLLQIFDEVCEAFPYLDEEKQIEIANNRFQELCQ |
| Ga0209348_10432414 | 3300025127 | Marine | MSTLHHEDLLLSIFDEVQEEFPYLDEDKQIEIANQRFEDMCR |
| Ga0209348_10475091 | 3300025127 | Marine | MSTLHHEDLLLTIFDEVCEAFPYLDEDKQIEIANRRFE |
| Ga0209348_10562674 | 3300025127 | Marine | MSTLHHEDMLLEIFEDVKEAFPYLDEDKQIEIANNRFYDLCQ |
| Ga0209348_10742465 | 3300025127 | Marine | EDLLLTIFDEVCEAFPYLDEDKQIEIANRRFEELCQ |
| Ga0209348_10781621 | 3300025127 | Marine | MSTLHHEDMLLEIFDEVCEAFPYLDEEKQIEIANNKFQELCQ |
| Ga0209348_11079343 | 3300025127 | Marine | MSTLHHEDLLLSIFDEVQEAFPYLDEEKQIEIANNRFQE |
| Ga0209348_11293563 | 3300025127 | Marine | IMSTLTHEDMLLDIFEEVQENFPYLDEDKQIEIANKRFEDLCQ |
| Ga0209348_11584981 | 3300025127 | Marine | MSTLTHEDMLLDIFEEVQENFPYLDEDKQIEIANKRFEDLC |
| Ga0209348_11613052 | 3300025127 | Marine | MSTLHHEDLLLSIFEEVQEAFPYLDEEKQIEIANNRFEDLCQ |
| Ga0209348_11687494 | 3300025127 | Marine | QTNNIMSTLTHEDMLLDIFDEVQENFPYLDEDKQIEIANKRFEDLCQ |
| Ga0209348_11972093 | 3300025127 | Marine | LHHEDMLLDIFEEVQENFPYLDEEKQIEIANNRFQDLCQ |
| Ga0209348_12182041 | 3300025127 | Marine | SSREVRIMSTLHHEDMLLQIFDEVQEAFPYLDEEKQIEIANNRFQELCQ |
| Ga0209232_10227904 | 3300025132 | Marine | MSVLHHEEILLSIFEEVKEEFPQMDEEKQIEITNERFAERCQ |
| Ga0209645_100325815 | 3300025151 | Marine | MSTLHHEDMLLQIFDEVQEAFPYLDEEKQIEIANNRFQELCQ |
| Ga0209645_11222611 | 3300025151 | Marine | MSTLHHEDLLWDIYDEVIENFPYLDEEKQIEIANK |
| Ga0209645_12138381 | 3300025151 | Marine | MSCLQNELLLETIFEEVQECFPYYDEEKQIEIAKQRFDDLCQ |
| Ga0208749_10038292 | 3300026077 | Marine | MSTLQHEDMLLDIFEEVQANFPYLDEDKQIEIANQRFEDLLQ |
| Ga0208749_10153435 | 3300026077 | Marine | MSTLHHEDLILSIFEEVQEVFPYLTEEQQAKIAVQRFEDLCQ |
| Ga0208390_10219312 | 3300026081 | Marine | MSTLHHEDLLLSIFDEVCEEFPYLNEDKQIEIANQRFEDMCE |
| Ga0208390_10240873 | 3300026081 | Marine | MSTLHHEDLLLTIFEEVQEAFPYLDEEKQIEIANNRFQEICQ |
| Ga0208878_101063210 | 3300026083 | Marine | LHHEDLLLTIFEEVQEAFPYLDEEKQIEIANNRFQEVCQ |
| Ga0208878_10787293 | 3300026083 | Marine | MSTLHHEDLLLTIFEEVQEAFPYLDEDKQIEIANNRFWEIAQ |
| Ga0208624_10330846 | 3300026093 | Marine | DMLLQIFDEVQEAFPYLDEEKQIEIANNRFQDLCQ |
| Ga0208763_10270993 | 3300026136 | Marine | MSTLHHEDMLLDIFEEVQANFPYLDEDKQIEIANQRFEDLLQ |
| Ga0208405_10026085 | 3300026189 | Marine | MSTLHHEDLLLSIFDEVQEAFPYLDEEKQIEIANNRFQEMCQ |
| Ga0208405_10290724 | 3300026189 | Marine | MSTLHHEDLLLSIFDEVQEAFPYLDEEKQIEIANNKFAELCQ |
| Ga0208405_10539702 | 3300026189 | Marine | MSTLHHEDLLLSIFEEVQEAFPYLDEEKQIEIANNRFEDMCQ |
| Ga0208405_10617483 | 3300026189 | Marine | MSTLHHEDMLLDIFEEVQENFPYLDEEKQIEIANNRFQDLCQ |
| Ga0207985_10223153 | 3300026203 | Marine | MSTLHHEDLLLTIFEEVQEAFPYLDEEKQIEIANNRFQEMCI |
| Ga0207985_10450685 | 3300026203 | Marine | EDLLLSIFDEVCEAFPYYDEEKQIEIANKRFEDMCQ |
| Ga0207993_10021351 | 3300026270 | Marine | DLLLSIFDEVCEAFPYLDEDKQIEIANNRFEELCQ |
| Ga0207993_10083817 | 3300026270 | Marine | MSVLHHEDLLISIFEEVQEAFPYLNEDKQIEIANKRFEDLCQ |
| Ga0207993_11119501 | 3300026270 | Marine | HEDLLLTIFEEVQEAFPYLDEDQQIEIANNRFQEVCQ |
| Ga0207993_11681413 | 3300026270 | Marine | MSTLHHEDLLWDIYDEVIENFPYLSEEKQIELAHKKFEELCQ |
| Ga0209036_10512643 | 3300027702 | Marine | MSTLHHEDLLWDIFDEVVENFPYLDEEKQIEIANKRFEEMCQ |
| Ga0209036_10557943 | 3300027702 | Marine | LIFMSTLHHEDLLLTIFEEVQEAFPYLDEDKQIEIANNRFQEMCI |
| Ga0209036_10784063 | 3300027702 | Marine | MSTLHHEDMLLEIFDEVQENFPYLEEDKQIEIANNRFQELCQ |
| Ga0209036_10966153 | 3300027702 | Marine | HEDLLLTIFEEVQEAFPYLDEDKQIEIANNRFQELCI |
| Ga0209036_12119323 | 3300027702 | Marine | EDLLLTIFEEVQEAFPYLDEDKQIEIANNRFQEMCI |
| Ga0209433_100595186 | 3300027774 | Marine | HNTNMSTLHHEDLLLQIFDEVCEAFPYYDEEKQIEIANNRFQELCQ |
| Ga0209433_102273683 | 3300027774 | Marine | LHHEDMLLQIFDEVCEAFPYYDEEKQIEIANNRFQELCQ |
| Ga0209359_103167713 | 3300027830 | Marine | MSTLHHEDLLWDIFDEVIENFPYLDEEKQIEIANKRFEEMCQ |
| Ga0209359_103520401 | 3300027830 | Marine | MSTLHHEDLLLSIFDEVCEEFPYLDEDKQIELANQRFEDMCE |
| Ga0209359_106003881 | 3300027830 | Marine | MSCLQNELLLESIFEEVQECFPYYDEEKQIEIAQQRFEDMCIPF |
| Ga0183748_10410393 | 3300029319 | Marine | MSVLHHEDLLISIFEEVQEAFPYLNEDKQIEIANKKFEDLCQ |
| Ga0183748_10427913 | 3300029319 | Marine | MSTLHHEDMLLQIFDEVQEAFPYLDEEKQIEIANNRFQDLCQ |
| Ga0183748_10662074 | 3300029319 | Marine | DLLLQIFDEVQEAFPYLDEEKQIEIANNRFQEMCI |
| Ga0183748_11367363 | 3300029319 | Marine | KQGLKTMSTLHHEDMLLQIFDEVCEAFPYLDEEKQIEIANNRFQELCQ |
| Ga0183826_10510692 | 3300029792 | Marine | MSTLHHEDLLLSIFDEVQEAFPYLDEDKQIEIANQRFEDMCQ |
| Ga0073988_123011371 | 3300030780 | Marine | HLLIMSTLHHEDMLLDIFDQVQEAFPYLDEEKQIEIANQRFEDLLQ |
| Ga0310343_100307705 | 3300031785 | Seawater | MSTLTHEDMLLQIFDEVQEAFPYYDEEKQIEIANKRFEDLCQ |
| Ga0310343_103122152 | 3300031785 | Seawater | MSTLTHEDMLLDIFDQVQEAFPYLDEEKQIEIANQRFEDLCQ |
| Ga0310343_103127241 | 3300031785 | Seawater | MSTLHHEDLLLSIFDEVCEEFPNYDEDRQIQIANQRFEDICQ |
| Ga0310343_104081541 | 3300031785 | Seawater | LQNELLLESIFEEVQECFPYYDEEKQIEIAKQRFDDLCH |
| Ga0310343_107781514 | 3300031785 | Seawater | MSCLHNEMILENIFEEVQECFPYLSEEKQIEIANKRFED |
| Ga0310343_110600401 | 3300031785 | Seawater | MSCLQNEMLLESIFEEVQEAFPYYDEAKQIEIAQQRFDDLCQ |
| Ga0315316_101431896 | 3300032011 | Seawater | MSTLTHEDMLLEIFDEVQENFPYLDEDKQIEIANKRFEDLCQ |
| Ga0315330_100628974 | 3300032047 | Seawater | MSTLQNEELLEQIFEEVKEAFPYLSTGKQIEIANNRFEELCQ |
| Ga0315330_102906782 | 3300032047 | Seawater | MSTLHHEDMLLQIFDEVCEAFPYYDEDKQIEIANQRFQDLCQ |
| Ga0315330_107548141 | 3300032047 | Seawater | MSTLHHEDMLLEIFEDVKEAFPYMEEEKQIEIANNRFYDMCQXPSW |
| Ga0315315_102271523 | 3300032073 | Seawater | MSTLHHEDLLLSIFDEVCEAFPYLDEDKQIEIANQRVEEMGQ |
| Ga0310342_1001649037 | 3300032820 | Seawater | SKCKSSQIFTPQNTMSTLTHEDMLLQIFDEVQEAFPYYDEEKQIEIANKRFEDLCQ |
| ⦗Top⦘ |