


| Basic Information | |
|---|---|
| Family ID | F002599 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 544 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MTPAWAQRREELLSDCLVSPDVFHQMVDRLGEFVVPYQQALETEA |
| Number of Associated Samples | 279 |
| Number of Associated Scaffolds | 543 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 92.05 % |
| % of genes near scaffold ends (potentially truncated) | 81.07 % |
| % of genes from short scaffolds (< 2000 bps) | 91.54 % |
| Associated GOLD sequencing projects | 244 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.48 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (77.941 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (24.816 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.963 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (49.816 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 52.05% β-sheet: 0.00% Coil/Unstructured: 47.95% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.48 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 543 Family Scaffolds |
|---|---|---|
| PF13546 | DDE_5 | 2.95 |
| PF00076 | RRM_1 | 1.29 |
| PF07929 | PRiA4_ORF3 | 1.10 |
| PF13358 | DDE_3 | 0.92 |
| PF01797 | Y1_Tnp | 0.74 |
| PF13340 | DUF4096 | 0.74 |
| PF01609 | DDE_Tnp_1 | 0.74 |
| PF12680 | SnoaL_2 | 0.55 |
| PF14104 | DUF4277 | 0.55 |
| PF13586 | DDE_Tnp_1_2 | 0.55 |
| PF13565 | HTH_32 | 0.55 |
| PF00211 | Guanylate_cyc | 0.55 |
| PF01850 | PIN | 0.55 |
| PF12762 | DDE_Tnp_IS1595 | 0.55 |
| PF07592 | DDE_Tnp_ISAZ013 | 0.55 |
| PF03400 | DDE_Tnp_IS1 | 0.55 |
| PF01610 | DDE_Tnp_ISL3 | 0.55 |
| PF04978 | DUF664 | 0.55 |
| PF13560 | HTH_31 | 0.55 |
| PF13610 | DDE_Tnp_IS240 | 0.37 |
| PF02705 | K_trans | 0.37 |
| PF02668 | TauD | 0.37 |
| PF01656 | CbiA | 0.37 |
| PF07015 | VirC1 | 0.37 |
| PF13384 | HTH_23 | 0.37 |
| PF12840 | HTH_20 | 0.37 |
| PF02899 | Phage_int_SAM_1 | 0.37 |
| PF13191 | AAA_16 | 0.37 |
| PF11535 | Calci_bind_CcbP | 0.37 |
| PF13495 | Phage_int_SAM_4 | 0.37 |
| PF13408 | Zn_ribbon_recom | 0.37 |
| PF04392 | ABC_sub_bind | 0.37 |
| PF00589 | Phage_integrase | 0.37 |
| PF00873 | ACR_tran | 0.18 |
| PF01436 | NHL | 0.18 |
| PF13020 | NOV_C | 0.18 |
| PF01741 | MscL | 0.18 |
| PF09754 | PAC2 | 0.18 |
| PF13518 | HTH_28 | 0.18 |
| PF01315 | Ald_Xan_dh_C | 0.18 |
| PF04337 | DUF480 | 0.18 |
| PF08883 | DOPA_dioxygen | 0.18 |
| PF13633 | Obsolete Pfam Family | 0.18 |
| PF02321 | OEP | 0.18 |
| PF00999 | Na_H_Exchanger | 0.18 |
| PF00246 | Peptidase_M14 | 0.18 |
| PF02518 | HATPase_c | 0.18 |
| PF03972 | MmgE_PrpD | 0.18 |
| PF01548 | DEDD_Tnp_IS110 | 0.18 |
| PF07508 | Recombinase | 0.18 |
| PF13238 | AAA_18 | 0.18 |
| PF03683 | UPF0175 | 0.18 |
| PF01098 | FTSW_RODA_SPOVE | 0.18 |
| PF13193 | AMP-binding_C | 0.18 |
| PF12759 | HTH_Tnp_IS1 | 0.18 |
| PF03811 | Zn_Tnp_IS1 | 0.18 |
| PF00989 | PAS | 0.18 |
| PF03693 | ParD_antitoxin | 0.18 |
| PF07452 | CHRD | 0.18 |
| PF04851 | ResIII | 0.18 |
| PF05239 | PRC | 0.18 |
| PF00078 | RVT_1 | 0.18 |
| PF02423 | OCD_Mu_crystall | 0.18 |
| PF00571 | CBS | 0.18 |
| PF05443 | ROS_MUCR | 0.18 |
| PF03050 | DDE_Tnp_IS66 | 0.18 |
| PF04454 | Linocin_M18 | 0.18 |
| PF14319 | Zn_Tnp_IS91 | 0.18 |
| PF04754 | Transposase_31 | 0.18 |
| PF00011 | HSP20 | 0.18 |
| PF00012 | HSP70 | 0.18 |
| PF00890 | FAD_binding_2 | 0.18 |
| PF05834 | Lycopene_cycl | 0.18 |
| PF01926 | MMR_HSR1 | 0.18 |
| PF10048 | DUF2282 | 0.18 |
| PF13808 | DDE_Tnp_1_assoc | 0.18 |
| PF07589 | PEP-CTERM | 0.18 |
| PF02452 | PemK_toxin | 0.18 |
| PF01526 | DDE_Tnp_Tn3 | 0.18 |
| PF13700 | DUF4158 | 0.18 |
| PF05114 | DUF692 | 0.18 |
| PF13683 | rve_3 | 0.18 |
| PF12697 | Abhydrolase_6 | 0.18 |
| PF01498 | HTH_Tnp_Tc3_2 | 0.18 |
| PF12867 | DinB_2 | 0.18 |
| PF13737 | DDE_Tnp_1_5 | 0.18 |
| PF02515 | CoA_transf_3 | 0.18 |
| PF00072 | Response_reg | 0.18 |
| PF04365 | BrnT_toxin | 0.18 |
| PF13564 | DoxX_2 | 0.18 |
| PF13458 | Peripla_BP_6 | 0.18 |
| PF13592 | HTH_33 | 0.18 |
| PF02548 | Pantoate_transf | 0.18 |
| PF12695 | Abhydrolase_5 | 0.18 |
| PF14076 | DUF4258 | 0.18 |
| PF08546 | ApbA_C | 0.18 |
| PF00903 | Glyoxalase | 0.18 |
| PF05168 | HEPN | 0.18 |
| PF06794 | UPF0270 | 0.18 |
| PF07045 | DUF1330 | 0.18 |
| PF04986 | Y2_Tnp | 0.18 |
| PF09335 | SNARE_assoc | 0.18 |
| PF13401 | AAA_22 | 0.18 |
| PF00872 | Transposase_mut | 0.18 |
| PF03992 | ABM | 0.18 |
| PF01565 | FAD_binding_4 | 0.18 |
| PF13614 | AAA_31 | 0.18 |
| PF00239 | Resolvase | 0.18 |
| PF09720 | Unstab_antitox | 0.18 |
| PF02800 | Gp_dh_C | 0.18 |
| PF02012 | BNR | 0.18 |
| PF08240 | ADH_N | 0.18 |
| PF13676 | TIR_2 | 0.18 |
| PF07690 | MFS_1 | 0.18 |
| PF01814 | Hemerythrin | 0.18 |
| PF00891 | Methyltransf_2 | 0.18 |
| PF13527 | Acetyltransf_9 | 0.18 |
| PF00496 | SBP_bac_5 | 0.18 |
| PF13359 | DDE_Tnp_4 | 0.18 |
| PF00034 | Cytochrom_C | 0.18 |
| PF07978 | NIPSNAP | 0.18 |
| PF14384 | BrnA_antitoxin | 0.18 |
| PF00656 | Peptidase_C14 | 0.18 |
| PF01695 | IstB_IS21 | 0.18 |
| PF13655 | RVT_N | 0.18 |
| PF00296 | Bac_luciferase | 0.18 |
| PF17195 | DUF5132 | 0.18 |
| PF06884 | DUF1264 | 0.18 |
| PF13508 | Acetyltransf_7 | 0.18 |
| PF05448 | AXE1 | 0.18 |
| PF02738 | MoCoBD_1 | 0.18 |
| PF05973 | Gp49 | 0.18 |
| PF04545 | Sigma70_r4 | 0.18 |
| PF03466 | LysR_substrate | 0.18 |
| PF13419 | HAD_2 | 0.18 |
| COG ID | Name | Functional Category | % Frequency in 543 Family Scaffolds |
|---|---|---|---|
| COG1943 | REP element-mobilizing transposase RayT | Mobilome: prophages, transposons [X] | 0.74 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.74 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.74 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.74 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.74 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.74 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.74 |
| COG1662 | Transposase and inactivated derivatives, IS1 family | Mobilome: prophages, transposons [X] | 0.55 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.55 |
| COG3464 | Transposase | Mobilome: prophages, transposons [X] | 0.55 |
| COG1192 | ParA-like ATPase involved in chromosome/plasmid partitioning or cellulose biosynthesis protein BcsQ | Cell cycle control, cell division, chromosome partitioning [D] | 0.37 |
| COG1538 | Outer membrane protein TolC | Cell wall/membrane/envelope biogenesis [M] | 0.37 |
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.37 |
| COG2175 | Taurine dioxygenase, alpha-ketoglutarate-dependent | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.37 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.37 |
| COG3158 | K+ uptake protein Kup | Inorganic ion transport and metabolism [P] | 0.37 |
| COG4973 | Site-specific recombinase XerC | Replication, recombination and repair [L] | 0.37 |
| COG4974 | Site-specific recombinase XerD | Replication, recombination and repair [L] | 0.37 |
| COG0025 | NhaP-type Na+/H+ or K+/H+ antiporter | Inorganic ion transport and metabolism [P] | 0.18 |
| COG0057 | Glyceraldehyde-3-phosphate dehydrogenase/erythrose-4-phosphate dehydrogenase | Carbohydrate transport and metabolism [G] | 0.18 |
| COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 0.18 |
| COG0398 | Uncharacterized membrane protein YdjX, related to fungal oxalate transporter, TVP38/TMEM64 family | Function unknown [S] | 0.18 |
| COG0413 | Ketopantoate hydroxymethyltransferase | Coenzyme transport and metabolism [H] | 0.18 |
| COG0443 | Molecular chaperone DnaK (HSP70) | Posttranslational modification, protein turnover, chaperones [O] | 0.18 |
| COG0475 | Kef-type K+ transport system, membrane component KefB | Inorganic ion transport and metabolism [P] | 0.18 |
| COG0586 | Membrane integrity protein DedA, putative transporter, DedA/Tvp38 family | Cell wall/membrane/envelope biogenesis [M] | 0.18 |
| COG0772 | Peptodoglycan polymerase FtsW/RodA/SpoVE | Cell cycle control, cell division, chromosome partitioning [D] | 0.18 |
| COG1238 | Uncharacterized membrane protein YqaA, VTT domain | Function unknown [S] | 0.18 |
| COG1484 | DNA replication protein DnaC | Replication, recombination and repair [L] | 0.18 |
| COG1506 | Dipeptidyl aminopeptidase/acylaminoacyl peptidase | Amino acid transport and metabolism [E] | 0.18 |
| COG1804 | Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases | Lipid transport and metabolism [I] | 0.18 |
| COG1893 | Ketopantoate reductase | Coenzyme transport and metabolism [H] | 0.18 |
| COG1895 | HEPN domain protein, predicted toxin of MNT-HEPN system | Defense mechanisms [V] | 0.18 |
| COG1970 | Large-conductance mechanosensitive channel | Cell wall/membrane/envelope biogenesis [M] | 0.18 |
| COG2079 | 2-methylcitrate dehydratase PrpD | Carbohydrate transport and metabolism [G] | 0.18 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.18 |
| COG2250 | HEPN domain protein, predicted toxin of MNT-HEPN system | Defense mechanisms [V] | 0.18 |
| COG2337 | mRNA-degrading endonuclease MazF, toxin component of the MazEF toxin-antitoxin module | Defense mechanisms [V] | 0.18 |
| COG2423 | Ornithine cyclodeaminase/archaeal alanine dehydrogenase, mu-crystallin family | Amino acid transport and metabolism [E] | 0.18 |
| COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 0.18 |
| COG2886 | Predicted antitoxin, contains HTH domain | General function prediction only [R] | 0.18 |
| COG2929 | Ribonuclease BrnT, toxin component of the BrnT-BrnA toxin-antitoxin system | Defense mechanisms [V] | 0.18 |
| COG3004 | Na+/H+ antiporter NhaA | Energy production and conversion [C] | 0.18 |
| COG3089 | Uncharacterized conserved protein YheU, UPF0270 family | Function unknown [S] | 0.18 |
| COG3132 | Uncharacterized conserved protein YceH, UPF0502 family | Function unknown [S] | 0.18 |
| COG3220 | Uncharacterized conserved protein, UPF0276 family | Function unknown [S] | 0.18 |
| COG3263 | NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domains | Energy production and conversion [C] | 0.18 |
| COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 0.18 |
| COG3436 | Transposase | Mobilome: prophages, transposons [X] | 0.18 |
| COG3458 | Cephalosporin-C deacetylase or related acetyl esterase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.18 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.18 |
| COG3609 | Transcriptional regulator, contains Arc/MetJ-type RHH (ribbon-helix-helix) DNA-binding domain | Transcription [K] | 0.18 |
| COG3657 | Putative component of the toxin-antitoxin plasmid stabilization module | Defense mechanisms [V] | 0.18 |
| COG3677 | Transposase InsA | Mobilome: prophages, transposons [X] | 0.18 |
| COG3805 | Aromatic ring-cleaving dioxygenase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.18 |
| COG4249 | Uncharacterized conserved protein, contains caspase domain | General function prediction only [R] | 0.18 |
| COG4644 | Transposase and inactivated derivatives, TnpA family | Mobilome: prophages, transposons [X] | 0.18 |
| COG4651 | Predicted Kef-type K+ transport protein, K+/H+ antiporter domain | Inorganic ion transport and metabolism [P] | 0.18 |
| COG4679 | Phage-related protein gp49, toxin component of the Tad-Ata toxin-antitoxin system | Defense mechanisms [V] | 0.18 |
| COG4957 | Predicted transcriptional regulator | Transcription [K] | 0.18 |
| COG5464 | Recombination-promoting DNA endonuclease RpnC/YadD | Replication, recombination and repair [L] | 0.18 |
| COG5470 | Uncharacterized conserved protein, DUF1330 family | Function unknown [S] | 0.18 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 78.68 % |
| Unclassified | root | N/A | 21.32 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000363|ICChiseqgaiiFebDRAFT_10930935 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella | 715 | Open in IMG/M |
| 3300000890|JGI11643J12802_11793511 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 576 | Open in IMG/M |
| 3300000955|JGI1027J12803_108641205 | Not Available | 924 | Open in IMG/M |
| 3300001431|F14TB_100288209 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1274 | Open in IMG/M |
| 3300003987|Ga0055471_10031149 | All Organisms → cellular organisms → Bacteria | 1358 | Open in IMG/M |
| 3300003995|Ga0055438_10087833 | All Organisms → cellular organisms → Bacteria | 863 | Open in IMG/M |
| 3300004268|Ga0066398_10058727 | All Organisms → cellular organisms → Bacteria | 800 | Open in IMG/M |
| 3300004268|Ga0066398_10221514 | Not Available | 508 | Open in IMG/M |
| 3300004281|Ga0066397_10005212 | All Organisms → cellular organisms → Bacteria | 1439 | Open in IMG/M |
| 3300004463|Ga0063356_101949423 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 887 | Open in IMG/M |
| 3300004463|Ga0063356_103161744 | Not Available | 709 | Open in IMG/M |
| 3300004463|Ga0063356_103744372 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300004633|Ga0066395_10871608 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 544 | Open in IMG/M |
| 3300005166|Ga0066674_10550156 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300005172|Ga0066683_10333713 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 942 | Open in IMG/M |
| 3300005175|Ga0066673_10071265 | Not Available | 1805 | Open in IMG/M |
| 3300005186|Ga0066676_11093362 | All Organisms → cellular organisms → Bacteria → PVC group → Candidatus Omnitrophica → Candidatus Omnitrophus → Candidatus Omnitrophus fodinae | 526 | Open in IMG/M |
| 3300005289|Ga0065704_10012702 | All Organisms → cellular organisms → Bacteria | 1751 | Open in IMG/M |
| 3300005289|Ga0065704_10028906 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1359 | Open in IMG/M |
| 3300005294|Ga0065705_10069812 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
| 3300005294|Ga0065705_10981938 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300005295|Ga0065707_10099880 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2972 | Open in IMG/M |
| 3300005295|Ga0065707_10447811 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 803 | Open in IMG/M |
| 3300005295|Ga0065707_10972560 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300005332|Ga0066388_101440700 | All Organisms → cellular organisms → Bacteria | 1200 | Open in IMG/M |
| 3300005332|Ga0066388_104451235 | Not Available | 714 | Open in IMG/M |
| 3300005332|Ga0066388_105182691 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 662 | Open in IMG/M |
| 3300005332|Ga0066388_106078034 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300005332|Ga0066388_106424896 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 593 | Open in IMG/M |
| 3300005340|Ga0070689_100556907 | All Organisms → cellular organisms → Bacteria | 988 | Open in IMG/M |
| 3300005347|Ga0070668_100419962 | All Organisms → cellular organisms → Bacteria | 1145 | Open in IMG/M |
| 3300005438|Ga0070701_10749870 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 661 | Open in IMG/M |
| 3300005445|Ga0070708_100592006 | All Organisms → cellular organisms → Bacteria | 1046 | Open in IMG/M |
| 3300005445|Ga0070708_101054939 | All Organisms → cellular organisms → Bacteria → PVC group → Candidatus Omnitrophica → Candidatus Omnitrophus → Candidatus Omnitrophus fodinae | 761 | Open in IMG/M |
| 3300005450|Ga0066682_10381522 | Not Available | 905 | Open in IMG/M |
| 3300005457|Ga0070662_100633537 | Not Available | 901 | Open in IMG/M |
| 3300005459|Ga0068867_101839613 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300005467|Ga0070706_102100915 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300005468|Ga0070707_100742629 | All Organisms → cellular organisms → Bacteria | 945 | Open in IMG/M |
| 3300005468|Ga0070707_101118181 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 754 | Open in IMG/M |
| 3300005471|Ga0070698_100069476 | All Organisms → cellular organisms → Bacteria | 3536 | Open in IMG/M |
| 3300005471|Ga0070698_100151064 | All Organisms → cellular organisms → Bacteria | 2270 | Open in IMG/M |
| 3300005471|Ga0070698_101577835 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300005518|Ga0070699_101723403 | All Organisms → cellular organisms → Bacteria → PVC group → Candidatus Omnitrophica → Candidatus Omnitrophus → Candidatus Omnitrophus fodinae | 574 | Open in IMG/M |
| 3300005536|Ga0070697_101166914 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
| 3300005536|Ga0070697_101737872 | Not Available | 558 | Open in IMG/M |
| 3300005547|Ga0070693_100441367 | All Organisms → cellular organisms → Bacteria | 911 | Open in IMG/M |
| 3300005554|Ga0066661_10739725 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300005558|Ga0066698_11107802 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 501 | Open in IMG/M |
| 3300005559|Ga0066700_10419446 | All Organisms → cellular organisms → Bacteria | 942 | Open in IMG/M |
| 3300005560|Ga0066670_10542032 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
| 3300005561|Ga0066699_11034005 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300005564|Ga0070664_101407318 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
| 3300005564|Ga0070664_101815583 | Not Available | 578 | Open in IMG/M |
| 3300005569|Ga0066705_10838961 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300005574|Ga0066694_10329175 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 726 | Open in IMG/M |
| 3300005576|Ga0066708_10481895 | All Organisms → cellular organisms → Bacteria | 798 | Open in IMG/M |
| 3300005617|Ga0068859_102974520 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300005713|Ga0066905_101343395 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 645 | Open in IMG/M |
| 3300005713|Ga0066905_101588464 | Not Available | 598 | Open in IMG/M |
| 3300005764|Ga0066903_100166959 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3208 | Open in IMG/M |
| 3300005764|Ga0066903_100426182 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 2200 | Open in IMG/M |
| 3300005764|Ga0066903_100664269 | All Organisms → cellular organisms → Bacteria | 1826 | Open in IMG/M |
| 3300005764|Ga0066903_102462731 | All Organisms → cellular organisms → Bacteria | 1007 | Open in IMG/M |
| 3300005764|Ga0066903_103817913 | All Organisms → cellular organisms → Bacteria | 809 | Open in IMG/M |
| 3300005764|Ga0066903_104078462 | Not Available | 782 | Open in IMG/M |
| 3300005764|Ga0066903_104234919 | All Organisms → cellular organisms → Bacteria → PVC group → Candidatus Omnitrophica → Candidatus Omnitrophus → Candidatus Omnitrophus fodinae | 767 | Open in IMG/M |
| 3300005764|Ga0066903_104707217 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 726 | Open in IMG/M |
| 3300005764|Ga0066903_105611204 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 660 | Open in IMG/M |
| 3300005843|Ga0068860_100163288 | All Organisms → cellular organisms → Bacteria | 2149 | Open in IMG/M |
| 3300005981|Ga0081538_10103716 | All Organisms → cellular organisms → Bacteria | 1422 | Open in IMG/M |
| 3300005983|Ga0081540_1020206 | All Organisms → cellular organisms → Bacteria | 4016 | Open in IMG/M |
| 3300006041|Ga0075023_100361120 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300006046|Ga0066652_100275859 | All Organisms → cellular organisms → Bacteria | 1483 | Open in IMG/M |
| 3300006049|Ga0075417_10096487 | Not Available | 1336 | Open in IMG/M |
| 3300006049|Ga0075417_10140328 | All Organisms → cellular organisms → Bacteria | 1119 | Open in IMG/M |
| 3300006049|Ga0075417_10323324 | Not Available | 752 | Open in IMG/M |
| 3300006049|Ga0075417_10592093 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300006049|Ga0075417_10646317 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300006058|Ga0075432_10268390 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 698 | Open in IMG/M |
| 3300006058|Ga0075432_10396608 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 595 | Open in IMG/M |
| 3300006175|Ga0070712_101694165 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 553 | Open in IMG/M |
| 3300006420|Ga0082248_10061733 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 771 | Open in IMG/M |
| 3300006794|Ga0066658_10559945 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300006794|Ga0066658_10712427 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300006796|Ga0066665_10441210 | All Organisms → cellular organisms → Bacteria | 1075 | Open in IMG/M |
| 3300006796|Ga0066665_10970689 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
| 3300006797|Ga0066659_10761693 | All Organisms → cellular organisms → Bacteria | 797 | Open in IMG/M |
| 3300006800|Ga0066660_11163888 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300006800|Ga0066660_11549542 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300006844|Ga0075428_100015512 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 8446 | Open in IMG/M |
| 3300006844|Ga0075428_100051703 | All Organisms → cellular organisms → Bacteria | 4506 | Open in IMG/M |
| 3300006844|Ga0075428_100702242 | All Organisms → cellular organisms → Bacteria | 1077 | Open in IMG/M |
| 3300006844|Ga0075428_101126001 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 829 | Open in IMG/M |
| 3300006844|Ga0075428_101268249 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
| 3300006844|Ga0075428_101338582 | All Organisms → cellular organisms → Bacteria | 752 | Open in IMG/M |
| 3300006845|Ga0075421_101483779 | All Organisms → cellular organisms → Bacteria → PVC group → Candidatus Omnitrophica → Candidatus Omnitrophus → Candidatus Omnitrophus fodinae | 742 | Open in IMG/M |
| 3300006845|Ga0075421_102630935 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 521 | Open in IMG/M |
| 3300006845|Ga0075421_102811079 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 501 | Open in IMG/M |
| 3300006846|Ga0075430_100035327 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 4240 | Open in IMG/M |
| 3300006846|Ga0075430_100762298 | All Organisms → cellular organisms → Bacteria | 797 | Open in IMG/M |
| 3300006846|Ga0075430_101419255 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300006847|Ga0075431_100456774 | All Organisms → cellular organisms → Bacteria | 1272 | Open in IMG/M |
| 3300006847|Ga0075431_100636972 | All Organisms → cellular organisms → Bacteria | 1047 | Open in IMG/M |
| 3300006847|Ga0075431_100885389 | Not Available | 863 | Open in IMG/M |
| 3300006847|Ga0075431_101135131 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
| 3300006847|Ga0075431_101225871 | Not Available | 712 | Open in IMG/M |
| 3300006847|Ga0075431_101337226 | Not Available | 677 | Open in IMG/M |
| 3300006852|Ga0075433_10411172 | All Organisms → cellular organisms → Bacteria | 1193 | Open in IMG/M |
| 3300006853|Ga0075420_100163258 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1953 | Open in IMG/M |
| 3300006853|Ga0075420_101942633 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella | 503 | Open in IMG/M |
| 3300006854|Ga0075425_100852850 | Not Available | 1042 | Open in IMG/M |
| 3300006871|Ga0075434_100848127 | Not Available | 929 | Open in IMG/M |
| 3300006871|Ga0075434_101250234 | Not Available | 754 | Open in IMG/M |
| 3300006871|Ga0075434_102657223 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300006880|Ga0075429_100334810 | All Organisms → cellular organisms → Bacteria | 1325 | Open in IMG/M |
| 3300006880|Ga0075429_100469105 | All Organisms → cellular organisms → Bacteria | 1103 | Open in IMG/M |
| 3300006880|Ga0075429_101058021 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
| 3300006880|Ga0075429_101614226 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300006904|Ga0075424_100759613 | Not Available | 1035 | Open in IMG/M |
| 3300006914|Ga0075436_101215940 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella | 569 | Open in IMG/M |
| 3300006969|Ga0075419_10626188 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 758 | Open in IMG/M |
| 3300006969|Ga0075419_10764270 | Not Available | 689 | Open in IMG/M |
| 3300007076|Ga0075435_101094192 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 697 | Open in IMG/M |
| 3300007255|Ga0099791_10123830 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 1199 | Open in IMG/M |
| 3300007258|Ga0099793_10090979 | Not Available | 1402 | Open in IMG/M |
| 3300007258|Ga0099793_10103884 | All Organisms → cellular organisms → Bacteria | 1317 | Open in IMG/M |
| 3300007258|Ga0099793_10673790 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 521 | Open in IMG/M |
| 3300007265|Ga0099794_10483928 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 651 | Open in IMG/M |
| 3300007265|Ga0099794_10513264 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300009012|Ga0066710_103227630 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 625 | Open in IMG/M |
| 3300009012|Ga0066710_104039031 | Not Available | 549 | Open in IMG/M |
| 3300009012|Ga0066710_104204003 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300009038|Ga0099829_10015715 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. WSC-7 | 5057 | Open in IMG/M |
| 3300009038|Ga0099829_10222284 | All Organisms → cellular organisms → Bacteria | 1534 | Open in IMG/M |
| 3300009038|Ga0099829_10722872 | All Organisms → cellular organisms → Bacteria | 827 | Open in IMG/M |
| 3300009038|Ga0099829_11412074 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 575 | Open in IMG/M |
| 3300009038|Ga0099829_11541091 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300009088|Ga0099830_10895627 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 734 | Open in IMG/M |
| 3300009089|Ga0099828_10340742 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1350 | Open in IMG/M |
| 3300009089|Ga0099828_10342061 | All Organisms → cellular organisms → Bacteria | 1348 | Open in IMG/M |
| 3300009089|Ga0099828_10366822 | Not Available | 1298 | Open in IMG/M |
| 3300009089|Ga0099828_10642879 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 954 | Open in IMG/M |
| 3300009089|Ga0099828_10764147 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 866 | Open in IMG/M |
| 3300009089|Ga0099828_10927727 | All Organisms → cellular organisms → Bacteria | 777 | Open in IMG/M |
| 3300009089|Ga0099828_11677549 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 559 | Open in IMG/M |
| 3300009089|Ga0099828_11800219 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → unclassified Ktedonobacteraceae → Ktedonobacteraceae bacterium | 538 | Open in IMG/M |
| 3300009090|Ga0099827_10082096 | All Organisms → cellular organisms → Bacteria | 2519 | Open in IMG/M |
| 3300009090|Ga0099827_10174922 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 1771 | Open in IMG/M |
| 3300009090|Ga0099827_10313488 | All Organisms → cellular organisms → Bacteria | 1329 | Open in IMG/M |
| 3300009090|Ga0099827_10544607 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 999 | Open in IMG/M |
| 3300009090|Ga0099827_10707741 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 870 | Open in IMG/M |
| 3300009090|Ga0099827_11028773 | Not Available | 715 | Open in IMG/M |
| 3300009090|Ga0099827_11103391 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella palauensis | 689 | Open in IMG/M |
| 3300009090|Ga0099827_11727415 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 545 | Open in IMG/M |
| 3300009090|Ga0099827_11900850 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 519 | Open in IMG/M |
| 3300009090|Ga0099827_11945718 | Not Available | 512 | Open in IMG/M |
| 3300009094|Ga0111539_10123036 | All Organisms → cellular organisms → Bacteria | 3041 | Open in IMG/M |
| 3300009094|Ga0111539_10199255 | All Organisms → cellular organisms → Bacteria | 2335 | Open in IMG/M |
| 3300009094|Ga0111539_10409611 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1579 | Open in IMG/M |
| 3300009094|Ga0111539_10657071 | All Organisms → cellular organisms → Bacteria | 1221 | Open in IMG/M |
| 3300009094|Ga0111539_12930511 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300009100|Ga0075418_10130562 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2672 | Open in IMG/M |
| 3300009100|Ga0075418_11356750 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 771 | Open in IMG/M |
| 3300009100|Ga0075418_11409104 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 756 | Open in IMG/M |
| 3300009100|Ga0075418_12554143 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 558 | Open in IMG/M |
| 3300009100|Ga0075418_12919609 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 522 | Open in IMG/M |
| 3300009137|Ga0066709_100637404 | Not Available | 1523 | Open in IMG/M |
| 3300009137|Ga0066709_103286317 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 588 | Open in IMG/M |
| 3300009147|Ga0114129_10662980 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella gemina | 1345 | Open in IMG/M |
| 3300009147|Ga0114129_11161456 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium | 963 | Open in IMG/M |
| 3300009147|Ga0114129_11199994 | Not Available | 945 | Open in IMG/M |
| 3300009147|Ga0114129_11392118 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 866 | Open in IMG/M |
| 3300009147|Ga0114129_13001549 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 555 | Open in IMG/M |
| 3300009156|Ga0111538_10421700 | All Organisms → cellular organisms → Bacteria | 1690 | Open in IMG/M |
| 3300009156|Ga0111538_10459896 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1613 | Open in IMG/M |
| 3300009156|Ga0111538_11986015 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 731 | Open in IMG/M |
| 3300009157|Ga0105092_10205152 | All Organisms → cellular organisms → Bacteria | 1102 | Open in IMG/M |
| 3300009162|Ga0075423_10459091 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella | 1339 | Open in IMG/M |
| 3300009162|Ga0075423_10894095 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 941 | Open in IMG/M |
| 3300009162|Ga0075423_12265576 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla | 591 | Open in IMG/M |
| 3300009162|Ga0075423_12281768 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 589 | Open in IMG/M |
| 3300009162|Ga0075423_13056386 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 513 | Open in IMG/M |
| 3300009176|Ga0105242_10115346 | All Organisms → cellular organisms → Bacteria | 2296 | Open in IMG/M |
| 3300009176|Ga0105242_10916671 | Not Available | 878 | Open in IMG/M |
| 3300009553|Ga0105249_12270010 | Not Available | 615 | Open in IMG/M |
| 3300009553|Ga0105249_12941724 | Not Available | 547 | Open in IMG/M |
| 3300009610|Ga0105340_1505369 | Not Available | 540 | Open in IMG/M |
| 3300009792|Ga0126374_10492930 | All Organisms → cellular organisms → Bacteria | 881 | Open in IMG/M |
| 3300009792|Ga0126374_10636479 | Not Available | 793 | Open in IMG/M |
| 3300009792|Ga0126374_11308744 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 586 | Open in IMG/M |
| 3300009792|Ga0126374_11641460 | Not Available | 532 | Open in IMG/M |
| 3300009797|Ga0105080_1023089 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 660 | Open in IMG/M |
| 3300009799|Ga0105075_1015135 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales | 755 | Open in IMG/M |
| 3300009811|Ga0105084_1080697 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 599 | Open in IMG/M |
| 3300009812|Ga0105067_1049031 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella gemina | 666 | Open in IMG/M |
| 3300009813|Ga0105057_1032630 | Not Available | 805 | Open in IMG/M |
| 3300009823|Ga0105078_1036701 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 616 | Open in IMG/M |
| 3300009823|Ga0105078_1051384 | Not Available | 549 | Open in IMG/M |
| 3300009837|Ga0105058_1129620 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 604 | Open in IMG/M |
| 3300010038|Ga0126315_10893621 | Not Available | 590 | Open in IMG/M |
| 3300010043|Ga0126380_10219864 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1289 | Open in IMG/M |
| 3300010043|Ga0126380_10975430 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Gemmatales → Gemmataceae → Fimbriiglobus → Fimbriiglobus ruber | 711 | Open in IMG/M |
| 3300010043|Ga0126380_11247017 | Not Available | 644 | Open in IMG/M |
| 3300010043|Ga0126380_11715205 | Not Available | 565 | Open in IMG/M |
| 3300010046|Ga0126384_10310455 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 1300 | Open in IMG/M |
| 3300010046|Ga0126384_11046065 | Not Available | 746 | Open in IMG/M |
| 3300010046|Ga0126384_11342624 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 665 | Open in IMG/M |
| 3300010046|Ga0126384_11380936 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
| 3300010046|Ga0126384_11562896 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 620 | Open in IMG/M |
| 3300010046|Ga0126384_12095639 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 543 | Open in IMG/M |
| 3300010046|Ga0126384_12099846 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 542 | Open in IMG/M |
| 3300010046|Ga0126384_12371572 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 513 | Open in IMG/M |
| 3300010047|Ga0126382_10200933 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Chloroflexineae → Oscillochloridaceae → Oscillochloris → Candidatus Oscillochloris fontis | 1418 | Open in IMG/M |
| 3300010047|Ga0126382_10634643 | Not Available | 885 | Open in IMG/M |
| 3300010047|Ga0126382_10646304 | All Organisms → cellular organisms → Bacteria | 878 | Open in IMG/M |
| 3300010112|Ga0127458_1032974 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 557 | Open in IMG/M |
| 3300010322|Ga0134084_10476435 | Not Available | 502 | Open in IMG/M |
| 3300010358|Ga0126370_10470537 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1053 | Open in IMG/M |
| 3300010358|Ga0126370_10836892 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 824 | Open in IMG/M |
| 3300010358|Ga0126370_10966656 | All Organisms → cellular organisms → Bacteria | 774 | Open in IMG/M |
| 3300010358|Ga0126370_10991835 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
| 3300010358|Ga0126370_11307869 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 680 | Open in IMG/M |
| 3300010358|Ga0126370_12503011 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 514 | Open in IMG/M |
| 3300010359|Ga0126376_10047662 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales | 3014 | Open in IMG/M |
| 3300010359|Ga0126376_10197559 | Not Available | 1663 | Open in IMG/M |
| 3300010359|Ga0126376_10542768 | Not Available | 1086 | Open in IMG/M |
| 3300010359|Ga0126376_10812457 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 914 | Open in IMG/M |
| 3300010359|Ga0126376_10896880 | All Organisms → cellular organisms → Bacteria | 876 | Open in IMG/M |
| 3300010360|Ga0126372_10899159 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_40CM_4_52_4 | 888 | Open in IMG/M |
| 3300010360|Ga0126372_11895878 | Not Available | 641 | Open in IMG/M |
| 3300010360|Ga0126372_13289976 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 502 | Open in IMG/M |
| 3300010361|Ga0126378_12169466 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300010361|Ga0126378_12560274 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300010362|Ga0126377_10451060 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1308 | Open in IMG/M |
| 3300010362|Ga0126377_10939428 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 929 | Open in IMG/M |
| 3300010362|Ga0126377_11304918 | Not Available | 798 | Open in IMG/M |
| 3300010362|Ga0126377_11600943 | All Organisms → cellular organisms → Bacteria | 726 | Open in IMG/M |
| 3300010366|Ga0126379_10037537 | All Organisms → cellular organisms → Bacteria | 3864 | Open in IMG/M |
| 3300010366|Ga0126379_10482089 | All Organisms → cellular organisms → Bacteria | 1308 | Open in IMG/M |
| 3300010366|Ga0126379_10985725 | All Organisms → cellular organisms → Bacteria | 947 | Open in IMG/M |
| 3300010366|Ga0126379_12539221 | Not Available | 611 | Open in IMG/M |
| 3300010366|Ga0126379_12555423 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 609 | Open in IMG/M |
| 3300010398|Ga0126383_10024695 | All Organisms → cellular organisms → Bacteria | 4678 | Open in IMG/M |
| 3300010398|Ga0126383_10231564 | All Organisms → cellular organisms → Bacteria | 1798 | Open in IMG/M |
| 3300010398|Ga0126383_10363612 | All Organisms → cellular organisms → Bacteria | 1472 | Open in IMG/M |
| 3300010398|Ga0126383_10978122 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 934 | Open in IMG/M |
| 3300010398|Ga0126383_11638503 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 733 | Open in IMG/M |
| 3300010398|Ga0126383_12256291 | Not Available | 630 | Open in IMG/M |
| 3300010398|Ga0126383_12769561 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium AA13 | 572 | Open in IMG/M |
| 3300010398|Ga0126383_12770849 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 572 | Open in IMG/M |
| 3300010403|Ga0134123_13011702 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 540 | Open in IMG/M |
| 3300011269|Ga0137392_11317669 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 581 | Open in IMG/M |
| 3300011270|Ga0137391_10666737 | All Organisms → cellular organisms → Bacteria | 867 | Open in IMG/M |
| 3300011270|Ga0137391_10686931 | Not Available | 851 | Open in IMG/M |
| 3300011271|Ga0137393_10504117 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella | 1038 | Open in IMG/M |
| 3300011271|Ga0137393_10512272 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1029 | Open in IMG/M |
| 3300012096|Ga0137389_10351509 | Not Available | 1254 | Open in IMG/M |
| 3300012096|Ga0137389_10476719 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1070 | Open in IMG/M |
| 3300012189|Ga0137388_11222196 | Not Available | 689 | Open in IMG/M |
| 3300012198|Ga0137364_10741393 | All Organisms → cellular organisms → Bacteria | 742 | Open in IMG/M |
| 3300012199|Ga0137383_10216538 | Not Available | 1403 | Open in IMG/M |
| 3300012201|Ga0137365_10196454 | All Organisms → cellular organisms → Bacteria | 1509 | Open in IMG/M |
| 3300012201|Ga0137365_10433040 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Spirosoma → Spirosoma pollinicola | 969 | Open in IMG/M |
| 3300012202|Ga0137363_10112591 | All Organisms → cellular organisms → Bacteria | 2087 | Open in IMG/M |
| 3300012203|Ga0137399_10381271 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales | 1174 | Open in IMG/M |
| 3300012203|Ga0137399_10504902 | All Organisms → cellular organisms → Bacteria | 1014 | Open in IMG/M |
| 3300012204|Ga0137374_10554255 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 883 | Open in IMG/M |
| 3300012205|Ga0137362_10221052 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 1633 | Open in IMG/M |
| 3300012205|Ga0137362_10419953 | All Organisms → cellular organisms → Bacteria | 1158 | Open in IMG/M |
| 3300012205|Ga0137362_10561939 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 985 | Open in IMG/M |
| 3300012205|Ga0137362_11287880 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 616 | Open in IMG/M |
| 3300012205|Ga0137362_11697800 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 518 | Open in IMG/M |
| 3300012206|Ga0137380_11261642 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300012207|Ga0137381_10994118 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 724 | Open in IMG/M |
| 3300012207|Ga0137381_11461274 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 575 | Open in IMG/M |
| 3300012210|Ga0137378_10099318 | All Organisms → cellular organisms → Bacteria | 2670 | Open in IMG/M |
| 3300012211|Ga0137377_10178451 | All Organisms → cellular organisms → Bacteria | 2039 | Open in IMG/M |
| 3300012211|Ga0137377_10687778 | Not Available | 958 | Open in IMG/M |
| 3300012211|Ga0137377_11258410 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
| 3300012212|Ga0150985_123204093 | All Organisms → cellular organisms → Bacteria | 1030 | Open in IMG/M |
| 3300012349|Ga0137387_10520659 | Not Available | 863 | Open in IMG/M |
| 3300012349|Ga0137387_10612338 | Not Available | 789 | Open in IMG/M |
| 3300012349|Ga0137387_11061162 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 579 | Open in IMG/M |
| 3300012349|Ga0137387_11094995 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 568 | Open in IMG/M |
| 3300012350|Ga0137372_10256699 | All Organisms → cellular organisms → Bacteria | 1373 | Open in IMG/M |
| 3300012350|Ga0137372_10669416 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 754 | Open in IMG/M |
| 3300012351|Ga0137386_10715220 | Not Available | 719 | Open in IMG/M |
| 3300012354|Ga0137366_10581022 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales | 805 | Open in IMG/M |
| 3300012354|Ga0137366_11007680 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 579 | Open in IMG/M |
| 3300012356|Ga0137371_10256968 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1364 | Open in IMG/M |
| 3300012356|Ga0137371_10286992 | All Organisms → cellular organisms → Bacteria | 1283 | Open in IMG/M |
| 3300012357|Ga0137384_10069458 | All Organisms → cellular organisms → Bacteria | 2924 | Open in IMG/M |
| 3300012357|Ga0137384_11092646 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300012357|Ga0137384_11343253 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 562 | Open in IMG/M |
| 3300012358|Ga0137368_10506328 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
| 3300012359|Ga0137385_10776209 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 797 | Open in IMG/M |
| 3300012359|Ga0137385_10829381 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 767 | Open in IMG/M |
| 3300012360|Ga0137375_10494197 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1043 | Open in IMG/M |
| 3300012360|Ga0137375_11333790 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 539 | Open in IMG/M |
| 3300012361|Ga0137360_10093795 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella | 2280 | Open in IMG/M |
| 3300012361|Ga0137360_11620550 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 552 | Open in IMG/M |
| 3300012362|Ga0137361_10421330 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1226 | Open in IMG/M |
| 3300012362|Ga0137361_10518166 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_40CM_4_52_4 | 1095 | Open in IMG/M |
| 3300012362|Ga0137361_10738533 | All Organisms → cellular organisms → Bacteria | 898 | Open in IMG/M |
| 3300012362|Ga0137361_10796302 | All Organisms → cellular organisms → Bacteria | 860 | Open in IMG/M |
| 3300012362|Ga0137361_10893318 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 806 | Open in IMG/M |
| 3300012362|Ga0137361_10997541 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 757 | Open in IMG/M |
| 3300012362|Ga0137361_11403956 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 621 | Open in IMG/M |
| 3300012362|Ga0137361_11737729 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 543 | Open in IMG/M |
| 3300012363|Ga0137390_10062508 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3632 | Open in IMG/M |
| 3300012363|Ga0137390_10241898 | All Organisms → cellular organisms → Bacteria | 1790 | Open in IMG/M |
| 3300012363|Ga0137390_10368964 | All Organisms → cellular organisms → Bacteria | 1416 | Open in IMG/M |
| 3300012363|Ga0137390_10412464 | Not Available | 1328 | Open in IMG/M |
| 3300012405|Ga0134041_1258194 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
| 3300012513|Ga0157326_1084386 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300012685|Ga0137397_11061315 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium | 592 | Open in IMG/M |
| 3300012685|Ga0137397_11231442 | Not Available | 537 | Open in IMG/M |
| 3300012917|Ga0137395_11027155 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 589 | Open in IMG/M |
| 3300012918|Ga0137396_10013982 | All Organisms → cellular organisms → Bacteria | 5006 | Open in IMG/M |
| 3300012918|Ga0137396_10887316 | Not Available | 654 | Open in IMG/M |
| 3300012922|Ga0137394_10452458 | All Organisms → cellular organisms → Bacteria | 1093 | Open in IMG/M |
| 3300012922|Ga0137394_10961790 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
| 3300012925|Ga0137419_10334635 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1167 | Open in IMG/M |
| 3300012927|Ga0137416_10784870 | Not Available | 841 | Open in IMG/M |
| 3300012929|Ga0137404_10109720 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2239 | Open in IMG/M |
| 3300012929|Ga0137404_10127908 | Not Available | 2086 | Open in IMG/M |
| 3300012930|Ga0137407_11743592 | Not Available | 593 | Open in IMG/M |
| 3300012944|Ga0137410_10446188 | All Organisms → cellular organisms → Bacteria | 1050 | Open in IMG/M |
| 3300012944|Ga0137410_10983503 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 718 | Open in IMG/M |
| 3300012944|Ga0137410_11229110 | Not Available | 646 | Open in IMG/M |
| 3300012944|Ga0137410_11638142 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300012944|Ga0137410_11766643 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 545 | Open in IMG/M |
| 3300012948|Ga0126375_10121589 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1593 | Open in IMG/M |
| 3300012948|Ga0126375_10132096 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Chroococcales → Microcystaceae → Microcystis | 1543 | Open in IMG/M |
| 3300012948|Ga0126375_10432948 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 961 | Open in IMG/M |
| 3300012948|Ga0126375_10562224 | All Organisms → cellular organisms → Bacteria | 863 | Open in IMG/M |
| 3300012948|Ga0126375_10763985 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Dictyobacteraceae → Dictyobacter → Dictyobacter kobayashii | 761 | Open in IMG/M |
| 3300012948|Ga0126375_11020230 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 675 | Open in IMG/M |
| 3300012948|Ga0126375_11053674 | Not Available | 666 | Open in IMG/M |
| 3300012948|Ga0126375_11293560 | Not Available | 612 | Open in IMG/M |
| 3300012948|Ga0126375_11570300 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 565 | Open in IMG/M |
| 3300012948|Ga0126375_11745953 | Not Available | 541 | Open in IMG/M |
| 3300012948|Ga0126375_11793519 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 535 | Open in IMG/M |
| 3300012960|Ga0164301_11680543 | Not Available | 530 | Open in IMG/M |
| 3300012971|Ga0126369_12959076 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 556 | Open in IMG/M |
| 3300012972|Ga0134077_10024670 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella gemina | 2095 | Open in IMG/M |
| 3300012977|Ga0134087_10085697 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium 70-9 | 1298 | Open in IMG/M |
| 3300012977|Ga0134087_10679156 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 543 | Open in IMG/M |
| 3300013306|Ga0163162_12689674 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 573 | Open in IMG/M |
| 3300013308|Ga0157375_10898170 | Not Available | 1030 | Open in IMG/M |
| 3300015053|Ga0137405_1381805 | All Organisms → cellular organisms → Bacteria | 940 | Open in IMG/M |
| 3300015241|Ga0137418_10563229 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 900 | Open in IMG/M |
| 3300015241|Ga0137418_10994892 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 607 | Open in IMG/M |
| 3300015241|Ga0137418_11308834 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 505 | Open in IMG/M |
| 3300015245|Ga0137409_11143529 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 618 | Open in IMG/M |
| 3300015264|Ga0137403_10236165 | All Organisms → cellular organisms → Bacteria | 1745 | Open in IMG/M |
| 3300015264|Ga0137403_10367444 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Modestobacter → Modestobacter marinus | 1323 | Open in IMG/M |
| 3300015371|Ga0132258_11864113 | All Organisms → cellular organisms → Bacteria | 1514 | Open in IMG/M |
| 3300015372|Ga0132256_100360215 | All Organisms → cellular organisms → Bacteria | 1550 | Open in IMG/M |
| 3300015374|Ga0132255_105255351 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300016270|Ga0182036_10521171 | All Organisms → cellular organisms → Bacteria | 944 | Open in IMG/M |
| 3300016270|Ga0182036_10797780 | Not Available | 769 | Open in IMG/M |
| 3300016294|Ga0182041_10904526 | Not Available | 794 | Open in IMG/M |
| 3300016294|Ga0182041_11500254 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300016319|Ga0182033_10545304 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1002 | Open in IMG/M |
| 3300016341|Ga0182035_11773830 | Not Available | 558 | Open in IMG/M |
| 3300016357|Ga0182032_11655000 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 557 | Open in IMG/M |
| 3300016357|Ga0182032_11885586 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Archangiaceae → Cystobacter | 523 | Open in IMG/M |
| 3300016371|Ga0182034_10619540 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 915 | Open in IMG/M |
| 3300016387|Ga0182040_10481489 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella gemina | 989 | Open in IMG/M |
| 3300016387|Ga0182040_10900258 | Not Available | 734 | Open in IMG/M |
| 3300016387|Ga0182040_11785028 | Not Available | 526 | Open in IMG/M |
| 3300016404|Ga0182037_10554691 | Not Available | 970 | Open in IMG/M |
| 3300016404|Ga0182037_11496674 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 598 | Open in IMG/M |
| 3300016422|Ga0182039_10921948 | All Organisms → cellular organisms → Bacteria | 781 | Open in IMG/M |
| 3300016422|Ga0182039_12220851 | Not Available | 506 | Open in IMG/M |
| 3300016445|Ga0182038_11443057 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300017656|Ga0134112_10165836 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 854 | Open in IMG/M |
| 3300017656|Ga0134112_10461249 | Not Available | 533 | Open in IMG/M |
| 3300017792|Ga0163161_10784598 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
| 3300017997|Ga0184610_1108472 | Not Available | 886 | Open in IMG/M |
| 3300017997|Ga0184610_1128474 | All Organisms → cellular organisms → Bacteria | 821 | Open in IMG/M |
| 3300017997|Ga0184610_1230348 | Not Available | 618 | Open in IMG/M |
| 3300018054|Ga0184621_10095676 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1046 | Open in IMG/M |
| 3300018056|Ga0184623_10144844 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1098 | Open in IMG/M |
| 3300018061|Ga0184619_10516566 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 526 | Open in IMG/M |
| 3300018063|Ga0184637_10044655 | All Organisms → cellular organisms → Bacteria | 2696 | Open in IMG/M |
| 3300018071|Ga0184618_10184101 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 868 | Open in IMG/M |
| 3300018076|Ga0184609_10364309 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 674 | Open in IMG/M |
| 3300018076|Ga0184609_10377246 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 661 | Open in IMG/M |
| 3300018079|Ga0184627_10672039 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 510 | Open in IMG/M |
| 3300018082|Ga0184639_10160583 | All Organisms → cellular organisms → Bacteria | 1194 | Open in IMG/M |
| 3300018422|Ga0190265_11693488 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 742 | Open in IMG/M |
| 3300018433|Ga0066667_11288422 | Not Available | 638 | Open in IMG/M |
| 3300018466|Ga0190268_10558902 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 797 | Open in IMG/M |
| 3300018466|Ga0190268_10728194 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
| 3300018466|Ga0190268_11342929 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 607 | Open in IMG/M |
| 3300018466|Ga0190268_11556529 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 579 | Open in IMG/M |
| 3300018468|Ga0066662_11300336 | Not Available | 745 | Open in IMG/M |
| 3300018482|Ga0066669_11284910 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
| 3300019233|Ga0184645_1323250 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella | 2182 | Open in IMG/M |
| 3300019269|Ga0184644_1679450 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella | 778 | Open in IMG/M |
| 3300019789|Ga0137408_1051742 | All Organisms → cellular organisms → Bacteria | 2032 | Open in IMG/M |
| 3300019789|Ga0137408_1051743 | All Organisms → cellular organisms → Bacteria | 2032 | Open in IMG/M |
| 3300020003|Ga0193739_1095736 | Not Available | 750 | Open in IMG/M |
| 3300021073|Ga0210378_10274391 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 636 | Open in IMG/M |
| 3300021086|Ga0179596_10159275 | Not Available | 1079 | Open in IMG/M |
| 3300021086|Ga0179596_10299572 | Not Available | 802 | Open in IMG/M |
| 3300022413|Ga0224508_10806506 | Not Available | 571 | Open in IMG/M |
| 3300022694|Ga0222623_10097753 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 1141 | Open in IMG/M |
| 3300025910|Ga0207684_10548270 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 989 | Open in IMG/M |
| 3300025910|Ga0207684_10745851 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 830 | Open in IMG/M |
| 3300025922|Ga0207646_10402879 | Not Available | 1235 | Open in IMG/M |
| 3300025935|Ga0207709_11710129 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300025936|Ga0207670_11594762 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 555 | Open in IMG/M |
| 3300025938|Ga0207704_11272159 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300025939|Ga0207665_11078756 | Not Available | 640 | Open in IMG/M |
| 3300025939|Ga0207665_11289905 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Halobacteria → unclassified Halobacteria → Halobacteria archaeon | 582 | Open in IMG/M |
| 3300025961|Ga0207712_10588406 | Not Available | 961 | Open in IMG/M |
| 3300026075|Ga0207708_10408909 | All Organisms → cellular organisms → Bacteria | 1123 | Open in IMG/M |
| 3300026118|Ga0207675_100128245 | Not Available | 2404 | Open in IMG/M |
| 3300026118|Ga0207675_101654747 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 660 | Open in IMG/M |
| 3300026118|Ga0207675_101950548 | Not Available | 605 | Open in IMG/M |
| 3300026118|Ga0207675_102745278 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 500 | Open in IMG/M |
| 3300026298|Ga0209236_1065640 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1742 | Open in IMG/M |
| 3300026301|Ga0209238_1148264 | Not Available | 721 | Open in IMG/M |
| 3300026310|Ga0209239_1266071 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 591 | Open in IMG/M |
| 3300026332|Ga0209803_1314594 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300026523|Ga0209808_1043152 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2101 | Open in IMG/M |
| 3300026529|Ga0209806_1075006 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1510 | Open in IMG/M |
| 3300026552|Ga0209577_10609822 | Not Available | 650 | Open in IMG/M |
| 3300026552|Ga0209577_10649523 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 610 | Open in IMG/M |
| 3300027027|Ga0209844_1011330 | Not Available | 666 | Open in IMG/M |
| 3300027056|Ga0209879_1005573 | Not Available | 1932 | Open in IMG/M |
| 3300027379|Ga0209842_1062710 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
| 3300027490|Ga0209899_1004888 | All Organisms → cellular organisms → Bacteria | 3081 | Open in IMG/M |
| 3300027511|Ga0209843_1087795 | Not Available | 528 | Open in IMG/M |
| 3300027633|Ga0208988_1018896 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → Thiotrichaceae → Thiothrix → Thiothrix nivea | 1762 | Open in IMG/M |
| 3300027636|Ga0214469_1058800 | All Organisms → cellular organisms → Bacteria | 1181 | Open in IMG/M |
| 3300027654|Ga0209799_1019770 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1475 | Open in IMG/M |
| 3300027655|Ga0209388_1226271 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 513 | Open in IMG/M |
| 3300027846|Ga0209180_10103825 | All Organisms → cellular organisms → Bacteria | 1621 | Open in IMG/M |
| 3300027846|Ga0209180_10118807 | All Organisms → cellular organisms → Bacteria | 1516 | Open in IMG/M |
| 3300027846|Ga0209180_10141675 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1383 | Open in IMG/M |
| 3300027846|Ga0209180_10199120 | All Organisms → cellular organisms → Bacteria | 1155 | Open in IMG/M |
| 3300027846|Ga0209180_10378337 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfamplus → Desulfamplus magnetovallimortis | 805 | Open in IMG/M |
| 3300027874|Ga0209465_10064358 | Not Available | 1770 | Open in IMG/M |
| 3300027874|Ga0209465_10194429 | All Organisms → Viruses → Predicted Viral | 1012 | Open in IMG/M |
| 3300027874|Ga0209465_10349429 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
| 3300027874|Ga0209465_10524721 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 590 | Open in IMG/M |
| 3300027875|Ga0209283_10290212 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1080 | Open in IMG/M |
| 3300027875|Ga0209283_10359754 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 954 | Open in IMG/M |
| 3300027875|Ga0209283_10610783 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
| 3300027875|Ga0209283_10813753 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 573 | Open in IMG/M |
| 3300027882|Ga0209590_10176296 | All Organisms → cellular organisms → Bacteria | 1340 | Open in IMG/M |
| 3300027882|Ga0209590_10282068 | All Organisms → cellular organisms → Bacteria | 1064 | Open in IMG/M |
| 3300027882|Ga0209590_10723730 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 636 | Open in IMG/M |
| 3300027903|Ga0209488_10099693 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2176 | Open in IMG/M |
| 3300027907|Ga0207428_10192474 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella | 1537 | Open in IMG/M |
| 3300027907|Ga0207428_10202703 | All Organisms → cellular organisms → Bacteria | 1492 | Open in IMG/M |
| 3300027909|Ga0209382_10171328 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2503 | Open in IMG/M |
| 3300027909|Ga0209382_11496724 | Not Available | 673 | Open in IMG/M |
| 3300027909|Ga0209382_11708963 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300027961|Ga0209853_1106289 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 708 | Open in IMG/M |
| 3300028381|Ga0268264_10258953 | All Organisms → cellular organisms → Bacteria | 1620 | Open in IMG/M |
| 3300028536|Ga0137415_10460096 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → Nitrospinia → Nitrospinales → Nitrospinaceae → Nitrospina | 1078 | Open in IMG/M |
| 3300028536|Ga0137415_10540735 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Caballeronia → Caballeronia arationis | 974 | Open in IMG/M |
| 3300028587|Ga0247828_10674953 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → Thiotrichaceae → Beggiatoa → unclassified Beggiatoa → Beggiatoa sp. PS | 640 | Open in IMG/M |
| 3300028792|Ga0307504_10431678 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 524 | Open in IMG/M |
| 3300028819|Ga0307296_10616715 | Not Available | 594 | Open in IMG/M |
| 3300028828|Ga0307312_10251472 | All Organisms → cellular organisms → Bacteria | 1144 | Open in IMG/M |
| 3300030619|Ga0268386_10674727 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 678 | Open in IMG/M |
| 3300030620|Ga0302046_11428279 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300030903|Ga0308206_1033252 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 949 | Open in IMG/M |
| 3300030904|Ga0308198_1083798 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 539 | Open in IMG/M |
| 3300031092|Ga0308204_10012561 | All Organisms → cellular organisms → Bacteria | 1587 | Open in IMG/M |
| 3300031093|Ga0308197_10027045 | All Organisms → cellular organisms → Bacteria | 1314 | Open in IMG/M |
| 3300031093|Ga0308197_10413464 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 531 | Open in IMG/M |
| 3300031093|Ga0308197_10461868 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 512 | Open in IMG/M |
| 3300031226|Ga0307497_10628962 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 546 | Open in IMG/M |
| 3300031228|Ga0299914_10433733 | Not Available | 1143 | Open in IMG/M |
| 3300031228|Ga0299914_11255317 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 590 | Open in IMG/M |
| 3300031229|Ga0299913_11684582 | Not Available | 584 | Open in IMG/M |
| 3300031547|Ga0310887_10392103 | Not Available | 815 | Open in IMG/M |
| 3300031562|Ga0310886_10348814 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 860 | Open in IMG/M |
| 3300031562|Ga0310886_10492215 | Not Available | 738 | Open in IMG/M |
| 3300031719|Ga0306917_10483431 | Not Available | 972 | Open in IMG/M |
| 3300031719|Ga0306917_10644831 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 833 | Open in IMG/M |
| 3300031720|Ga0307469_11721487 | Not Available | 605 | Open in IMG/M |
| 3300031736|Ga0318501_10560147 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 626 | Open in IMG/M |
| 3300031740|Ga0307468_102030081 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300031744|Ga0306918_10485161 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 967 | Open in IMG/M |
| 3300031744|Ga0306918_10833068 | Not Available | 720 | Open in IMG/M |
| 3300031744|Ga0306918_11543538 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 507 | Open in IMG/M |
| 3300031819|Ga0318568_10766776 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300031820|Ga0307473_11143696 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_51_12 | 576 | Open in IMG/M |
| 3300031824|Ga0307413_10927777 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
| 3300031824|Ga0307413_11900614 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 535 | Open in IMG/M |
| 3300031854|Ga0310904_10802738 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
| 3300031879|Ga0306919_11351074 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300031879|Ga0306919_11410442 | Not Available | 526 | Open in IMG/M |
| 3300031890|Ga0306925_11028512 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 838 | Open in IMG/M |
| 3300031890|Ga0306925_12027716 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 542 | Open in IMG/M |
| 3300031908|Ga0310900_10024182 | All Organisms → cellular organisms → Bacteria | 3263 | Open in IMG/M |
| 3300031910|Ga0306923_10729530 | All Organisms → cellular organisms → Bacteria | 1101 | Open in IMG/M |
| 3300031910|Ga0306923_11743980 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 642 | Open in IMG/M |
| 3300031910|Ga0306923_11748117 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
| 3300031912|Ga0306921_10911424 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_51_12 | 997 | Open in IMG/M |
| 3300031942|Ga0310916_10906326 | Not Available | 739 | Open in IMG/M |
| 3300031944|Ga0310884_10699450 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300031946|Ga0310910_10785074 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 751 | Open in IMG/M |
| 3300032001|Ga0306922_10763780 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 1013 | Open in IMG/M |
| 3300032001|Ga0306922_11256941 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 751 | Open in IMG/M |
| 3300032001|Ga0306922_11834137 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 596 | Open in IMG/M |
| 3300032003|Ga0310897_10240006 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RIFOXYD12_FULL_50_9 | 807 | Open in IMG/M |
| 3300032003|Ga0310897_10469868 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 606 | Open in IMG/M |
| 3300032013|Ga0310906_10018157 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodopila | 2930 | Open in IMG/M |
| 3300032013|Ga0310906_11165435 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 559 | Open in IMG/M |
| 3300032042|Ga0318545_10325843 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 553 | Open in IMG/M |
| 3300032059|Ga0318533_10271144 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes → Actinoplanes missouriensis | 1228 | Open in IMG/M |
| 3300032059|Ga0318533_10545725 | Not Available | 850 | Open in IMG/M |
| 3300032075|Ga0310890_11194154 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300032076|Ga0306924_11232040 | Not Available | 808 | Open in IMG/M |
| 3300032174|Ga0307470_10107806 | Not Available | 1613 | Open in IMG/M |
| 3300032174|Ga0307470_10847648 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 713 | Open in IMG/M |
| 3300032180|Ga0307471_102428492 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 663 | Open in IMG/M |
| 3300032205|Ga0307472_100073557 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2240 | Open in IMG/M |
| 3300032205|Ga0307472_100087673 | All Organisms → cellular organisms → Bacteria | 2094 | Open in IMG/M |
| 3300032205|Ga0307472_100087673 | All Organisms → cellular organisms → Bacteria | 2094 | Open in IMG/M |
| 3300032205|Ga0307472_100168302 | All Organisms → cellular organisms → Bacteria | 1625 | Open in IMG/M |
| 3300032205|Ga0307472_100691606 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 916 | Open in IMG/M |
| 3300032205|Ga0307472_102414009 | Not Available | 534 | Open in IMG/M |
| 3300032261|Ga0306920_101260076 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1065 | Open in IMG/M |
| 3300032261|Ga0306920_101856320 | Not Available | 849 | Open in IMG/M |
| 3300032261|Ga0306920_102068120 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 796 | Open in IMG/M |
| 3300032261|Ga0306920_102807131 | Not Available | 663 | Open in IMG/M |
| 3300032261|Ga0306920_103595263 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300033290|Ga0318519_10958475 | Not Available | 530 | Open in IMG/M |
| 3300034661|Ga0314782_157181 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 562 | Open in IMG/M |
| 3300034668|Ga0314793_026034 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 951 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 24.82% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 12.68% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 11.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.17% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.15% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 4.60% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.49% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.57% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 2.57% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.21% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.21% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.02% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.47% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.47% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.29% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.74% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.55% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.55% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.55% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.55% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.55% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.37% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.37% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.37% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.37% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.37% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.37% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.37% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.37% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.37% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.37% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.18% |
| Sediment | Environmental → Aquatic → Marine → Unclassified → Unclassified → Sediment | 0.18% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.18% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.18% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.18% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.18% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.18% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.18% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.18% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.18% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.18% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.18% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.18% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.18% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000363 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
| 3300003987 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D2 | Environmental | Open in IMG/M |
| 3300003995 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleA_D2 | Environmental | Open in IMG/M |
| 3300004268 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio | Environmental | Open in IMG/M |
| 3300004281 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Host-Associated | Open in IMG/M |
| 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006420 | Deep-sea sediment bacterial and archaeal communities from Fram Strait - Hausgarten IV | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009157 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009610 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009797 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_10_20 | Environmental | Open in IMG/M |
| 3300009799 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_0_30 | Environmental | Open in IMG/M |
| 3300009811 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_20_30 | Environmental | Open in IMG/M |
| 3300009812 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_50_60 | Environmental | Open in IMG/M |
| 3300009813 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_10_20 | Environmental | Open in IMG/M |
| 3300009823 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_40_50 | Environmental | Open in IMG/M |
| 3300009837 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 | Environmental | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010112 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012405 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Host-Associated | Open in IMG/M |
| 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Host-Associated | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
| 3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
| 3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
| 3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
| 3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018079 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1 | Environmental | Open in IMG/M |
| 3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019233 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019269 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020003 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a2 | Environmental | Open in IMG/M |
| 3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300022413 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_21 | Environmental | Open in IMG/M |
| 3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
| 3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300027027 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_0_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300027056 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_20_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027379 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_10_20 (SPAdes) | Environmental | Open in IMG/M |
| 3300027490 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_0_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300027511 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_20_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027633 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027636 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57 HiSeq | Environmental | Open in IMG/M |
| 3300027654 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027961 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028587 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3 | Environmental | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300030619 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (Novaseq) | Environmental | Open in IMG/M |
| 3300030620 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111 | Environmental | Open in IMG/M |
| 3300030903 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_369 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030904 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_202 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031092 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_367 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031093 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_198 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031228 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57 | Environmental | Open in IMG/M |
| 3300031229 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38 | Environmental | Open in IMG/M |
| 3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
| 3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Host-Associated | Open in IMG/M |
| 3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031944 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032003 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1 | Environmental | Open in IMG/M |
| 3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
| 3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| 3300034661 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034668 | Metatranscriptome of lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0R1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| ICChiseqgaiiFebDRAFT_109309351 | 3300000363 | Soil | MNTVWALRREELLSDCLVSPDVFNQMVDRLGEFVMPYH |
| JGI11643J12802_117935112 | 3300000890 | Soil | MTLTWAQRREELLGDCIVSPDIFNPMIDRLAAFVVPYQQALE |
| JGI1027J12803_1086412053 | 3300000955 | Soil | MGTVWARRREDLLSDCLVSPDVFIPMVDRLAEFVVPYQHVLET |
| F14TB_1002882092 | 3300001431 | Soil | MTSAWAQRQAELLSSCIVSPHVFESIVDRLCDFVVPYVRRDS* |
| Ga0055471_100311491 | 3300003987 | Natural And Restored Wetlands | MHTVWAQRREEVLRDCLMSPDVFHQMVDRLGAFVVPYQHALETEAGQHSMHLY |
| Ga0055438_100878332 | 3300003995 | Natural And Restored Wetlands | MTLTWAQRREELLSDCIVSPDVFNPMIDRLAEFVVPYQQGLNLG* |
| Ga0066398_100587271 | 3300004268 | Tropical Forest Soil | MTPMWARRREDMLSDCIVSPDVFTQMVERLGAFVVPYQQALETDADQHP |
| Ga0066398_102215141 | 3300004268 | Tropical Forest Soil | MARTWTQRREALLSDCIVSPDVFTPMIDRLVAFVVPYQQALETEAAQRNM |
| Ga0066397_100052123 | 3300004281 | Tropical Forest Soil | MTPAWAQRQAELLRDCIVSPHVFEAMVDRLGEFVVPYQHALET |
| Ga0063356_1019494232 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MTPAWAQRQEALLSDCVVSPDVFTHVVDHLRDFVRPYQHALETEAGKRNVYLYL |
| Ga0063356_1031617441 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MTPAWAQRREALVSDCLVSPDVFQQMVDRLGAFVVPYQHALETEA |
| Ga0063356_1037443721 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MTPAWAQRREEMLSDCLVSPDVFTQMVDRLREFVVPYRP* |
| Ga0066395_108716082 | 3300004633 | Tropical Forest Soil | MTLAWTQRQAELLRDCIVSPDVFASMVDRLCDFVVPYQHALE |
| Ga0066674_105501562 | 3300005166 | Soil | MSTVWAQRREDLGSDCLVSPDVFNEMVDRLGEFIMPYQQALETEADPHSMHLYLQGLL |
| Ga0066683_103337131 | 3300005172 | Soil | MTPAWAQRQEALRRDCIVSPDVFSPMLDRLGEFVVPYQQALEAEAGQPHVHRY |
| Ga0066673_100712654 | 3300005175 | Soil | MTPVWAQRREELWSDCLVSPDVFHEMVDRLGEFVVPYQQALETEAGQ |
| Ga0066676_110933621 | 3300005186 | Soil | MALAWAQRREELLNDCIVSPDIFNPMIDRLAAFVLPYQQALETEAAQR |
| Ga0065704_100127021 | 3300005289 | Switchgrass Rhizosphere | MXTVWALRREELLSDCLVSPDVFNQMVDRLGEFVMPYVRRDS* |
| Ga0065704_100289064 | 3300005289 | Switchgrass Rhizosphere | MMTVWAQRREEVLSDCLVSPDVFNQMVDRLGEFVVPYQQALEIEAGQHPMRLRSIYSSL* |
| Ga0065705_100698121 | 3300005294 | Switchgrass Rhizosphere | MNTVWALRREELLSDCLVSPDVFNQMVDRLGEFVMPYQHV |
| Ga0065705_109819382 | 3300005294 | Switchgrass Rhizosphere | MTPAWAQRQAELLRDCLVSPDVFAFMVDRLGDFVVPYQHALETEAGQRNVHFYLAGLLVRDHRGTMCVTCE* |
| Ga0065707_100998801 | 3300005295 | Switchgrass Rhizosphere | MMTVWAQRREEVLSDCLVSPDVFNQMVDRLGEFVVPYQQALEIEAGQHPMRLRS |
| Ga0065707_104478113 | 3300005295 | Switchgrass Rhizosphere | MALAWAQRREALLSDCIVSPDVFNPMIDRLAEFVVPYQQAMETEAAQ |
| Ga0065707_109725602 | 3300005295 | Switchgrass Rhizosphere | MTLAWAQRREEMLSDCIVSPDVFHQMVDRLDEFVVPYQQALV |
| Ga0066388_1014407001 | 3300005332 | Tropical Forest Soil | MTSVWAQRREALWSDCLVSPDVFHEMVERLGEFVMPYQQALE |
| Ga0066388_1044512351 | 3300005332 | Tropical Forest Soil | MTRAWAQRQAELLRDCIVSPDVFASMVDRLCDFVVPYQHALE |
| Ga0066388_1051826911 | 3300005332 | Tropical Forest Soil | DMPFCGGEKMTPAWAQRQAELVSDCMVSPDVFASMVDRLRDFAMPYQHCLETEAEKRRFHRI* |
| Ga0066388_1060780341 | 3300005332 | Tropical Forest Soil | MTPAWAQRQAALRRDCLVSPDVFSSMVDRLGEFVVPYQQA |
| Ga0066388_1064248962 | 3300005332 | Tropical Forest Soil | MTPAWAQRQEALMRDCVVSPDVFTPMVDRLRDFVRPYQYALETEAGKRNVYL |
| Ga0070689_1005569072 | 3300005340 | Switchgrass Rhizosphere | MTPAWAQRQAELLSDCIVSPDVFESIVDRLCAFVVPYQLAFETEAGKRHV |
| Ga0070668_1004199622 | 3300005347 | Switchgrass Rhizosphere | MTLAWAQRQEELLSDCVVSPDVFHHMVERLGDFVVPYVRRDS* |
| Ga0070701_107498702 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | MTPAWSQRREELLRDCIVSPDVFHQMMDRLGEFVVPYQHALETE |
| Ga0070708_1005920062 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MTPAWAQRREEMLSDCLVSPDVFNQMVDRLDEFVVPSVRRDS* |
| Ga0070708_1010549392 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MTPVWAQRREELLSDCLVSPNVFNQMLDRLGEFVVPYRQALETEVGQHPMHLYLQGLLAEPVKFETE* |
| Ga0066682_103815222 | 3300005450 | Soil | MSTVWAQRREDLGSDCLVSPDVFYQMLDRLCAFVVPYQRALETETGQRNV |
| Ga0070662_1006335372 | 3300005457 | Corn Rhizosphere | MTPTWAQRREALLRDCIVSPDVFTSMVERLGDFVVPYQHA |
| Ga0068867_1018396132 | 3300005459 | Miscanthus Rhizosphere | MRTMWAQRREELLSDCLVSPEVFTPPIDRLGAVVVPYQHALATETDQHHMHLYLQGLL |
| Ga0070706_1021009151 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MRAVWASRQEELLHDCLVSPHVFTHMVDRLRDFAVPYQHCLETEADKRN |
| Ga0070707_1007426291 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MALTWTQRREELLSDCIVSPDVFNPMIDRLAAFVVPYQQALETEAAQRNLHLY |
| Ga0070707_1011181811 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MTPAWTLRQEELLRDCIVCPDVFNSIVDRLCAFVVPYQHALETEAGQRNVHLY |
| Ga0070698_1000694766 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MRAVWASRQEELLSDCVVSPHMFDHMVDRLCDFVVPYQHCLETE |
| Ga0070698_1001510645 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MHPVWAQRREEVLNDCIVSPDVFHQMVDRLAEFVVPYQG* |
| Ga0070698_1015778351 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MTPMWAQRQEELLRDCVVSPQVFDHMVDHLRDFVVPYQHTLETEANQRHVYLY |
| Ga0070699_1017234031 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MNTVWAQRREEVLRDCLVSPDIFHQMVERLDEFVVPYQHVLET |
| Ga0070697_1011669142 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MTPAWAQRQKELLSDCVVSPDVFHHMVDRLGEFVVPYQHALETEA |
| Ga0070697_1017378721 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MGTVWEQQREDLLSDCIVSPDIFIPLVDRLAEFTVPYHAAEYHRN |
| Ga0070693_1004413671 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | MHTVWAQRREELWSDCLVSPDVFTQMVDRLGEFVVPYQGFPE* |
| Ga0066661_107397251 | 3300005554 | Soil | MTPAWAQRREELLSDCIVSPDVFNPMVDHLHDFVVPY |
| Ga0066698_111078022 | 3300005558 | Soil | MTPVWAQRREELWSDCLVSPNVFHQMVDRLGEFAMPYQQALETEADPHSMHLSASIIVLAT* |
| Ga0066700_104194462 | 3300005559 | Soil | MTPTWAQRREALWRDCIVSPDVFTSMVERLGDFVVP |
| Ga0066670_105420322 | 3300005560 | Soil | MALTWTQRREELLSDCIVSPDVFNPMIDRLAAFVVPYQQ |
| Ga0066699_110340051 | 3300005561 | Soil | MHTVWAQRREEVVNDCLVSPDIFHHMVDRLAEFVVPYQHVL* |
| Ga0070664_1014073181 | 3300005564 | Corn Rhizosphere | MTPAWAQRREEMVSDCLVSPDVFTQMVERLGEFIVPYQQALETEADQHPM |
| Ga0070664_1018155831 | 3300005564 | Corn Rhizosphere | MALAWAQRREELLSDYIVSPDVFHQMVDRLAEFVVPYQHALETETGQHHMHLYLQ |
| Ga0066705_108389611 | 3300005569 | Soil | MTPTWAQRQEALLRDCIVFPGVFESIVDRLCDFAAPYQHCLETEAAQRNVQLYLAGLLSDLNRKN |
| Ga0066694_103291751 | 3300005574 | Soil | MTPVWAQRREELLSDCSVSPDVFHQMVDRLGEFVMLYQQ |
| Ga0066708_104818952 | 3300005576 | Soil | MNPVWAQRREEVLNDCIVSPDVFQQMVDRLAEFVVPYQ |
| Ga0068859_1029745201 | 3300005617 | Switchgrass Rhizosphere | MIPVWAQRREELWSDCLVSPDVFHQMVDRLGAFIMPYQQALEPEADPHSMHLYLQGLL |
| Ga0066905_1013433952 | 3300005713 | Tropical Forest Soil | MTPAWTQRQEALRHDCIVSPDVFDHMVERLRDFAVPYQHALET |
| Ga0066905_1015884642 | 3300005713 | Tropical Forest Soil | MTSAWAQRQGALLRDCVVSPDVFTPMADHLRDFVRPYQHALEA* |
| Ga0066903_1001669592 | 3300005764 | Tropical Forest Soil | MTPAWAQRRDALLSDCLVSPDIFHQMLDRLGAFVVPY* |
| Ga0066903_1004261823 | 3300005764 | Tropical Forest Soil | MSTMWAQRREELLSDCLVSPEVFTPLIDRLGAFVVPYQHALETETDQHHMHLYQ* |
| Ga0066903_1006642695 | 3300005764 | Tropical Forest Soil | MSIVWAQRREDLVSDCLVSPDVFHQMLDRLCAFVVPYQHALETE |
| Ga0066903_1024627311 | 3300005764 | Tropical Forest Soil | MHQVWAQRREEVLRDCLVSPDVFTQMVERLGEFVI |
| Ga0066903_1038179131 | 3300005764 | Tropical Forest Soil | MTPAWAQRRKEMLSDCLVSPDVFHQMVDRLGEFVV |
| Ga0066903_1040784621 | 3300005764 | Tropical Forest Soil | MHTVWAQRREAVLRDCLVSPDVFTEMVDRLDEFIVPYQHV |
| Ga0066903_1042349191 | 3300005764 | Tropical Forest Soil | MVQRQEALLQDCVVSPDVFDHMVERLRDFVVPYQR |
| Ga0066903_1047072171 | 3300005764 | Tropical Forest Soil | MHQVWAQRREEVLRDCLVSPDVFTQMVERLGEFVIPYQHALETAFR* |
| Ga0066903_1056112042 | 3300005764 | Tropical Forest Soil | MSTVWAQRREDLVSDCLVSPDVFHQMLDRLCAFVVPYQHA |
| Ga0068860_1001632881 | 3300005843 | Switchgrass Rhizosphere | MMTLAWAQRQEELLRDCIVSPDVFQHMVDRLGDFRLPRI* |
| Ga0081538_101037162 | 3300005981 | Tabebuia Heterophylla Rhizosphere | MTPAWAQRREEMLSDCLVSPDVFTQMVDRLGDFIVPYQQALETAADQHPMHL |
| Ga0081540_10202061 | 3300005983 | Tabebuia Heterophylla Rhizosphere | MNTVWAQRREEVLRDCLVSPDVFTQMMERLREFVMPYVRRDS* |
| Ga0075023_1001633541 | 3300006041 | Watersheds | MRAVRASRQEELLNDCAVSPQVFDHLVDRLCHFVVPYQPCLETEVGQRNVHL |
| Ga0075023_1003611201 | 3300006041 | Watersheds | MTPVWAQRKEELLSDCLVSPEVFTPMLDRLSDFVIPY |
| Ga0066652_1002758592 | 3300006046 | Soil | MTPAWAQRQEALLHDCIVSPDVFDHMVERLRDFAMPYQHALGTEASQR |
| Ga0075417_100964871 | 3300006049 | Populus Rhizosphere | MTLAWAQRQAELLSDCIVSPDVFQHMVDRLSDFAVPYQHAL |
| Ga0075417_101403285 | 3300006049 | Populus Rhizosphere | MTPVWAQRREALLSDCLVSPDVFHEMVDRLGEFVMPYQQALETEADPHSMHLYLQGLL |
| Ga0075417_103233241 | 3300006049 | Populus Rhizosphere | MSPAWAQRHEALLCGCIVSPDVFNSMVDRLCDFVV |
| Ga0075417_105920931 | 3300006049 | Populus Rhizosphere | MTSAWAQRHEALLRDCLVSPDVFSPMLDRLGEFVIPYQRTRPQGDE* |
| Ga0075417_106463171 | 3300006049 | Populus Rhizosphere | MIPAWAQRQAELLSDCIVSPDVFHHMVDRLRDFAMPYQHALETEANQRNVHL |
| Ga0075432_102683901 | 3300006058 | Populus Rhizosphere | MTPAWTLRQEELLRDCIVCPDVFNSMVDRLCAFVVPYQHAFETEAGKR |
| Ga0075432_103966083 | 3300006058 | Populus Rhizosphere | MNPVWAQRREEVLSDCIVSPDVFTQMVERLGEFVIPYQHALETTANGCHVHLY |
| Ga0070712_1016941651 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MTPAWAQRQEELRRDCIVSPDVFNPMVDHLRAFVVPYQRALEAEAGGRH |
| Ga0082248_100617331 | 3300006420 | Sediment | MTPTWAQRKEDLLSDCIVSPDVFNQIVDRLGEFVVPYQHALVCRESSLV* |
| Ga0066658_105599451 | 3300006794 | Soil | MNPVWAQQREAVLSDCIVSPDVFTEMVDRLDEFVVPYQHV |
| Ga0066658_107124272 | 3300006794 | Soil | MRGGEKITPVWAQRREEMWSDCLVSPDVFHEMVARLGEFVMPSQQ |
| Ga0066665_104412101 | 3300006796 | Soil | MTPLWAQRQEELLRDGLVSPDVFNHMVDRLCDFVVPYQ |
| Ga0066665_109706893 | 3300006796 | Soil | MPTVWALRREEVWRDCLVSPDVFQQMLDRLGAFVVPSQQALETEAGHRNLHL |
| Ga0066659_107616933 | 3300006797 | Soil | MTPVWAQRREEMWSDCLVSPDVFHEMVARLGEFVMPSQQALETEADPHSMHL |
| Ga0066660_111638881 | 3300006800 | Soil | MTPAWAQRREELLRDCIVSPDVFTSMVERLGDFVAPYQRVLETE |
| Ga0066660_115495422 | 3300006800 | Soil | MTPAWAQRQEELLSDCVVSPDVFDHMVDRLRDFVVPY |
| Ga0075428_1000155126 | 3300006844 | Populus Rhizosphere | MNPVWAQRREEVLSDCIVSPDVFTQMVERLGEFVIPYQHALETAANGCHVHLYLQG |
| Ga0075428_1000517033 | 3300006844 | Populus Rhizosphere | MNTVWAQRREELLSDCLVSPDVFTQMVDRLGEFVVPYQGFPE* |
| Ga0075428_1007022425 | 3300006844 | Populus Rhizosphere | MTPVWAQRREELLSDCIVSPDVFHQMVDRLGEFVMPYQQALETE |
| Ga0075428_1011260013 | 3300006844 | Populus Rhizosphere | MTPTWVQRREALLRDCIVSPDVFTSMVERLGDFVVPYQ |
| Ga0075428_1012682492 | 3300006844 | Populus Rhizosphere | MTPAWAQRRAELLRDCLVSPDVFQHMVERLSDFAMPYQHALGAGASQRSATDQRA* |
| Ga0075428_1013385823 | 3300006844 | Populus Rhizosphere | MDPVWAQRREEVLSDCLVSPDVFTQMVERLGEFVIPYQHALETAANGCHVHLYLQG |
| Ga0075421_1014837791 | 3300006845 | Populus Rhizosphere | MTPAWAQRREEMLSDCLVSPDVFTQMVDRLDEFIVPY* |
| Ga0075421_1026309351 | 3300006845 | Populus Rhizosphere | MTPTWAQRREELLSDCLVSPDVFHQMLDRLGEFVVPYQQALESEAAHHP |
| Ga0075421_1028110792 | 3300006845 | Populus Rhizosphere | MTLAWAQRQAELLRDCIVSPDVFASIVDRLCDFVVPYQHAL |
| Ga0075430_1000353273 | 3300006846 | Populus Rhizosphere | MTPGVGTRQAELLSDCLVSPDVFQHMVDRLRDFAVPYGF* |
| Ga0075430_1007622981 | 3300006846 | Populus Rhizosphere | MTLTWAQPREALLSDCIVSPDVFNSMIDRLAAFVVP |
| Ga0075430_1014192552 | 3300006846 | Populus Rhizosphere | MTLTWAQRREELLGDCIVSPDVFNPMIDRLAAFVVPYQQALETEAAQ |
| Ga0075431_1004567743 | 3300006847 | Populus Rhizosphere | MALAWAQRREELLNDCIVSPDVFNPMIDRLAAFVVPYQQALETEAAQRKKLF* |
| Ga0075431_1006369722 | 3300006847 | Populus Rhizosphere | MTPAWAQRREALLRDCIVSPDVFHQMVERLSVFVVPYQHALETEVGQRHVPLYLEGL |
| Ga0075431_1008853892 | 3300006847 | Populus Rhizosphere | MSTQWARRREELWRDCLVYPDVFHQMADRLAEFVVPYQQALESESTHPMHLYLQGL |
| Ga0075431_1011351311 | 3300006847 | Populus Rhizosphere | MTPVSAQRREELLSDCLVSPDVFHQMVDRLGEFVMPYQQALEPEADPHSMHLYLQG |
| Ga0075431_1012258712 | 3300006847 | Populus Rhizosphere | MARTWTQRREALLSDCIVSPDIFTPMIDRLAAFVVPYQQAMETEAAQRNMHLY |
| Ga0075431_1013372263 | 3300006847 | Populus Rhizosphere | MTPAWAQRQEALLRDCIVSPDVFDHMVERLRDFAVPYQRALETEASQRNVHLYLAGL |
| Ga0075433_104111723 | 3300006852 | Populus Rhizosphere | MTSAWAQRHEALLRDCLVSPDVFSPMLDRLGEFVIPYQRTRPQGEE* |
| Ga0075420_1001632582 | 3300006853 | Populus Rhizosphere | MTPTWAQRREALLRDCIVSPDVFTSMVERLGDFVVPYQQALETETGQRN* |
| Ga0075420_1019426332 | 3300006853 | Populus Rhizosphere | MTLTWAQRQEALLRDCVVSPDVFDHMVERLCDFVVPYQHALE |
| Ga0075425_1008528501 | 3300006854 | Populus Rhizosphere | MTPAWAQRQEALLRDCIVSPDVFESIVDRLCDFVVPYVRRDS* |
| Ga0075434_1008481271 | 3300006871 | Populus Rhizosphere | MTPVWTQRQEALLRDCIVSPDVFDHMVERLHFLQSC* |
| Ga0075434_1012502341 | 3300006871 | Populus Rhizosphere | MHPVWAQRREEVWNAGLVSPDVFHQRGERLAEFVMPSQHVLEIEAGHRPVHHYLAPG* |
| Ga0075434_1026572232 | 3300006871 | Populus Rhizosphere | MNTVWALRREELLSDCLVSPDVFNQMVDRLGEFAMPYQHVLET |
| Ga0075429_1003348103 | 3300006880 | Populus Rhizosphere | MTPLWAQRQAELLRDCLVSPDVFASMVDRLCDFVVPYQHGLETEAGQRHLHLYLVG |
| Ga0075429_1004691052 | 3300006880 | Populus Rhizosphere | MTPAWAQRQEALLRDCIVSPDVFDHMVERLRDFAVPYQRALETEASQRNVHLYL |
| Ga0075429_1010580211 | 3300006880 | Populus Rhizosphere | MTLAWLQRHEELLRDCIVSPDVFTSMVDRLGEFVMPYQQALETAAAQRNVHLYLT |
| Ga0075429_1016142262 | 3300006880 | Populus Rhizosphere | MSTVWAQRREELLSDCIVSPDVFTQMVDRLGAFVVPYQHALETEAGP |
| Ga0075424_1007596133 | 3300006904 | Populus Rhizosphere | MSPAWAQRHEALLCGCIVSPDVFNSMVDRLCDFVVPYQHALETEAGKRNM |
| Ga0075436_1012159401 | 3300006914 | Populus Rhizosphere | MTPAWAQRQEALLRDCIVSPDVFDHMIDRLGDFVVPYQH |
| Ga0075419_106261882 | 3300006969 | Populus Rhizosphere | MTPAWAQRQEALLRDCIVSPDVFDHMVERLRDFAV |
| Ga0075419_107642702 | 3300006969 | Populus Rhizosphere | MHTVWAQRREEVLSDCIVSPDVFTQMVERLGEFVVPYQHALE |
| Ga0075435_1010941921 | 3300007076 | Populus Rhizosphere | MSTVWAQRREDLVSDCLVSPDVFHQMVDRLCAFVVPYQHALETETGQ |
| Ga0099791_101238301 | 3300007255 | Vadose Zone Soil | MTSAWAQRHEELLRDCIVSPDVFSLLVDRLGEFVMPYQQA |
| Ga0099793_100909791 | 3300007258 | Vadose Zone Soil | MTPAWAQRQEAWLHDCLVSPDVFTSMVGRLGDFVVPYQHALETEAGKRHVHRP* |
| Ga0099793_101038843 | 3300007258 | Vadose Zone Soil | MRPAWAQRQDALLSDCIVSLDVFASMVDRLCDFAVPYKHALETVTG |
| Ga0099793_106737902 | 3300007258 | Vadose Zone Soil | MPIGGGETMTPAWAQRKEELLSDCIVSPDVFNQMVDRLGEFVVPYQQAIETEADQ |
| Ga0099794_104839282 | 3300007265 | Vadose Zone Soil | MTPAWAQRQAALLRDCIVSPDVFMHMVGRLSDFVVPYQLALETEASQRNVH |
| Ga0099794_105132641 | 3300007265 | Vadose Zone Soil | MNTVWAQRREELLSDCLVSPDVFTQMVDRLGEFVVPYQGF |
| Ga0066710_1032276302 | 3300009012 | Grasslands Soil | MTPAWAQRQEELLSDCVVSPDVFDHMVDRLRDFVVPYQHALETEASQRN |
| Ga0066710_1040390311 | 3300009012 | Grasslands Soil | MSTLWARRREELLNDCFVCPDVFHQMADRLAEFVVPYQQALEADVAHPMHLYLQDLLSHLQRKNAEE |
| Ga0066710_1042040032 | 3300009012 | Grasslands Soil | MTPAWAQRREEMVSDCLVSPAVFEQMVDRLGEFVVPYQQALE |
| Ga0099829_100157152 | 3300009038 | Vadose Zone Soil | MHTVWAQRREEVLSDCIVSPDVFNQMVDRLDEFVVPYQHV* |
| Ga0099829_102222842 | 3300009038 | Vadose Zone Soil | MTPAWAQRQEELLRDCIVSPDVFDHMVDRLHDFVVPYVRRDS* |
| Ga0099829_107228721 | 3300009038 | Vadose Zone Soil | MAISGGEKMSTVWTQRREELLSDCIVPPDVFTQMVDRLGAFVVPYQHALETEAGPHYMHFYLARG* |
| Ga0099829_114120741 | 3300009038 | Vadose Zone Soil | MTPAWAQRREELLSDCLVSPDVFHQMVDRLGEFVVPYQQALETEA |
| Ga0099829_115410912 | 3300009038 | Vadose Zone Soil | MPISGGEKMTPAWAQRQEALRRDCIVSPDVFNPMVDHLRDFVVPYQR |
| Ga0099830_108956272 | 3300009088 | Vadose Zone Soil | MTPAWAQRREALLRDCIVSPDVFHQMLERLSDFVVPYQQALETEVGQRHLPL |
| Ga0099828_103407421 | 3300009089 | Vadose Zone Soil | MHTVWAQRREELLSDCLVSPDVFHHMMDRLGDVVVPYQHALEA |
| Ga0099828_103420612 | 3300009089 | Vadose Zone Soil | MTPAWAQRREALLRDCIVSPDVFHQMVDRLGDFVVPYQHALETEVGQSHVQQIP* |
| Ga0099828_103668222 | 3300009089 | Vadose Zone Soil | MTPAWAQRQEELLSDCIVSPDVFNPIVERLGEFVVPYVRRDS* |
| Ga0099828_106428791 | 3300009089 | Vadose Zone Soil | MTPAWAQRQEALLSDCIVSPDVFNHMADRLGNFVVPYQQALETEAGKRNVPLYLAGL |
| Ga0099828_107641473 | 3300009089 | Vadose Zone Soil | MTPAWALRQEALLNDCIVSPDMFTPMVDRLGAFVVPYQQALEAEAGPRHVHRYLAGLLS |
| Ga0099828_109277272 | 3300009089 | Vadose Zone Soil | MSFQGGETMSTVWAQRKEELLSDCIVSPDVFNHLMGRLGDFVVPYQHALEAEAGGRHVHLYL |
| Ga0099828_116775492 | 3300009089 | Vadose Zone Soil | MTPAWAQRQEALLSDCIVSSDVFDHMVDRLGDFVVPYQHALET |
| Ga0099828_118002192 | 3300009089 | Vadose Zone Soil | MTPAWAQRQEELLSDCIVSPDVFNPMVDRLRDFVVHYQHVLETK |
| Ga0099827_100820963 | 3300009090 | Vadose Zone Soil | MALAWAQRREELLNDCIVSPDIFTPMIDRLAAFVFPYQQALETEAA |
| Ga0099827_101749224 | 3300009090 | Vadose Zone Soil | MMTVWAQRREEMLSDCLVSPDVFHQMVDRLGEFVVPYQHALETETG |
| Ga0099827_103134881 | 3300009090 | Vadose Zone Soil | MTPAWAQRQEALLRDCIVSPDVFAHMVERLRDFVVPYVRRDSSLHIAT* |
| Ga0099827_105446071 | 3300009090 | Vadose Zone Soil | EKMTPAWAQRQEALLSDCIVSPDVFNHMADRLGDFVVPFQQALETEAGKRNMPLYLVVYP |
| Ga0099827_107077411 | 3300009090 | Vadose Zone Soil | MMTPAWALRQEALLSDCIVSPDVFNHMVDRLGDFVVPYQHALET |
| Ga0099827_110287731 | 3300009090 | Vadose Zone Soil | MNPVWAQQQEAVLRDCLVSPDVFTQMVNRLGEFVVPYQH |
| Ga0099827_111033911 | 3300009090 | Vadose Zone Soil | MSTVWAQQREDLLSDCSVSPHVFNQMVARLAEFVVPYQQALETK |
| Ga0099827_117274151 | 3300009090 | Vadose Zone Soil | MPSAWAQRQAALLRDCIVFPDVFNPMVDRLGDFVVPYVRRDS* |
| Ga0099827_119008501 | 3300009090 | Vadose Zone Soil | MNTVWAQRREEVLSDGIVSPDVFHQMVDRLGEFVVPYQHALETEASGRH |
| Ga0099827_119457181 | 3300009090 | Vadose Zone Soil | MPAVWAQRHEELLSDCLVSPDVFHHMVDRLCDFVGPYQHALETKA |
| Ga0111539_101230361 | 3300009094 | Populus Rhizosphere | MNPVWAQRREEVLSDCIVSPDVFTQMVNRLGEFVMPY |
| Ga0111539_101992554 | 3300009094 | Populus Rhizosphere | MRPVWAQRREELWSDCLVSPDVFHEMVNRLGEFVMPYQQALETEA |
| Ga0111539_104096111 | 3300009094 | Populus Rhizosphere | MTPAWAQRREELLRDCLVSPDVFQQMVDRLGAFVVPYQHALETEAGQRN |
| Ga0111539_106570711 | 3300009094 | Populus Rhizosphere | MTPAWAQRRAELLRDCLVSPDVFQHMVERLSDFAMPYQHALG |
| Ga0111539_129305112 | 3300009094 | Populus Rhizosphere | WAQRRAELLRDCLVSPDVFQHMVERLSDFAMPYQHALGAGASQRSATDQRA* |
| Ga0075418_101305621 | 3300009100 | Populus Rhizosphere | WAQRREALLRDCIVSPDVFTSMVERLGDFVVPYQQALETETGQRN* |
| Ga0075418_113567501 | 3300009100 | Populus Rhizosphere | MTPAWAQRQADLLSDCIVSPDVFQRMVDRQRDFAVPYQHALETEASQRNVQLYLT |
| Ga0075418_114091041 | 3300009100 | Populus Rhizosphere | MPFCEGEKMIPTWAQRQAELLRDCIVSPGVFQHMVDRLHDFAAPYQHALKTEASQRNVPLYL |
| Ga0075418_125541432 | 3300009100 | Populus Rhizosphere | MPLGGGEKMTPTWAQRREALLRDCIVSPDVFTSMVERLGDFVVPYQQALETE |
| Ga0075418_129196092 | 3300009100 | Populus Rhizosphere | MTRAWAQRQAELLRDCIVSPDVFASMVDRLGDFVVPYQHALESEAGKR |
| Ga0066709_1006374043 | 3300009137 | Grasslands Soil | MTPARTQRQEALLRDCIVSPDVFDHMVERLRDFAV |
| Ga0066709_1032863172 | 3300009137 | Grasslands Soil | MALTWAQRREELLSDCIVSPDVFNPMIDRLAAFVVPYLQA |
| Ga0114129_106629804 | 3300009147 | Populus Rhizosphere | MIPAWAQRQAELLRDCIVSPDVFDHMVDRLRAFAVPY |
| Ga0114129_111614561 | 3300009147 | Populus Rhizosphere | MPLGGGEKMTPTWAQRREALVRDCIVSPDVFTSMVERLGDFVV |
| Ga0114129_111999941 | 3300009147 | Populus Rhizosphere | MTLAWAQRREEMLSDCIVFPDVFQQMVERLGEFVVPYQQALGTEADQHPMQLYL |
| Ga0114129_113921181 | 3300009147 | Populus Rhizosphere | MSFCGGEKMTPAWAQRREELLSDCLVSPDVFHQMVDRLGEFVVPYQQAL |
| Ga0114129_130015491 | 3300009147 | Populus Rhizosphere | MALTWTHRREELLSDCIVSPDVFNPMIDRLAEFVVPYQQALETEAAQRNLHL |
| Ga0111538_104217001 | 3300009156 | Populus Rhizosphere | MTPAWAQRQADLLRDCLVSPDVFASMVDRLGDFVVPYQHA |
| Ga0111538_104598961 | 3300009156 | Populus Rhizosphere | MNTVWALRREELLSDCLVSPDVFNQMVDRLGEFVMP* |
| Ga0111538_119860153 | 3300009156 | Populus Rhizosphere | MDPVWAQRREEVLSDCLVSPDIFTQMVERLGEFVIPYQH |
| Ga0105092_102051521 | 3300009157 | Freshwater Sediment | MTPAWAQRQKALLNDCVVSPDVFYHMGDRLGDFVAP |
| Ga0075423_104590911 | 3300009162 | Populus Rhizosphere | MPFCGGEKMTPAWAQRQEALLRDCIVSPDVFDHMIDRLGDFVVPYQHALE |
| Ga0075423_108940951 | 3300009162 | Populus Rhizosphere | MTPAWAQRQEALLNDCIVSANVFTPLVDRLGAFVVPYQQTLEAEAGQRH |
| Ga0075423_122655761 | 3300009162 | Populus Rhizosphere | GEKMTPVWTQRREELLSDCLVSPDVFTQMVDRLGEFVVPYQGFPE* |
| Ga0075423_122817681 | 3300009162 | Populus Rhizosphere | MTPAWAQRQEALLRDCIVSPDVFYHMVERLRDFAVPYQRALETEASQRNVHLY |
| Ga0075423_130563861 | 3300009162 | Populus Rhizosphere | MTPAWAQRQEELLRDCIVFPDVFNSMVDRLGDFVVPYQHALETE |
| Ga0105242_101153464 | 3300009176 | Miscanthus Rhizosphere | MTPAWAQRREALLSDCLVSPNVFHQMLDRLGAFVVPYQRALESEAAHHP |
| Ga0105242_109166711 | 3300009176 | Miscanthus Rhizosphere | MIPAWAQRQAELLSDCIVSPDVFESIVDRLCAFVVPYQLAFETEAGKRHVHLY |
| Ga0105249_122700101 | 3300009553 | Switchgrass Rhizosphere | MTLAWAQRQAELLRDCIVSPDVFQHMGDRLGDFVVPYQHA |
| Ga0105249_129417242 | 3300009553 | Switchgrass Rhizosphere | MTPAWAQRPADLLSACIVSPDVFQRMVDRLRDFAVPYQQAL |
| Ga0105340_15053691 | 3300009610 | Soil | MTPAWAQRQEELWSDCVVFPDVFDHMVDGLSDVVVWYQVARETEASQG* |
| Ga0126374_104929303 | 3300009792 | Tropical Forest Soil | MTSGWAQRQAELLSGCIVSPHVFASIVDRLGDFMVPYQHALETE |
| Ga0126374_106364791 | 3300009792 | Tropical Forest Soil | MNNVWAQRREEVLRDCLVSPDVFTQMVERLGEFVIPYQHALETE |
| Ga0126374_113087442 | 3300009792 | Tropical Forest Soil | MALAWARRQEALLSDCIVFPDVFHHMVDRLGDFVVRYQPALKT* |
| Ga0126374_116414601 | 3300009792 | Tropical Forest Soil | MTPAWAQRREALLSDCLVSPDLFHQMLDRLGAFVVPYQRALASEAAHH |
| Ga0105080_10230892 | 3300009797 | Groundwater Sand | MTPAWAQRQEELLRDCIVSPDVFTQMVDRLGAFVVPYQQAFETEVGQH |
| Ga0105075_10151352 | 3300009799 | Groundwater Sand | MTPAWAQRQKELRRDCLVLPDVFSPMVDRLGEFVVP |
| Ga0105084_10806971 | 3300009811 | Groundwater Sand | MTPAWAQRQEALLRDCIVSPDVFDHMVERLRDFAVPYQHALE |
| Ga0105067_10490311 | 3300009812 | Groundwater Sand | MTPAWAQRREELLRDCIVSPDVFNQMVDRLGDFVVPYQH |
| Ga0105057_10326303 | 3300009813 | Groundwater Sand | MTSVWALRQEALLNDCIVSPDVFSNVVDRLRDFVVPYQR |
| Ga0105078_10367011 | 3300009823 | Groundwater Sand | MTAMWAQRHEELLTDCIVSPDVFDHMVDRLRAFVVPYQHGLETEAGQRHMHLYL* |
| Ga0105078_10513841 | 3300009823 | Groundwater Sand | MALAWAQRREELLSDCIVSPDVFNPMIDQLATFVVPYQQA |
| Ga0105058_11296201 | 3300009837 | Groundwater Sand | MTPVWAQRREELWSDCIVSPNVFHQMVDRLGEFAMPYQQALETEADPHSMHLYLQGLLS |
| Ga0126315_108936213 | 3300010038 | Serpentine Soil | MHTVWAQRREEVLSDCIVSPDVFTQMVERLDEFVVPYQHVLE |
| Ga0126380_102198642 | 3300010043 | Tropical Forest Soil | MTPVWAQRQEELLRDCIVSPDVFSPMVDRLGEFVVPYQQALEAEAG |
| Ga0126380_109754301 | 3300010043 | Tropical Forest Soil | MHTVWAQRREEVLNDCLVSPDVFPQMVERLAEFVVPYQHVLE |
| Ga0126380_112470171 | 3300010043 | Tropical Forest Soil | MHTVWALRREALVSDCRVSPDVFHQMVDRLGEFVVP |
| Ga0126380_117152051 | 3300010043 | Tropical Forest Soil | MQGGEKMSTVWAQRREALVSDCLVFPDVFHPMVDRLGQFVVPYQHVLETEACQHTV |
| Ga0126384_103104552 | 3300010046 | Tropical Forest Soil | MTPAWAQRQEELLCDCIVSPDVFNSMMDRLCDFVV |
| Ga0126384_110460652 | 3300010046 | Tropical Forest Soil | MTPVWAQRQEALLRDCVVSPDVFTPMVDRLRDFVRPYQYALETE |
| Ga0126384_113426243 | 3300010046 | Tropical Forest Soil | MTPAWARRQAELLRDCIVSPDVFASMVDRLGDFVVP |
| Ga0126384_113809362 | 3300010046 | Tropical Forest Soil | MALPWAQRREALLSDCIVSPDIFTPMVDRLAEFVVPYQQALAT |
| Ga0126384_115628961 | 3300010046 | Tropical Forest Soil | MMTLAWAQRQEEVLRDCIVSPDVFHSMVDRLRDFVVPYQHALGTEASQRNVHL |
| Ga0126384_120956391 | 3300010046 | Tropical Forest Soil | MTSVWAQRRAELWSDCLVSPDVFNEMVERLGEFVMPYQQALETE |
| Ga0126384_120998461 | 3300010046 | Tropical Forest Soil | MTPAWAQRQEALLRDCVVSPDVFTPMVDRLRDFVRPYQYALETE |
| Ga0126384_123715721 | 3300010046 | Tropical Forest Soil | MTSAWAQRQAELLSDCIVSPHVFESMVDRLCDFVAPYQHALETEAGQRHLHLYLV |
| Ga0126382_102009332 | 3300010047 | Tropical Forest Soil | MYGGEKMTPVWAQRREEMLSDCLVSPDVVTQMVDRLGEFIVPYQQALETEADQHPMQLHLGPVTT* |
| Ga0126382_106346431 | 3300010047 | Tropical Forest Soil | MHPVWAQRRKEVLSDCLVSPDVFTQMVERLGEFVIPYQHALETEAS |
| Ga0126382_106463042 | 3300010047 | Tropical Forest Soil | MSIVWAQRREDLVSDCLVSPDVFHQMLDRLCAFVVPYQHALESE |
| Ga0127458_10329741 | 3300010112 | Grasslands Soil | MPSQGGEKMTSVWAQRQVELLRDCIVSSDVFNYIVDRLGD |
| Ga0134084_104764352 | 3300010322 | Grasslands Soil | MNTAWAQRREELWSDCIVSPDVFNQMVDRLDEFVVPYQ |
| Ga0126370_104705371 | 3300010358 | Tropical Forest Soil | MTPAWAQRQEALLRDCIVSPDVFNHMVDRLREFVVPYQHALETEAGKRN |
| Ga0126370_108368921 | 3300010358 | Tropical Forest Soil | MTPAWAQRQAELVRDCIVSPDVFASIVDRLSDFVVPYQHALETEAG |
| Ga0126370_109666561 | 3300010358 | Tropical Forest Soil | MNHVWARRREEVLRDCLVSPDVFTQMVERLGEFVIPY |
| Ga0126370_109918351 | 3300010358 | Tropical Forest Soil | MPSQGGEKMTSMWARRQEELLRDCIVPSDVFNHMVDRLGDFVLPYQHALETEAGKRNVHLYL |
| Ga0126370_113078691 | 3300010358 | Tropical Forest Soil | MWAQRREELWSDCLVSPDVFQEMVERLGEFVMPYQQALATDPHA |
| Ga0126370_125030111 | 3300010358 | Tropical Forest Soil | MPFCGGEKMIPTWAQRQAELLSDCIVSPDVFDHMVDRLHAF |
| Ga0126376_100476625 | 3300010359 | Tropical Forest Soil | MSTVWAQRREDLVSDCLVSPDVFHQMLDRLCAFVVPYQHALETETGQRN |
| Ga0126376_101975591 | 3300010359 | Tropical Forest Soil | MTPAWAQQPEALLRDCIVSPDVFDSMVERLCAFVMPYQHALETEA |
| Ga0126376_105427681 | 3300010359 | Tropical Forest Soil | MPFCGGEKMTPAWAQLQAELLRDCIVSPDVFASMVDRLCDFVVPYQHALETEAGQRNVHLYLQMRN |
| Ga0126376_108124573 | 3300010359 | Tropical Forest Soil | MTPAWAQRQEELLRDCIVSPDVFNFMVDRLRDFVGQYQHALGTEESQH |
| Ga0126376_108968802 | 3300010359 | Tropical Forest Soil | MTQAWAQRQAELLRDCLVSPDVFQHMANRMGDFAVPYQHALETEA |
| Ga0126372_108991591 | 3300010360 | Tropical Forest Soil | MTPAWAQRQAELLRDCLVSPDVFTQMVERLGDFVVPYQHALETEAGQRNVH |
| Ga0126372_118958782 | 3300010360 | Tropical Forest Soil | MTSVWAPRQEELLRDCIVPSDVSNPMVDRLGDCVLPSQHARETEAGKRNMHLSLAGLL |
| Ga0126372_132899762 | 3300010360 | Tropical Forest Soil | MTPAWAQRQEELLRDCVVFPDVFDHMVDRLRDFGVPYQQALETEASQR |
| Ga0126378_121694661 | 3300010361 | Tropical Forest Soil | MTLAWAQRQAELLRDCLVSPDVFQHMVDRLSDFAVPYQHALETEAGRRN |
| Ga0126378_125602741 | 3300010361 | Tropical Forest Soil | MTPTWAQRREELLSDCLVSPDVFMQMVERLGGFVVPY |
| Ga0126377_104510601 | 3300010362 | Tropical Forest Soil | MALAWAQRREELLRDCIVSPDVFSPMLDRLGEFAMPYQQALAA |
| Ga0126377_109394281 | 3300010362 | Tropical Forest Soil | MTPAWTLRQEELLRDCIVCPDVFNSIVDRLCAFVVPYQHALETE |
| Ga0126377_113049182 | 3300010362 | Tropical Forest Soil | MSRLWAQRREELLSDCLGSPEVFTPHIDRLGTFVVP |
| Ga0126377_116009431 | 3300010362 | Tropical Forest Soil | MWAQRREALLNDCIVSPDVFNPMVDRLAAFVVPYQQALETEATQRHLHLYVSDVRRDWC* |
| Ga0126379_100375371 | 3300010366 | Tropical Forest Soil | MHPVWAQRRKEVLSDCLVSPDVFTQMVERLGEFVIPYVRRDS* |
| Ga0126379_104820891 | 3300010366 | Tropical Forest Soil | MWAQRREEVLRDCIVSPDVFSPMLDRLGEFAMPYQRALAAEVGQHHVHRYLAGLLSHLNR |
| Ga0126379_109857251 | 3300010366 | Tropical Forest Soil | MNHVWARRREEVLRDCLVSPDVFTQMVERLGEFVIPYQHALETEAS |
| Ga0126379_118662211 | 3300010366 | Tropical Forest Soil | PAWAQRPAELLRDGLVSPAVFHHMVDRLRAFVVPYQHALESEAGQRHVYLYTYCLPL* |
| Ga0126379_125392212 | 3300010366 | Tropical Forest Soil | MTPAWAQRREEMVSDCLVSPDVFHQMVDRLGEFVVPYQHALASETGQHHMHLY |
| Ga0126379_125554231 | 3300010366 | Tropical Forest Soil | MTPLWAQRQAELLRDCLVSPDVFASMVDRLCDFVVPYQHALETEAGKRHLHL |
| Ga0126383_100246959 | 3300010398 | Tropical Forest Soil | MTSVWAPRQEELLRDCIVPSDVSNPMVDRLGDCVLPSQHARETEAGKR |
| Ga0126383_102315643 | 3300010398 | Tropical Forest Soil | MTQAWAQRQAELLRDCLVSPDVFQHMVDRLSDFAVPYQHALETEAG |
| Ga0126383_103636122 | 3300010398 | Tropical Forest Soil | MTPAWAQRQEALLRDCIVFPDVFNHMVDRLREFVVPYQHALET |
| Ga0126383_109781221 | 3300010398 | Tropical Forest Soil | MPPAWAQRQKALLHDCIVSPDVFDHMVERLRDFAVPYVRRDS* |
| Ga0126383_116385031 | 3300010398 | Tropical Forest Soil | MHTVWAQRREEVLNDCLVSPDIFHQMVERLAEFVVPY |
| Ga0126383_122562912 | 3300010398 | Tropical Forest Soil | MYTAWAQRREEMVSDCLVSPDVFTQMVDRLGEFVMPY |
| Ga0126383_127695612 | 3300010398 | Tropical Forest Soil | MSTVWAQRREDLVSDCLVSPNVFHQMLDRLCAFVVPYQHAL |
| Ga0126383_127708492 | 3300010398 | Tropical Forest Soil | MRAVWAQRQEELLSDCVVSPHVFDHMVDRLGDFAVPINTA* |
| Ga0134123_130117021 | 3300010403 | Terrestrial Soil | MPLCGGEKMTSAWAQRQAELLSICIVSPHVFESIVDRLCDFVVPYQHALETEA |
| Ga0137392_113176691 | 3300011269 | Vadose Zone Soil | MHTVWAQRREELLSDCLVSPDVFNQMVDRLGEFVVPYQQALEAEA |
| Ga0137391_106667372 | 3300011270 | Vadose Zone Soil | MTPAWAQRQEALLSDCIVSPDVFNHMVDRLGDFAMPYQHAFEALW* |
| Ga0137391_106869311 | 3300011270 | Vadose Zone Soil | MQTVWAQRREEVLRACLVSPDIFHHMVERLDEFVVPSQHVLETTTG |
| Ga0137393_105041173 | 3300011271 | Vadose Zone Soil | MTPVWAQRREELLSDCLVSPDVFHQMVDRLGAFVRPYQQAFETEADPHSMHLYLQGL |
| Ga0137393_105122722 | 3300011271 | Vadose Zone Soil | MNTMWAQRREEVMRDCLVSPDVFNQMVDRLDEFVVPYQHVL |
| Ga0137389_103515093 | 3300012096 | Vadose Zone Soil | MTPAWVQRQKELLSDWVVSPDVFTSMVERLGDFVVP* |
| Ga0137389_104767191 | 3300012096 | Vadose Zone Soil | MTPTWAQRREALLRDCIVSPDVFHQMVERLSAFVVPYQHALETEV |
| Ga0137388_112221962 | 3300012189 | Vadose Zone Soil | MNTGWAQRREELLSECIVSPDVLNQMVDRLGEFVVP |
| Ga0137364_107413932 | 3300012198 | Vadose Zone Soil | MTPVWAQRREELLSDCLVSPDVFHQMVDRLGEFVMPYQQAIET |
| Ga0137383_102165381 | 3300012199 | Vadose Zone Soil | MTPAWAQRQAELLSDCIVSPDVFESIVDRLRDFATPYQHCL |
| Ga0137365_101964541 | 3300012201 | Vadose Zone Soil | MTPAWALRQEALLNDCIVSPDVFNHMMDRLGDFVVPYQH |
| Ga0137365_104330403 | 3300012201 | Vadose Zone Soil | MTPAWAQRQEALLHDCVVSPHGFHHMVDDLRDFVVPYQH |
| Ga0137363_101125913 | 3300012202 | Vadose Zone Soil | MALTWAQRREELLSDCIVSPDVFNPMIDRLAAFVAPYQQALETEAARR |
| Ga0137399_103812713 | 3300012203 | Vadose Zone Soil | MTLTWAQRRAALLSDCIVSPDVFNPMIDRLAEFVVPYQQALETEVAQRN |
| Ga0137399_105049022 | 3300012203 | Vadose Zone Soil | MNTVWARRREELLSDCLVSPNVFNQMINRLGEFVVPYQRGLETEAGQRNVH |
| Ga0137374_105542551 | 3300012204 | Vadose Zone Soil | MCGGEKMNTVWTQRREEVLCDCLVTPDVFTQMLDRLGEFVVPYQQALETETGRHPMH |
| Ga0137362_102210523 | 3300012205 | Vadose Zone Soil | MHTVWAQRREEVLRDCLVSPDIFNQMVERLEEFVVPYQHVLD* |
| Ga0137362_104199531 | 3300012205 | Vadose Zone Soil | MPIGGGEKMTPAWAQRREELLSDCIVSPDVFNPMVDHLRDF |
| Ga0137362_105619392 | 3300012205 | Vadose Zone Soil | MTSAWAQRQAELLSDCIVSPDVFDPMMDRLRTFVVPYQQALETEA |
| Ga0137362_112878801 | 3300012205 | Vadose Zone Soil | MHTVWAQRREEVVSDGIVPPDVFTPLIDRLGEFVVPYQHALETETGQHHM |
| Ga0137362_116978002 | 3300012205 | Vadose Zone Soil | MNTVWAQRKEELLSDCIVSPNVFNHMMDRLGDFVVPYQHALEAEAGG |
| Ga0137380_112616422 | 3300012206 | Vadose Zone Soil | MHTVWAQRREEVVNDCLVSPDIFHHMVDRLAEFVMPYQHVLETEAGQRHVHLYL |
| Ga0137381_109941182 | 3300012207 | Vadose Zone Soil | MTSAWALRREELWSDCLVSLDVFSPMVDRLGEFVLPYQHALETKAGQ |
| Ga0137381_114612741 | 3300012207 | Vadose Zone Soil | MTPAWALRQEALLNDCNVSPDVFNHMMDRLGDFVVPYQH |
| Ga0137378_100993182 | 3300012210 | Vadose Zone Soil | MTPVWAQQREELLSDCLVSPDVFHQMVDRLGTFVISYQQVLETEAGQRNV |
| Ga0137377_101784511 | 3300012211 | Vadose Zone Soil | QRQAELLSDCIVSPDVFASMVDRLCDFVVPYVRRDSSLHIAAIAQK* |
| Ga0137377_106877781 | 3300012211 | Vadose Zone Soil | MTPAWAQRQEELLSDCVVFPDVFDHMVDGLRDFVVPY |
| Ga0137377_112584101 | 3300012211 | Vadose Zone Soil | MNTVWAQRKEELLSDCIVSPDVFNPMMDRLGDCVVPYQHALEAEAGGRHVHL |
| Ga0150985_1232040931 | 3300012212 | Avena Fatua Rhizosphere | MTPAWAQRQAELLSDCLVSPDVFASIIDRLCNFVVPYQHALETEAGKRHVP |
| Ga0137387_105206591 | 3300012349 | Vadose Zone Soil | MQGGEKMGTVWAQQREDLLSDCIVSPDVFIPMVDRLAEFAVPYQHVLETEAGQRNV |
| Ga0137387_106123382 | 3300012349 | Vadose Zone Soil | MHTVWAQRREEVLRDCLVSPDVFTQMVDRLDEFVV |
| Ga0137387_110611621 | 3300012349 | Vadose Zone Soil | MTPAWAQRQEELLRDCIVSPDVFESIVDRLCDFVVPYQHA |
| Ga0137387_110949952 | 3300012349 | Vadose Zone Soil | MNTVWALRREELLSDCLVSPDVFNQMVDRLGEFVMPYQHVLDSIGICIFCV* |
| Ga0137372_102566993 | 3300012350 | Vadose Zone Soil | MTPAWAQRQEELLSDCVVFPDVFDHMVDGLRDFVVPYQHALETEA |
| Ga0137372_106694161 | 3300012350 | Vadose Zone Soil | MPIGGGEKMTPAWAQRQEELLRDCIVSPDVFTHMMDRLGDF |
| Ga0137386_107152202 | 3300012351 | Vadose Zone Soil | MTPAWAQRREEMLSDCIVSPDVFNQMVDRLDEFVVP |
| Ga0137366_105810221 | 3300012354 | Vadose Zone Soil | MTPAWAQRQEELLRDCIVSPDVFNHTVDRLCDFVV |
| Ga0137366_110076801 | 3300012354 | Vadose Zone Soil | MPIGGGETMTPAWAQRKEELLSDCIVSPDVFNQMVDRLGEFVVPYQQVLETEA |
| Ga0137371_102569682 | 3300012356 | Vadose Zone Soil | MSNVWAQRREELLSDCIVSPDVFQQMVDRLGAFVVPYQHALETQDDGFQLHLDLQGLLSHG* |
| Ga0137371_102869922 | 3300012356 | Vadose Zone Soil | MTPAWAQRQKELLRDCVVSPDVFTHMVDRLRDCVVPYQYALETEAG* |
| Ga0137384_100694585 | 3300012357 | Vadose Zone Soil | MTPAWAQRQAELLSDCIVSPDVFHQMVDRLRDFVVPYVRRD |
| Ga0137384_110926462 | 3300012357 | Vadose Zone Soil | MALTWAQRREELLRDCIVSPDVFNPMIDRLAAFVVPYQQALETEAAQRNL |
| Ga0137384_113432531 | 3300012357 | Vadose Zone Soil | MPLGGGEKMTPTWAQRREALVRDCIVSPDVFTYMVERLGDFVVPYQHALG |
| Ga0137368_105063282 | 3300012358 | Vadose Zone Soil | MTPAWAQRQEEWLSDCIVSPDVCNSMGDRLGDFVVPYQQA |
| Ga0137385_107762093 | 3300012359 | Vadose Zone Soil | MNTVWALRREQLLSDCLVSPDVFNQMVDRLGAFVMPYQ |
| Ga0137385_108293812 | 3300012359 | Vadose Zone Soil | MTPPWAQRQAELLRDCIVSPDVFTSMVDRLGEFVMPYQQALETEA |
| Ga0137375_104941972 | 3300012360 | Vadose Zone Soil | MTPAWAQRQKDLLSDGVVSPDVFHHMLDRLGDFVAPYQHVLETETGQRPVHRYL |
| Ga0137375_113337901 | 3300012360 | Vadose Zone Soil | MQGGEKMRTVWAQRREELLNDCIVSPDVFTPLIDRLGAFVVPYQHALETEAGQHPM |
| Ga0137360_100937951 | 3300012361 | Vadose Zone Soil | MRGSEKMTPAWAQRQEELLSDCIVSPDVFNHVVDRLRDFVVPY |
| Ga0137360_116205502 | 3300012361 | Vadose Zone Soil | MTPAWAQRQEALLSDCLVSPEVFNPIVNRLGGFVVPYQHALET |
| Ga0137361_104213301 | 3300012362 | Vadose Zone Soil | MPPAWAQQQEALLRDCTVAPDVFSPILDRLVEFVVPYQQALEAEVYQYHMHLYLVGLLSH |
| Ga0137361_105181661 | 3300012362 | Vadose Zone Soil | MQGGEKMGTVWAQQREDLLSDCIVSPDVFIPMVDRLAEFAVPYQHVLETEAGQRNGYL* |
| Ga0137361_107385333 | 3300012362 | Vadose Zone Soil | MTPVWAQRREELWSDCLVSPDVFNEMVDRLGAFVMPYQQALETEADPHAMHLYLQGL |
| Ga0137361_107963023 | 3300012362 | Vadose Zone Soil | MSFQGGEKMNNVWAQRREALWRDGIGSPAVFTSMVERLGDFVVPYPRALETEASQR |
| Ga0137361_108933182 | 3300012362 | Vadose Zone Soil | MALTWAQRREALLSDCIVSPDVFNPMIDRLAEFVVPYQQALETEVAQRNMHL* |
| Ga0137361_109975411 | 3300012362 | Vadose Zone Soil | MTPAWAQRREEMLSDCIVSPDVFNQMVDRLDEFVVPYQQALVTEADQHPMHLYLQG |
| Ga0137361_114039562 | 3300012362 | Vadose Zone Soil | MTPAWAQRKKELLSDCIVSPDVFNSMVDRLGDFVVPYQQALEAEAGQRHVHRYL |
| Ga0137361_117377291 | 3300012362 | Vadose Zone Soil | MTPVWALRHEELLNDCIVSPDVFNPMVDRLRDFVVPYVRRDS* |
| Ga0137390_100625086 | 3300012363 | Vadose Zone Soil | MRTVWAQRREEVLSDCLVSPDVFSQMVERLGEFVVPYQ |
| Ga0137390_102418984 | 3300012363 | Vadose Zone Soil | MTPAWALRQEELLSDCIVSPDVFNHMVDRLCDFVVRVPPRIV* |
| Ga0137390_103689644 | 3300012363 | Vadose Zone Soil | MTPAWAQRQAELLSDCIVSPDVFQHMVDRLSDFAVPY |
| Ga0137390_104124641 | 3300012363 | Vadose Zone Soil | MALTWAQRREALLSDCIVSPDVFNPMIDRLAAFVVPYQQALETEAAQRNLHRYLQG |
| Ga0134041_12581941 | 3300012405 | Grasslands Soil | MPLGGGEKMTPTWAQRREALVRDCIVSPDVFTSMVERLGDFVVPYQHA |
| Ga0157342_10771691 | 3300012507 | Arabidopsis Rhizosphere | MPPAWAQGHAALLRDWSVSPNVFHQMVDRLRDGVAPSQRALKPEAGQRHVS |
| Ga0157326_10843861 | 3300012513 | Arabidopsis Rhizosphere | MYGGEKMHTVWAQRREEVLSDCLVSPDVFTQMVERLGEFVVPYQHALETEASG |
| Ga0137397_110613152 | 3300012685 | Vadose Zone Soil | MTPAWALRQEELLSDCIVSPDVFTPMMDRLNDFVVPYQHALEAEAGG |
| Ga0137397_112314421 | 3300012685 | Vadose Zone Soil | MPPAWAQRREEWLSDCIVSPDVFHPMVDRLGEFVVPSHPALATEASQRNVHLSLQGLLSH |
| Ga0137395_110271551 | 3300012917 | Vadose Zone Soil | MTLAWAQRQAELLRDCIVSPGVFASMVDRLCDFVVSYHQALESE |
| Ga0137396_100139824 | 3300012918 | Vadose Zone Soil | MRFCGGEKMTPTWAQRQEALLRDCIVSPDIFNHMVDRLREFVVPYQHALDRIGIFIFAV* |
| Ga0137396_108873162 | 3300012918 | Vadose Zone Soil | MHTVWAQRREELLSDCLVSPDVFTQMVDRLDEFVVPYQQ |
| Ga0137394_104524581 | 3300012922 | Vadose Zone Soil | RREELLSDCIVSPDVFQQMVDRLGAFVVPYQHALETQADGFHLV* |
| Ga0137394_109617901 | 3300012922 | Vadose Zone Soil | MTPAWAQRHEELLNDCIVYPDVFNPMVDRLRAFVVPYQQALKTKAGRRNVP |
| Ga0137419_103346352 | 3300012925 | Vadose Zone Soil | MTPAWAQRQEELLRDCIVSPDVFTHMMDRLGDFVVPYQHALETEAG |
| Ga0137416_107848701 | 3300012927 | Vadose Zone Soil | MALTWAQRREALLSDCIVSPDVFNPMIDRLAEFVVPYQQALETEVAQRNMHL |
| Ga0137404_101097203 | 3300012929 | Vadose Zone Soil | MMTPAWAQRQEELLSDCVVSPNVFHHMMDRLSEFVAPYQRALKTEAGQRNMHLY |
| Ga0137404_101279083 | 3300012929 | Vadose Zone Soil | MTPAWAKRQEALLRDCPVFPDVCASIVDRLGDFVVPYVR |
| Ga0137407_117435921 | 3300012930 | Vadose Zone Soil | MAISGGEKMTPAWAQRQEELRSDCIVSPDVFNLMVDRLGDFVVPYQHAL |
| Ga0137410_104461883 | 3300012944 | Vadose Zone Soil | MTPAWAQRQEALLRDCIVSPDVFNSMVDHLCDFVVP |
| Ga0137410_109835032 | 3300012944 | Vadose Zone Soil | MTPAWAQRQEELLRDCIVSPDVFNHRVDRLSEFVVPSQHALETEAGQRNVRLYL* |
| Ga0137410_112291101 | 3300012944 | Vadose Zone Soil | MQGGEKMGTVWAQRREEVLNDCIVSPDVFTPLIDHLGE |
| Ga0137410_116381422 | 3300012944 | Vadose Zone Soil | MSTLWARRREELLHDCFVCPDVFHQMADRLAGFVVPY |
| Ga0137410_117666432 | 3300012944 | Vadose Zone Soil | MTPAWAQRQEELLRDCIVSPDVFNHTVDRLCDFVVPYQHALVDLLT* |
| Ga0126375_101215893 | 3300012948 | Tropical Forest Soil | MMTPAWAQRDEELLRDCIVSPDVFNSMVDRLGDFIVPYQQALETAAAQRNVHLYL |
| Ga0126375_101320962 | 3300012948 | Tropical Forest Soil | MHTVWAQRREEVLSDCLISPDVFTQMVERLGEFVVPYQHALETEA |
| Ga0126375_104329481 | 3300012948 | Tropical Forest Soil | MTPAWTLRQEELLRDCIVCPDVFNSMVDRLCAFVVPYQHALETEA |
| Ga0126375_105622242 | 3300012948 | Tropical Forest Soil | MTPTWAQRREELLSDCLVSPDVFMQMVERLGGFVVPYQQAL |
| Ga0126375_107639852 | 3300012948 | Tropical Forest Soil | MTPVWAQRREELWSDCLVSPDVFHEMVERLGAFVMPYQQALE |
| Ga0126375_110202303 | 3300012948 | Tropical Forest Soil | MTPAWAQRQEALLRDCIVSPDVFDHMVERLRDFAVPYQHAL |
| Ga0126375_110536741 | 3300012948 | Tropical Forest Soil | MIPAWAQRQEELLRGCLVSPNVFGPMVDRLVKFVVPCQQAIEA |
| Ga0126375_112935601 | 3300012948 | Tropical Forest Soil | MGTVWARRREDLLSDCLVPPDVFIPMVDCLAEFVVPYQHVLETEAGQ |
| Ga0126375_115703002 | 3300012948 | Tropical Forest Soil | MTLTWAQRQAALLRDCLVSPDVFSSMVDRLGEFVVPYQQALEAEA |
| Ga0126375_117459532 | 3300012948 | Tropical Forest Soil | MGTVWARRREDLLSDCLVPPDVFIPMVDRLAEFVVPYQHVLETETG* |
| Ga0126375_117935192 | 3300012948 | Tropical Forest Soil | MTPLWAQRQAELLRDCIVSPDVFESMVDRLCDFVVP |
| Ga0164301_116805431 | 3300012960 | Soil | MNPVWAQRREEVLRDCLVSPDVFHQMVERLAEFVVPYQ |
| Ga0126369_129590761 | 3300012971 | Tropical Forest Soil | MNHVWARRREEGLRDCLVSPDVFTQMVERLGEFVIPYQHALETA |
| Ga0134077_100246702 | 3300012972 | Grasslands Soil | MPVTPRQEALLRDGLVSPDVFNHMVDRLCDFVVPYQHAL |
| Ga0134087_100856972 | 3300012977 | Grasslands Soil | MALTWAQRREALLSDCIVSPDVFNPMIDCLAAFVV |
| Ga0134087_106791562 | 3300012977 | Grasslands Soil | MHTVWVQRQEELLRDCIVFPGVFESIVDRLCDFAAPYQHCLE |
| Ga0163162_126896741 | 3300013306 | Switchgrass Rhizosphere | MGTVWARRREDLLSDCLVSPDVFIPMVDRLAEFVVP |
| Ga0157375_108981702 | 3300013308 | Miscanthus Rhizosphere | MRTMWAQRREELLSDCLVSPEVFTPLIDRLGAVVVPYQHALATETDQHHM |
| Ga0137405_13818052 | 3300015053 | Vadose Zone Soil | MTSAWAQRHEALLRDCLVSPDVFSPMLDRLGEFVMPYQQVL |
| Ga0137418_105632292 | 3300015241 | Vadose Zone Soil | MALTWAQRREELLSDCIVSPDVFNPMIDRLAAFVAPYQQAMETEAARRNL |
| Ga0137418_109948923 | 3300015241 | Vadose Zone Soil | MRGGEKMTPAWALRREELLSDCFVSPDVFNPMLERLGEFVVPYQEALETEAGQRN |
| Ga0137418_113088341 | 3300015241 | Vadose Zone Soil | MTLAWAQRQAELLRDCIVSPDVFASLVDRLCDFVVPYQHALEPEAGTRHVH |
| Ga0137409_111435292 | 3300015245 | Vadose Zone Soil | MTPAWAQRQEELLSDCVVSPDVFIHIVDHLHDFVRPYQHALETEA |
| Ga0137403_102361655 | 3300015264 | Vadose Zone Soil | MPFFGGEKMTPAWAQRQAELLSDCIVSPNVFESMVDRLGAFVVPYQHALETKAGKRHMHL |
| Ga0137403_103674441 | 3300015264 | Vadose Zone Soil | MTPAWAQRQEALLNDCIVSPDVFEAIVDRLGDFVVP |
| Ga0132258_118641131 | 3300015371 | Arabidopsis Rhizosphere | MTQAWAQRQADLLRDCIVSPDVFASMVDRLYDFVVPYQHA |
| Ga0132256_1003602153 | 3300015372 | Arabidopsis Rhizosphere | MNPVWAQRRKEVLSDCLVSPDVFTQMVERLGEFVIPYQHA |
| Ga0132255_1052553512 | 3300015374 | Arabidopsis Rhizosphere | MWAQRREEVVSDCLVSPDVFHRMVERLAEFVVPYQHVLETEA |
| Ga0182036_105211712 | 3300016270 | Soil | MALAWAQRREELLRDCIVSADVFSPMLDRLGEFAMPYQQALAAEVGQHHVHRYLAGLLSHLNR |
| Ga0182036_107977801 | 3300016270 | Soil | MTPAWAQRQEELMSDCVVFPDVFDHMVDRLRDFVGP |
| Ga0182041_109045261 | 3300016294 | Soil | MTPAWAQQREEMLSDCLVSPDVFTQMVERLGEFVVPYRQALETAADP |
| Ga0182041_115002542 | 3300016294 | Soil | MTPTWAQRREALLRDCIVSPDVFTSMVERLGDFMVPYQHALETEASQRNVHLY |
| Ga0182033_105453041 | 3300016319 | Soil | MALTWAQRREELLSDCIVSPDVFTPMIDRLAAFVVPYQQALETEAAQRNLHL |
| Ga0182035_117738302 | 3300016341 | Soil | MIPAWTQRREEMLSDCLVSPDGFTQMVERLGEFVVPYQQA |
| Ga0182032_116550001 | 3300016357 | Soil | MTPMWAQRRAALLRDCLVSPDVFTSMVERLGDFVVPYQHALETEASQRNVHRYL |
| Ga0182032_118855861 | 3300016357 | Soil | MHNVWAQRREEVLRDCLVSPDVFTQMVERLGEFVRPYQHAL |
| Ga0182034_106195401 | 3300016371 | Soil | MTPSWAQRREEILSDCLVPPDVVKQMVERLGEFGVPYQHALESEAGKRNIHLYLEGLL |
| Ga0182040_104814891 | 3300016387 | Soil | MALTWAQRREALLSDCIISPDVFNLMIDRLAEFVVPYQQAMETEAAQRNL |
| Ga0182040_109002581 | 3300016387 | Soil | MGTVWARRREDLLSDCLVSPDVFIPMVDRLAEFVVSYQQVLETEAGHRNV |
| Ga0182040_117850281 | 3300016387 | Soil | MALTWAQRREELLSDCIVSPDVFTPMIDRLAAFVV |
| Ga0182037_105546913 | 3300016404 | Soil | MHTVWAQRREEILNDCLVSPNILHHMVDRLAEFVVPYQHVLNRATRH |
| Ga0182037_114966741 | 3300016404 | Soil | MNTVWALRREELLSDCLVSPDVFNQMVDRLGEFVMPYQHVLKTEATQRNV |
| Ga0182039_109219482 | 3300016422 | Soil | MTPAWTQQQEALLRDCIVSPDVFDHMVERLRDFAVPYKHAFETEAGKRNV |
| Ga0182039_122208511 | 3300016422 | Soil | MALTWAQRREVLLSDCIVSPDVFTPMIDRLAAFVVPDQQA |
| Ga0182038_114430571 | 3300016445 | Soil | MTPMWARRREDMLSDCLVSPDVFTQMVKRLGVFVVPYQQALETEADQHPMHLYLQ |
| Ga0134112_101658361 | 3300017656 | Grasslands Soil | MTPVWAQRREELLSDCLVSPGVFHQMVDRLGEFVRPYQQAFETEADPHAM |
| Ga0134112_104612492 | 3300017656 | Grasslands Soil | MTPAWAQRREELLSDCIVSPDVFNPMVDHLHDFVV |
| Ga0163161_107845982 | 3300017792 | Switchgrass Rhizosphere | MMHTMWAQRQEELLRDCIVSPDVFQHMVDRLGDFVVPYQHALETEA |
| Ga0184610_11084722 | 3300017997 | Groundwater Sediment | MTPAWAQRQEELLSDCIVFPDVFNPMVDRLGDFVVPYQQA |
| Ga0184610_11284741 | 3300017997 | Groundwater Sediment | MTPAWAQRQEELLRDCIVSPDVFSPMVDRLGEFVVPYQEALEAEAGQHHVH |
| Ga0184610_12303481 | 3300017997 | Groundwater Sediment | MTPAWAQRQEVLLSDCVVFPDVFDHMVDGLRDFVVPYVRRDS |
| Ga0184621_100956763 | 3300018054 | Groundwater Sediment | MDTVWAQRREEVLRDCLVSPDIFHQMVERLDEFVVPYQHVLETTTGK |
| Ga0184623_101448441 | 3300018056 | Groundwater Sediment | MTPAWAQRREELLSDCMVSPDVFHQMVDRLGEFVVPYVRRDS |
| Ga0184619_105165661 | 3300018061 | Groundwater Sediment | MNTVWALRREELLNDCMVSPDVFNQMVDRLGEFVMPYQHVLETEAGPRNAHLSLQG |
| Ga0184637_100446551 | 3300018063 | Groundwater Sediment | MRAVWASRHEELLNDCVVSPQVFEPMVDRLCGFVVP |
| Ga0184618_101841012 | 3300018071 | Groundwater Sediment | MTPAWAQRREELLSDCIVSPDVFHQMMDRLGEFVVPYQQALETGAGQ |
| Ga0184609_103643091 | 3300018076 | Groundwater Sediment | MTPAWAQRQEELLRDCLVSPDVFDHMADRLGDFVVPYVRRDS |
| Ga0184609_103772461 | 3300018076 | Groundwater Sediment | MTPAWAQRQEELLSDCIVSPEVFNSMVGRLGDFVVPYQQALEAEAGQQHVH |
| Ga0184627_106720391 | 3300018079 | Groundwater Sediment | MTPAWAQRQEALLRDCIMSPEVFDHMVERLRDFVVPY |
| Ga0184639_101605831 | 3300018082 | Groundwater Sediment | MTPAWAQRQEELLRDCIVSPDVFNHMADRLGDFVAPYVRRDS |
| Ga0190265_116934881 | 3300018422 | Soil | RREEVVNDCLVSPDIFHHMVDRLAEFVVPYQHVLETEAG |
| Ga0066667_112884221 | 3300018433 | Grasslands Soil | MSTVWAQRREELLSDCIVSPEVFHQMLDRLPDFVVP |
| Ga0190268_105589021 | 3300018466 | Soil | MHPVWAQRREEVLSDCLVSPDVFTQMVERLAEFVVPYQHVLET |
| Ga0190268_107281942 | 3300018466 | Soil | MTPPWAQRREALLRDCIVSPDVFTSRVERLGDFVVPYQRALETEASQRNVH |
| Ga0190268_113429291 | 3300018466 | Soil | MTPAWIQRQEALLRDCIVSPDVFDYMVERLRDFVVPY |
| Ga0190268_115565291 | 3300018466 | Soil | MTPVWAQRREELGSDCLVSPDVFHEMVERLGEFVMPYQQALATEADPH |
| Ga0066662_113003361 | 3300018468 | Grasslands Soil | MNPVWAQRREEVWNDCLVSPDVFTQMVHRLRAFVGPYQHALET |
| Ga0066669_112849102 | 3300018482 | Grasslands Soil | MNPVWAQQREAVLSDCIVSPDVFTQTVNRLDEFVVPYQHVLETEASQRNVHL |
| Ga0184645_13232502 | 3300019233 | Groundwater Sediment | MSNVWAQRREELLSDCIVSPDVFNQMVDRLGAYYKRILS |
| Ga0184644_16794501 | 3300019269 | Groundwater Sediment | MHTVWALRREELLSDCLVSPDVFHQMVDRLGEFGVPYQQALETKGD |
| Ga0137408_10517421 | 3300019789 | Vadose Zone Soil | MHTVWAQRREELLSDCLVSPDVFTQMVDRLGEFVVPYQEFVPGVMVQ |
| Ga0137408_10517434 | 3300019789 | Vadose Zone Soil | MHTVWAQRREELLSDCLVSPDVFTQMVDRLGEFVVPYQEFPE |
| Ga0193739_10957361 | 3300020003 | Soil | MTPAWAQRREELLSDCMVSPDVFHQMVDRLRDFVVPYVRRDS |
| Ga0210378_102743911 | 3300021073 | Groundwater Sediment | MTPAWAQRQEELLRDCLVSPDVFDHMADRLRDFVVPYVRRDS |
| Ga0179596_101592752 | 3300021086 | Vadose Zone Soil | MNTVWAQRREELLSDCLVSPDVFNQMVDRLGEFVVPYQHALETEADQHPMHLYL |
| Ga0179596_102995722 | 3300021086 | Vadose Zone Soil | MALAWAQRREELLNDCIVSPDIFTPMIDRLAAFVLP |
| Ga0224508_108065062 | 3300022413 | Sediment | MTPAWALRKEDLLSDCIVSPEVFIPMVDRLRNFVVPDQQALEAEAGW |
| Ga0222623_100977531 | 3300022694 | Groundwater Sediment | MNTVWAQRREELLSDGIVSPDVFNQMVDRLGEFVVPSQQ |
| Ga0207684_105482703 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MRAVWASRQEELLHDCLVSPHVFTHMVDRLRDFAVPYQHCLETEADKRNSRTWKI |
| Ga0207684_107458511 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MTPAWAQRQEELLSDCIVSSDVFNHMVDRLGDFVVPYQHALETEAGQHNRKGGRG |
| Ga0207646_104028791 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MMTVWAQRREELLSDCLVSPDVFNRMVDRLGEFVVPYQQALETEAGQHP |
| Ga0207709_117101291 | 3300025935 | Miscanthus Rhizosphere | MAPVWAQRREELLSDCIVSPDVFNPMIDRLAAFVVP |
| Ga0207670_115947621 | 3300025936 | Switchgrass Rhizosphere | MHTVWAQRREEVLRDCLVSPDIFTEMVDRLDEFIVPYQYVLDTKV |
| Ga0207704_112721592 | 3300025938 | Miscanthus Rhizosphere | MMHTMWAQRQEELLRDCIVSPDVFNSMVDRLRDFVVPY |
| Ga0207665_110787561 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MTPAWARRREDLLSDCIVSPNVFIPMVARLAEFVVPYQHVLETEAGQRN |
| Ga0207665_112899052 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MTPAWAQRREALLSDCLVSPDIFHQMLDRLDEFVVPYQRALASEAVH |
| Ga0207712_105884062 | 3300025961 | Switchgrass Rhizosphere | MTPAWAQRQEELLRGCIVSPNVFGPMVDRLGKFVVPCQQA |
| Ga0207708_104089091 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MMTLAWAQRQEELLRDCIVSPDVFQHMVDRLGDFVVPYQHALETEAGKRHV |
| Ga0207675_1001282451 | 3300026118 | Switchgrass Rhizosphere | MALTWTQRREALLSDCIVSPDVFNPMIDRLAEFVVPYQQA |
| Ga0207675_1016547471 | 3300026118 | Switchgrass Rhizosphere | MTPAWAQRREALLSDCLVSPDVFHQMLDRLGAFVVPYQRALESEAVPHLMHLYLQ |
| Ga0207675_1019505481 | 3300026118 | Switchgrass Rhizosphere | MTPAWAQRQAELLRDCIVSPDVFASIVDRLGDFVVP |
| Ga0207675_1027452781 | 3300026118 | Switchgrass Rhizosphere | MTPVWAQRREELLRDCIVSPDVFTQIVDRLGEFVVPYQHVLETE |
| Ga0209236_10656403 | 3300026298 | Grasslands Soil | MTPAWAQRKEELLSDCTVSPDVFTQMVDRLRDFVVPYQHALEAKAGQHHVHFYLQ |
| Ga0209238_11482642 | 3300026301 | Grasslands Soil | MTPAWAQRQEALLRACIVFPDVFHPRVDRLRAFVVPSQQALET |
| Ga0209239_12660712 | 3300026310 | Grasslands Soil | MIPAWAQRREEMLSDCIVSPDVFHQMVDRLGEFVVPYQQALVTEA |
| Ga0209803_13145942 | 3300026332 | Soil | MTLTWAQRREELLGDCIVSPDVFNPMIDRLAAFVVPYQQALETEAAQRNMHLYLQ |
| Ga0209808_10431521 | 3300026523 | Soil | MNPVWAQRREEVLSDCIVSPDVFHRRVERLAAFVVPYQHV |
| Ga0209806_10750062 | 3300026529 | Soil | MHTGWAQRREEVLRDCLVSPDVFTQMVERLGEFVVPYQHALETEASGRHVHLYLEGAAVPSGA |
| Ga0209577_106098221 | 3300026552 | Soil | MHTVWAQRREEVLSDCIISPGVFTQMVVRLGEFVVPYQHA |
| Ga0209577_106495231 | 3300026552 | Soil | MRGGEKMTPAWAQRQEELLSDCIVSPDVFNHVVDRLRDFVVPYQLDLKVFSG |
| Ga0209844_10113302 | 3300027027 | Groundwater Sand | MTPTWAQRQEALRRDCIVSPDVFNPMVDRLRDFALPYQQALETEAQARRRDLQAARTPAD |
| Ga0209879_10055734 | 3300027056 | Groundwater Sand | MTPAWAQRQKALLRDCVVSPDVFHHMVDRLGDFVAP |
| Ga0209842_10627102 | 3300027379 | Groundwater Sand | MTPAWAQRREALLRDCLVSPDVFHQMVERLGDFVVPYQHALETEVGQRHL |
| Ga0209899_10048881 | 3300027490 | Groundwater Sand | MNTVWALRREELLSDCMVSPDVFNQMVDRLGEFVMPYQHVLETAAGQRNVHL |
| Ga0209843_10877952 | 3300027511 | Groundwater Sand | MTPVWAQRREELLSDCLVSPDVFKQMVDHLGEFVVPYQQ |
| Ga0208988_10188963 | 3300027633 | Forest Soil | MSTVWAQRREDLLSDCRVSPHVFNQMVARLAEFVVPYQQALETKAGQHPMHFYLQGL |
| Ga0214469_10588001 | 3300027636 | Soil | MNTVWAQRREALLSDCIVSPDVFNQMVDHLGEFIVPYQLALETEAVQHPMHLYLQG |
| Ga0209799_10197702 | 3300027654 | Tropical Forest Soil | WAQRQEALLRDCIVSPDVFDHMVERLRDFAVPYQHALETR |
| Ga0209388_12262711 | 3300027655 | Vadose Zone Soil | MTPAWAQRQEELLSDCVVFPDVFDHMVDGLRDFVVPYQISLSADAVEDA |
| Ga0209180_101038253 | 3300027846 | Vadose Zone Soil | MTPPWAQRREALWRDCIVSPDVFTAMVERLGDFVVPSQRA |
| Ga0209180_101188073 | 3300027846 | Vadose Zone Soil | MHTVWAQRREEVLSDCIVSPDVFNQMVDRLDEFVVPYQHV |
| Ga0209180_101416752 | 3300027846 | Vadose Zone Soil | MTPAWAQRQEELLRDCIVSPDVFDHMVDRLHDFVVPYVRRDS |
| Ga0209180_101991203 | 3300027846 | Vadose Zone Soil | TPAWAQRREELLSDCMVSPDVFQQMVDRLGAFVVPYQHALETEAGPHYMHFYLARG |
| Ga0209180_103783372 | 3300027846 | Vadose Zone Soil | MRAVWASRQEELLNDCVVSSHVFDHMVDRLCDFVVPYQH |
| Ga0209465_100643581 | 3300027874 | Tropical Forest Soil | MTPAWAQRREELLSDCLVSPDVFHQMLDRLGEFVVPYQQ |
| Ga0209465_101944291 | 3300027874 | Tropical Forest Soil | MTSAWAQRREELLSDCLVSPDVFTQMVERLGEFIVPYQQ |
| Ga0209465_103494292 | 3300027874 | Tropical Forest Soil | MTPAWAHRREELLSDCLVSPDVFHQMVDRLGEFVVPYQQAL |
| Ga0209465_105247211 | 3300027874 | Tropical Forest Soil | MTPAWAQRQEALLRDCIVSPDVFDHMVERLRDFAM |
| Ga0209283_102902121 | 3300027875 | Vadose Zone Soil | MIPAWAQRQEELLRDCLVSPDVFNPMMDRLRTFVVPYQQALDTTW |
| Ga0209283_103597541 | 3300027875 | Vadose Zone Soil | MTPAWAQRQEELLSDCIVSPDVFNPIVERLGEFVVPYVRRDS |
| Ga0209283_106107831 | 3300027875 | Vadose Zone Soil | MTPAWAQRREALLRDCIVSPDVFHQMVDRLGDFVVPYQHALETEVGQSHVQQIP |
| Ga0209283_108137531 | 3300027875 | Vadose Zone Soil | MRTVWAQRREEVLSDCLVSPDVFSQMVERLGEFVVPYQQALEAETG |
| Ga0209590_101762961 | 3300027882 | Vadose Zone Soil | MTPAWAQRQEALLRDCIVSPDVFAHMVERLRDFVVPYVRRDSSLHIAT |
| Ga0209590_102820682 | 3300027882 | Vadose Zone Soil | MRVVWAQRQAELLHDCVVSPDVFDHMVDRLHDFAQPYQQCLETE |
| Ga0209590_107237301 | 3300027882 | Vadose Zone Soil | MRAVWAQRQAELLNDCVVSPDVFDRMVDRLHDFAQPYQQCLETEAGQRNVDVY |
| Ga0209488_100996931 | 3300027903 | Vadose Zone Soil | MRTMWALRREELLSDCLVSPGVFHQMVDRLGEFVVPYQRIFPLGNEATH |
| Ga0207428_101924743 | 3300027907 | Populus Rhizosphere | MTSAWAQRHEALLRDCLVSPDVFSPMLDRLGEFVIPYQRTRPQGEE |
| Ga0207428_102027032 | 3300027907 | Populus Rhizosphere | MTPAWAQRRAELLRDCLVSPDVFQHMVERLSDFAMPYQHALGAGASQRSATDQRA |
| Ga0209382_101713281 | 3300027909 | Populus Rhizosphere | MTPAWTLRQEELLRDCIVCPDVFNSIVDRLCAFVVPYQHALETEAGKRNVHL |
| Ga0209382_114967241 | 3300027909 | Populus Rhizosphere | MTLAWAQRQEELLSDCIVSPNVFHHMMDRLGDFVAPYQ |
| Ga0209382_117089632 | 3300027909 | Populus Rhizosphere | MHPVWAQRRKEVLSDCLVSPDVFPQMVERLGTFVI |
| Ga0209853_11062892 | 3300027961 | Groundwater Sand | MTPAWALRQEALLRDCIVSPDVFNHMVDRLCDVVVPYQHALETEAGQRHV |
| Ga0268264_102589531 | 3300028381 | Switchgrass Rhizosphere | MMTLAWAQRQEELLRDCIVSPDVFQHMVDRLGDFRLPRI |
| Ga0137415_104600961 | 3300028536 | Vadose Zone Soil | MNPVWAQRREEVWSDCIVSPDVFTQMVDRLGEFVVPYQHALETEASGRHVHLYLQG |
| Ga0137415_105407351 | 3300028536 | Vadose Zone Soil | MTPAWAQRREELLSDCLVSPDVFHQMVDRLSAFVVP |
| Ga0247828_106749531 | 3300028587 | Soil | MTPAWAQRREEMLSDCLVSPDVFTQMIDRLGEFIVPYQ |
| Ga0307504_104316782 | 3300028792 | Soil | MTPTWAQRREALLRDCIVSPDVFHQMVERLGDFVVPYQQALETEVVQRHFPLYTYCVKSFFAP |
| Ga0307296_106167151 | 3300028819 | Soil | MRTVWAQRREELLNDCLVSPDVFTPLIDRLGEFVVPSQH |
| Ga0307312_102514722 | 3300028828 | Soil | MTPVWAQRREELLSDCLVSPDVFKQMVDRLGEFVVSYQQAL |
| Ga0268386_106747271 | 3300030619 | Soil | MNTAWALRREELLSDCIVSPDVFNQMVDRLGEFVMPYRQALETEAGQRNIYLQGLLR |
| Ga0302046_114282792 | 3300030620 | Soil | MNTVWARRREELLSDCIVSPDVFHQMVDRLGEFVIPYQQVLV |
| Ga0308206_10332523 | 3300030903 | Soil | MSNVWAQRREELLSDCIVSPDVFNQMVDRLGASVVPYQHALETQDDGFHLHLYLQGLLSH |
| Ga0308198_10837982 | 3300030904 | Soil | MALTWTQRREELLSDCIVSPDVFNPMIARLAEFVVPYQ |
| Ga0308204_100125612 | 3300031092 | Soil | MHTVWALRREELLSDCLVSPDVFHQMVDRLGEFEVPYQQALETKGD |
| Ga0308197_100270453 | 3300031093 | Soil | MSTVWAQRREELLSDCLVSPDVFHQMVDRLGEFGVPYQQALETKGD |
| Ga0308197_104134642 | 3300031093 | Soil | MTPTWAQRREALLRDCIVSPDVFTCMVEQLGDFVVPYQRALETEAGQHHMHLY |
| Ga0308197_104618681 | 3300031093 | Soil | MTPVWAQRQEELLRGCIVSPDVFTQMMDRLSDFVVPYQHALEAEAGGRHVHLYL |
| Ga0307497_106289621 | 3300031226 | Soil | MGTVWARRREDLLRDCLVSPDVFIPMVDRLAEFVVP |
| Ga0299914_104337331 | 3300031228 | Soil | MSTVWAQQREELLSDCIVSPDVFHQMVDRLGVFVVP |
| Ga0299914_112553171 | 3300031228 | Soil | MTPIWAQRREEWRSDGLVSPDVFHQMVDRLAEFVVPYQQALEAEAGHPMPLYLQGLLSHLQRK |
| Ga0299913_116845822 | 3300031229 | Soil | MTPAWAQRKEDLLSDCIVFPEVFISMVDRLRDFVVPYQHALEAEAGG |
| Ga0310887_103921032 | 3300031547 | Soil | MTPAWAQRREEMLSDCLVSPDVFTQMVERLGEFVVPYRQALETAADPHPF |
| Ga0310886_103488142 | 3300031562 | Soil | MTPAWAQRQAELLSDCIVSPHVFESMVDRLYDFVVPYQHALETEAGKRHMH |
| Ga0310886_104922151 | 3300031562 | Soil | MTPVWAQRQKALLNDCVVFPDVFHHMVDRLGDFVVP |
| Ga0306917_104834311 | 3300031719 | Soil | MTPTWAQRREDMLSDCLVSPDVFTQMVERLGQFVVPYQQALETKA |
| Ga0306917_106448311 | 3300031719 | Soil | MTLAWAQRQAALLRDCLVSPDVFSPMVDRLGEFVVPYQQALEAEAGQPHVQRYLAGL |
| Ga0307469_117214871 | 3300031720 | Hardwood Forest Soil | MNPVWAQRREEVLSDCIVSPDVFTQMVERLGEFVIPYQHALETEASGCHVHLYLQGIAVPSE |
| Ga0318501_105601472 | 3300031736 | Soil | MTPAWAQRREELLSDCLVSPDLFHQMVDRLAEFVVPYQQALETEAGQR |
| Ga0307468_1020300812 | 3300031740 | Hardwood Forest Soil | MNTVWARRREELLSDCLVSPDVFHQMVDRLGEFVIPYQEVLETEA |
| Ga0306918_104851611 | 3300031744 | Soil | MALAWAQRREELLRDCIVSPDVFSPMLDRLGEFAMPYQQALAAEVGQHHVHRYLAGLLSH |
| Ga0306918_108330682 | 3300031744 | Soil | MTPVWAQRREELLSDCLVSPDVFNQLIGRLAEFVVPYQQALETEA |
| Ga0306918_115435381 | 3300031744 | Soil | MTPAWAQRQEALLSDCVVFPDVFDHMVDRLRDFVVPYQ |
| Ga0318568_107667761 | 3300031819 | Soil | MTPAWAQRQEDLLSDCVVSPDVFHHMVDRLRDFVVPYQHALETEAGQRNVH |
| Ga0307473_111436961 | 3300031820 | Hardwood Forest Soil | MTPTWAQRREALLSDCLVSPDIFHQMLDRLGAFVVPYQRALASEAAHHPMQLYLQ |
| Ga0307413_109277771 | 3300031824 | Rhizosphere | MTPVWAQRREELLRDCLVSPDVFHQMVERLGECVVPYQQALETEA |
| Ga0307413_119006141 | 3300031824 | Rhizosphere | MALAWAQRREELLNDCIVSPDVFNPMIDRLAAFVVPYQQALETEAAQRNLHR |
| Ga0310904_108027381 | 3300031854 | Soil | MTPVWAQRREELRSDCLVSPDVFHEMVDRLGEFVMPYQQALELEADPHSMHLYLQGLL |
| Ga0306919_113510741 | 3300031879 | Soil | MTLAWAQRQAALLRDCLVSPDVFSPLVDRLGEFVVPYQQALEAEAGQPHVQRSLAGLLS |
| Ga0306919_114104421 | 3300031879 | Soil | MIPAWAQRREELLSDCLVSPDVFHQMIERLAEFVVPYQQALEIEAVQHPMRLYLQGLLSPLQ |
| Ga0306925_110285122 | 3300031890 | Soil | MHPVWTQRREEVLSDCLVSPDVFQQMMERLAAFVV |
| Ga0306925_120277162 | 3300031890 | Soil | MTPAWAQRRAELLRDCIVSPDVFASIVDRLCDFVVPYQHALESDAGKHHLHLYLVTNGVSLLETN |
| Ga0310900_100241825 | 3300031908 | Soil | MDPVWAQRREEVLSDCLVSPDVFTQMVERLGEFVIPYVRRDS |
| Ga0306923_107295302 | 3300031910 | Soil | MTLAWAQRREEMLSDCLVSPDVFHQMVDRLGEFVVPYQQALVTEADQHPMHLY |
| Ga0306923_117439802 | 3300031910 | Soil | MTPAWAQRQAALLRDCIVSPDVFIHMVDRLREFVVPYQQAFET |
| Ga0306923_117481171 | 3300031910 | Soil | MHTVWAQRREEVLSDCLVSPDVFHQMVERLAEFVVPYQHVLETAAGQRNVHLY |
| Ga0306921_109114241 | 3300031912 | Soil | MALAWAQRREELFNDCIVSPDIFTPMIDRLAAFVLP |
| Ga0310916_109063262 | 3300031942 | Soil | MSTVWAQRREALVSDCLVSPDVLHQMLDRLCAFVVPYQRALETETGQRNVHLS |
| Ga0310884_106994501 | 3300031944 | Soil | MTPAWAQRREALLRDCIVSPDVFTSMVERLGDFVVPYQQALDTETG |
| Ga0310910_107850741 | 3300031946 | Soil | MTPAWAQRREALLSDCLVSPDIFHQMLDRLGEFVVPYQGALASEAAHHPMHLYLQGLLSQLP |
| Ga0306922_107637802 | 3300032001 | Soil | MHTVWTQRREEILNDCLVSPDVFHQMVDRLVEFVVPYQH |
| Ga0306922_112569412 | 3300032001 | Soil | MNPVWAQRREEVLRDCLVSPDVFTQMVERLDEFVVPYQHVLETAAS |
| Ga0306922_118341371 | 3300032001 | Soil | MTPAWAQQQEALLRDCIVSPDVFDHMVERLRDFAVPYQHA |
| Ga0310897_102400061 | 3300032003 | Soil | MTLAWAQRQEALLRDCIVSPDVFDHIVERLRDFAVPYQHALETEAGKRHMHLYLVGLLSH |
| Ga0310897_104698682 | 3300032003 | Soil | MTPLWAQRQAELLRDCLVSPDVFASMVDRLCDFVVP |
| Ga0310906_100181573 | 3300032013 | Soil | MALAWAQRQEALLSDCIVSPDVFHHMVDRLGDFVAPYQHALETEAGQRNVH |
| Ga0310906_111654352 | 3300032013 | Soil | MRPVWAQRREELWSDCLVSPDVFHEMVNRLGEFVMPYQQALETEAD |
| Ga0318545_103258431 | 3300032042 | Soil | MTPAWAQRQEALWRDCGVCSDVFDHMVDRLRDCVVPY |
| Ga0318533_102711442 | 3300032059 | Soil | MALAWTQRREEVLGDCIVSPDVFNPMIDRLAAFIVPYQQALETEAAQRNMHLYPPLRKGHSRF |
| Ga0318533_105457251 | 3300032059 | Soil | MALAWAQRREELLSDCIVSPDVFNPLIDRLAAFVVPYQQAMETEAAQRNLH |
| Ga0310890_111941543 | 3300032075 | Soil | MTPAWAQRRAELLRDCLVSPDVFQHMVERLSDFAMPYQHALGAGASQRSATD |
| Ga0306924_112320401 | 3300032076 | Soil | MNHVWARRREEVLRDCLVSPDVFTQMVERLGEFVRPYQHALETEASGRHVHLYLQGLLSSLER |
| Ga0307470_101078061 | 3300032174 | Hardwood Forest Soil | MTPAWAQRQKEMLSDCLVSPDVFNQMVDRLGKFVVPY |
| Ga0307470_108476482 | 3300032174 | Hardwood Forest Soil | RREALLRDCIVSPDVFTSMVERLGDFVVPYVRRDS |
| Ga0307471_1024284921 | 3300032180 | Hardwood Forest Soil | MTPAWAQRQAELLRDCIVSPDVFMHMVDRLREFVVPYVRRDS |
| Ga0307472_1000735571 | 3300032205 | Hardwood Forest Soil | MTPAWTLRQEELLRDCIVCPDVFNSMVDRLCAFVVPYQHALETEAGKRNVHGCNRCY |
| Ga0307472_1000876733 | 3300032205 | Hardwood Forest Soil | MNTVWAQRREELLSDCLVSPDVFTQMVDRLGEFVVPYQGFPE |
| Ga0307472_1000876734 | 3300032205 | Hardwood Forest Soil | MTPAWAQRQEELLRDCIVSPDVFNHTVDRLCDFVVPYQHAL |
| Ga0307472_1001683023 | 3300032205 | Hardwood Forest Soil | MSTVWAQRREALVSDCIVFPDVFHQMVDRLGQFVVPY |
| Ga0307472_1006916061 | 3300032205 | Hardwood Forest Soil | MTPAWAQRKEELLSDCLVSPDVFTQMMDRLGDFVVPYQRAMEAEAGQHPMPLYLQ |
| Ga0307472_1024140091 | 3300032205 | Hardwood Forest Soil | MTSAWAQRHEALLRDCLVSPDVFSPMLDRLGEFVMPYQQVLAAEA |
| Ga0306920_1012600761 | 3300032261 | Soil | MTLAWAQRQAELVRDCVVSPDVFQHMVDRLSDFAVPSQHALETE |
| Ga0306920_1018563202 | 3300032261 | Soil | MTPAWAPRQEELLSDCIVSPDVFHHMVDRLRAFVVPYQHALLTEAGQ |
| Ga0306920_1020681202 | 3300032261 | Soil | MTPAWAQRREEMLSDCLVSPDVFTQMVDRLGEFVVPYQQALETAADQHSMRLYLQG |
| Ga0306920_1028071312 | 3300032261 | Soil | MGTVWARRREDLLSDCLVSPDVFIPMVDRLAEFVVPDQHVLETEA |
| Ga0306920_1035952631 | 3300032261 | Soil | MTPTWAQRREDMLSDCLVSPDVFTQMVERLGAFVVPYQQALETEADQHPM |
| Ga0318519_109584752 | 3300033290 | Soil | MALAWAQRREELLSDCIVSPDVFTPMIDRLAAFVV |
| Ga0314782_157181_138_266 | 3300034661 | Soil | MTPAWAQRQEALLSDCIVSPDVFKHMVDRLGDFVVPYVRRDS |
| Ga0314793_026034_822_950 | 3300034668 | Soil | MTPAWAQRQEALLSDFIVSPDVFKHMVDRLGDFVVPYVRRDS |
| ⦗Top⦘ |