


| Basic Information | |
|---|---|
| Family ID | F001968 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 610 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MFDELWSEIQDAPGEIFDLDIPELRDDEKFDVNEYLNANYDY |
| Number of Associated Samples | 294 |
| Number of Associated Scaffolds | 610 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 62.62 % |
| % of genes near scaffold ends (potentially truncated) | 24.10 % |
| % of genes from short scaffolds (< 2000 bps) | 73.11 % |
| Associated GOLD sequencing projects | 264 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.31 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Predicted Viral (43.607 % of family members) |
| NCBI Taxonomy ID | 10239 (predicted) |
| Taxonomy | All Organisms → Viruses → Predicted Viral |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (15.410 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.016 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (44.098 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 25.71% β-sheet: 0.00% Coil/Unstructured: 74.29% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.31 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 610 Family Scaffolds |
|---|---|---|
| PF07275 | ArdA | 3.11 |
| PF12098 | DUF3574 | 2.46 |
| PF13392 | HNH_3 | 1.48 |
| PF01541 | GIY-YIG | 0.98 |
| PF06685 | DUF1186 | 0.98 |
| PF04965 | GPW_gp25 | 0.82 |
| PF02675 | AdoMet_dc | 0.66 |
| PF14159 | CAAD | 0.49 |
| PF13385 | Laminin_G_3 | 0.49 |
| PF02672 | CP12 | 0.49 |
| PF04851 | ResIII | 0.33 |
| PF14240 | YHYH | 0.33 |
| PF03237 | Terminase_6N | 0.33 |
| PF02086 | MethyltransfD12 | 0.33 |
| PF16075 | DUF4815 | 0.33 |
| PF13640 | 2OG-FeII_Oxy_3 | 0.33 |
| PF01555 | N6_N4_Mtase | 0.16 |
| PF13759 | 2OG-FeII_Oxy_5 | 0.16 |
| PF03104 | DNA_pol_B_exo1 | 0.16 |
| PF07460 | NUMOD3 | 0.16 |
| PF09414 | RNA_ligase | 0.16 |
| PF03420 | Peptidase_S77 | 0.16 |
| PF11450 | DUF3008 | 0.16 |
| PF07230 | Portal_Gp20 | 0.16 |
| PF05869 | Dam | 0.16 |
| PF03330 | DPBB_1 | 0.16 |
| PF01327 | Pep_deformylase | 0.16 |
| PF01370 | Epimerase | 0.16 |
| PF13328 | HD_4 | 0.16 |
| COG ID | Name | Functional Category | % Frequency in 610 Family Scaffolds |
|---|---|---|---|
| COG4734 | Antirestriction protein ArdA | Defense mechanisms [V] | 3.11 |
| COG1586 | S-adenosylmethionine decarboxylase | Amino acid transport and metabolism [E] | 0.66 |
| COG0338 | DNA-adenine methylase | Replication, recombination and repair [L] | 0.33 |
| COG3392 | Adenine-specific DNA methylase | Replication, recombination and repair [L] | 0.33 |
| COG0242 | Peptide deformylase | Translation, ribosomal structure and biogenesis [J] | 0.16 |
| COG0417 | DNA polymerase B elongation subunit | Replication, recombination and repair [L] | 0.16 |
| COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 0.16 |
| COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 0.16 |
| COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 0.16 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 63.11 % |
| Unclassified | root | N/A | 36.89 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000792|BS_KBA_SWE02_21mDRAFT_10115313 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → Bristolvirus → Bristolvirus rhodeisland | 675 | Open in IMG/M |
| 3300001267|B570J13875_100175 | All Organisms → Viruses → Predicted Viral | 4422 | Open in IMG/M |
| 3300001275|B570J13894_1022724 | Not Available | 591 | Open in IMG/M |
| 3300001282|B570J14230_10034239 | All Organisms → Viruses → Predicted Viral | 1780 | Open in IMG/M |
| 3300001419|JGI11705J14877_10002817 | Not Available | 9180 | Open in IMG/M |
| 3300001419|JGI11705J14877_10058179 | All Organisms → Viruses → Predicted Viral | 1281 | Open in IMG/M |
| 3300001419|JGI11705J14877_10104806 | Not Available | 826 | Open in IMG/M |
| 3300001605|Draft_10033875 | All Organisms → Viruses → Predicted Viral | 4518 | Open in IMG/M |
| 3300001605|Draft_10357139 | Not Available | 786 | Open in IMG/M |
| 3300001838|RCM33_1012976 | All Organisms → Viruses → Predicted Viral | 1096 | Open in IMG/M |
| 3300001844|RCM35_1086596 | Not Available | 829 | Open in IMG/M |
| 3300001847|RCM41_1015340 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Bellamyvirus → unclassified Bellamyvirus → Synechococcus phage SynMITS9220M01 | 512 | Open in IMG/M |
| 3300001848|RCM47_1007977 | All Organisms → Viruses → Predicted Viral | 2877 | Open in IMG/M |
| 3300001849|RCM26_1234109 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Bellamyvirus → unclassified Bellamyvirus → Synechococcus phage SynMITS9220M01 | 675 | Open in IMG/M |
| 3300001855|JGI2160J19893_10037127 | All Organisms → Viruses → Predicted Viral | 1030 | Open in IMG/M |
| 3300001951|GOS2249_1051841 | All Organisms → Viruses → Predicted Viral | 1267 | Open in IMG/M |
| 3300001953|GOS2231_1020412 | All Organisms → Viruses → Predicted Viral | 1822 | Open in IMG/M |
| 3300001968|GOS2236_1020526 | All Organisms → Viruses → Predicted Viral | 1593 | Open in IMG/M |
| 3300001968|GOS2236_1049453 | All Organisms → Viruses → Predicted Viral | 1514 | Open in IMG/M |
| 3300001968|GOS2236_1054367 | All Organisms → Viruses → Predicted Viral | 2901 | Open in IMG/M |
| 3300001968|GOS2236_1056479 | All Organisms → Viruses → Predicted Viral | 1797 | Open in IMG/M |
| 3300001968|GOS2236_1064416 | All Organisms → Viruses → Predicted Viral | 3433 | Open in IMG/M |
| 3300001968|GOS2236_1067512 | All Organisms → Viruses → Predicted Viral | 1104 | Open in IMG/M |
| 3300001968|GOS2236_1082195 | All Organisms → Viruses → Predicted Viral | 1628 | Open in IMG/M |
| 3300001968|GOS2236_1092757 | All Organisms → Viruses → Predicted Viral | 1451 | Open in IMG/M |
| 3300001968|GOS2236_1103345 | All Organisms → Viruses → Predicted Viral | 1572 | Open in IMG/M |
| 3300002040|GOScombined01_101786848 | All Organisms → Viruses → Predicted Viral | 1591 | Open in IMG/M |
| 3300002133|S2T7BSa_1474245 | Not Available | 605 | Open in IMG/M |
| 3300002228|S2T7FKBa104N_1693561 | All Organisms → Viruses → Predicted Viral | 1065 | Open in IMG/M |
| 3300002835|B570J40625_100000236 | All Organisms → Viruses | 87921 | Open in IMG/M |
| 3300002835|B570J40625_100001695 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 40496 | Open in IMG/M |
| 3300002835|B570J40625_100342430 | All Organisms → Viruses → Predicted Viral | 1487 | Open in IMG/M |
| 3300002835|B570J40625_101598662 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Neptunevirus → Synechococcus virus SRIM50 | 532 | Open in IMG/M |
| 3300003411|JGI25911J50253_10207345 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → Bristolvirus → Bristolvirus rhodeisland | 539 | Open in IMG/M |
| 3300003430|JGI25921J50272_10000124 | Not Available | 24487 | Open in IMG/M |
| 3300003430|JGI25921J50272_10053401 | Not Available | 913 | Open in IMG/M |
| 3300003490|JGI25926J51410_1006696 | All Organisms → Viruses → Predicted Viral | 2405 | Open in IMG/M |
| 3300003491|JGI25924J51412_1011762 | All Organisms → Viruses → Predicted Viral | 1628 | Open in IMG/M |
| 3300003497|JGI25925J51416_10029851 | All Organisms → Viruses → Predicted Viral | 1562 | Open in IMG/M |
| 3300003580|JGI26260J51721_1058564 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae | 585 | Open in IMG/M |
| 3300004097|Ga0055584_100950816 | Not Available | 899 | Open in IMG/M |
| 3300004128|Ga0066180_10370547 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → Bristolvirus → Bristolvirus rhodeisland | 567 | Open in IMG/M |
| 3300004481|Ga0069718_15695989 | All Organisms → Viruses → Predicted Viral | 1704 | Open in IMG/M |
| 3300004481|Ga0069718_16292426 | All Organisms → Viruses → Predicted Viral | 4084 | Open in IMG/M |
| 3300005512|Ga0074648_1021602 | Not Available | 3572 | Open in IMG/M |
| 3300005512|Ga0074648_1030657 | All Organisms → Viruses → Predicted Viral | 2716 | Open in IMG/M |
| 3300005525|Ga0068877_10588030 | Not Available | 606 | Open in IMG/M |
| 3300005527|Ga0068876_10006910 | Not Available | 7685 | Open in IMG/M |
| 3300005527|Ga0068876_10069031 | All Organisms → Viruses → Predicted Viral | 2132 | Open in IMG/M |
| 3300005527|Ga0068876_10156532 | All Organisms → Viruses → Predicted Viral | 1337 | Open in IMG/M |
| 3300005527|Ga0068876_10294122 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 923 | Open in IMG/M |
| 3300005527|Ga0068876_10321910 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter calcoaceticus/baumannii complex → Acinetobacter baumannii | 874 | Open in IMG/M |
| 3300005528|Ga0068872_10000333 | Not Available | 39655 | Open in IMG/M |
| 3300005581|Ga0049081_10150504 | Not Available | 852 | Open in IMG/M |
| 3300005581|Ga0049081_10253760 | Not Available | 616 | Open in IMG/M |
| 3300005582|Ga0049080_10081841 | All Organisms → Viruses → Predicted Viral | 1104 | Open in IMG/M |
| 3300005584|Ga0049082_10041564 | All Organisms → Viruses → Predicted Viral | 1610 | Open in IMG/M |
| 3300005645|Ga0077109_1137183 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Synechococcus phage S-CBM2 | 627 | Open in IMG/M |
| 3300005662|Ga0078894_10003192 | Not Available | 12452 | Open in IMG/M |
| 3300005662|Ga0078894_10286692 | All Organisms → Viruses → Predicted Viral | 1494 | Open in IMG/M |
| 3300005739|Ga0076948_1004873 | Not Available | 30809 | Open in IMG/M |
| 3300005758|Ga0078117_1033294 | All Organisms → Viruses → Predicted Viral | 4785 | Open in IMG/M |
| 3300005805|Ga0079957_1000060 | Not Available | 78856 | Open in IMG/M |
| 3300005805|Ga0079957_1009793 | Not Available | 7309 | Open in IMG/M |
| 3300005805|Ga0079957_1044375 | All Organisms → Viruses → Predicted Viral | 2781 | Open in IMG/M |
| 3300005805|Ga0079957_1045190 | All Organisms → Viruses → Predicted Viral | 2748 | Open in IMG/M |
| 3300005805|Ga0079957_1048142 | All Organisms → Viruses → Predicted Viral | 2634 | Open in IMG/M |
| 3300005805|Ga0079957_1054475 | All Organisms → Viruses → Predicted Viral | 2422 | Open in IMG/M |
| 3300005805|Ga0079957_1074146 | All Organisms → Viruses → Predicted Viral | 1952 | Open in IMG/M |
| 3300005805|Ga0079957_1081831 | All Organisms → Viruses → Predicted Viral | 1822 | Open in IMG/M |
| 3300005805|Ga0079957_1128294 | All Organisms → Viruses → Predicted Viral | 1327 | Open in IMG/M |
| 3300005805|Ga0079957_1134724 | All Organisms → Viruses → Predicted Viral | 1282 | Open in IMG/M |
| 3300005805|Ga0079957_1227554 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SCSM1 | 880 | Open in IMG/M |
| 3300005805|Ga0079957_1233174 | Not Available | 865 | Open in IMG/M |
| 3300005940|Ga0073913_10001645 | All Organisms → Viruses → Predicted Viral | 3124 | Open in IMG/M |
| 3300005941|Ga0070743_10002963 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 6321 | Open in IMG/M |
| 3300005941|Ga0070743_10067368 | All Organisms → Viruses → Predicted Viral | 1213 | Open in IMG/M |
| 3300005943|Ga0073926_10059443 | Not Available | 748 | Open in IMG/M |
| 3300006003|Ga0073912_1007197 | Not Available | 981 | Open in IMG/M |
| 3300006005|Ga0073910_1000118 | All Organisms → Viruses → Predicted Viral | 4786 | Open in IMG/M |
| 3300006005|Ga0073910_1000366 | All Organisms → Viruses → Predicted Viral | 2874 | Open in IMG/M |
| 3300006014|Ga0073919_1005923 | All Organisms → Viruses → Predicted Viral | 1117 | Open in IMG/M |
| 3300006025|Ga0075474_10056066 | All Organisms → Viruses → Predicted Viral | 1325 | Open in IMG/M |
| 3300006030|Ga0075470_10001238 | Not Available | 7988 | Open in IMG/M |
| 3300006033|Ga0075012_10635270 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Aurunvirus → Synechococcus virus STIM5 | 666 | Open in IMG/M |
| 3300006484|Ga0070744_10083828 | Not Available | 924 | Open in IMG/M |
| 3300006637|Ga0075461_10010614 | All Organisms → Viruses → Predicted Viral | 3042 | Open in IMG/M |
| 3300006639|Ga0079301_1062342 | All Organisms → Viruses → Predicted Viral | 1187 | Open in IMG/M |
| 3300006752|Ga0098048_1001581 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 9884 | Open in IMG/M |
| 3300006802|Ga0070749_10014456 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 5038 | Open in IMG/M |
| 3300006802|Ga0070749_10112682 | All Organisms → Viruses → Predicted Viral | 1602 | Open in IMG/M |
| 3300006802|Ga0070749_10404888 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Synechococcus phage S-CBM2 | 752 | Open in IMG/M |
| 3300006810|Ga0070754_10040413 | All Organisms → Viruses → Predicted Viral | 2532 | Open in IMG/M |
| 3300006810|Ga0070754_10146941 | All Organisms → Viruses → Predicted Viral | 1129 | Open in IMG/M |
| 3300006810|Ga0070754_10338707 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → Bristolvirus → Bristolvirus rhodeisland | 668 | Open in IMG/M |
| 3300006868|Ga0075481_10184982 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → Bristolvirus → Bristolvirus rhodeisland | 749 | Open in IMG/M |
| 3300006916|Ga0070750_10121558 | All Organisms → Viruses → Predicted Viral | 1197 | Open in IMG/M |
| 3300006916|Ga0070750_10276934 | All Organisms → Viruses | 722 | Open in IMG/M |
| 3300006916|Ga0070750_10378696 | Not Available | 594 | Open in IMG/M |
| 3300006916|Ga0070750_10428549 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Synechococcus phage S-CRM01 | 549 | Open in IMG/M |
| 3300006917|Ga0075472_10627777 | Not Available | 539 | Open in IMG/M |
| 3300006919|Ga0070746_10132359 | All Organisms → Viruses → Predicted Viral | 1225 | Open in IMG/M |
| 3300006919|Ga0070746_10205997 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Synechococcus phage S-CBM2 | 935 | Open in IMG/M |
| 3300007202|Ga0103274_1216571 | All Organisms → Viruses → Predicted Viral | 1149 | Open in IMG/M |
| 3300007344|Ga0070745_1026754 | All Organisms → Viruses → Predicted Viral | 2508 | Open in IMG/M |
| 3300007345|Ga0070752_1354749 | Not Available | 550 | Open in IMG/M |
| 3300007538|Ga0099851_1001560 | Not Available | 9700 | Open in IMG/M |
| 3300007538|Ga0099851_1081932 | All Organisms → Viruses → Predicted Viral | 1242 | Open in IMG/M |
| 3300007538|Ga0099851_1119206 | Not Available | 998 | Open in IMG/M |
| 3300007538|Ga0099851_1147041 | Not Available | 879 | Open in IMG/M |
| 3300007538|Ga0099851_1158013 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 841 | Open in IMG/M |
| 3300007538|Ga0099851_1206570 | Not Available | 713 | Open in IMG/M |
| 3300007538|Ga0099851_1241121 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Synechococcus phage S-CRM01 | 649 | Open in IMG/M |
| 3300007538|Ga0099851_1284426 | Not Available | 586 | Open in IMG/M |
| 3300007538|Ga0099851_1315665 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 549 | Open in IMG/M |
| 3300007538|Ga0099851_1348653 | Not Available | 517 | Open in IMG/M |
| 3300007539|Ga0099849_1050528 | All Organisms → Viruses → Predicted Viral | 1733 | Open in IMG/M |
| 3300007539|Ga0099849_1133810 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 968 | Open in IMG/M |
| 3300007539|Ga0099849_1153589 | Not Available | 889 | Open in IMG/M |
| 3300007539|Ga0099849_1219676 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Bellamyvirus → unclassified Bellamyvirus → Synechococcus phage SynMITS9220M01 | 708 | Open in IMG/M |
| 3300007539|Ga0099849_1229602 | Not Available | 689 | Open in IMG/M |
| 3300007539|Ga0099849_1295333 | Not Available | 586 | Open in IMG/M |
| 3300007541|Ga0099848_1018992 | All Organisms → Viruses → Predicted Viral | 2950 | Open in IMG/M |
| 3300007541|Ga0099848_1030770 | All Organisms → Viruses → Predicted Viral | 2238 | Open in IMG/M |
| 3300007541|Ga0099848_1043230 | All Organisms → Viruses → Predicted Viral | 1837 | Open in IMG/M |
| 3300007541|Ga0099848_1050135 | All Organisms → Viruses → Predicted Viral | 1684 | Open in IMG/M |
| 3300007541|Ga0099848_1066975 | All Organisms → Viruses → Predicted Viral | 1419 | Open in IMG/M |
| 3300007541|Ga0099848_1070821 | All Organisms → Viruses → Predicted Viral | 1372 | Open in IMG/M |
| 3300007541|Ga0099848_1071268 | All Organisms → Viruses → Predicted Viral | 1367 | Open in IMG/M |
| 3300007541|Ga0099848_1190613 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → Shandvirus → Shandvirus sh35 | 740 | Open in IMG/M |
| 3300007541|Ga0099848_1207262 | Not Available | 701 | Open in IMG/M |
| 3300007541|Ga0099848_1219014 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 676 | Open in IMG/M |
| 3300007541|Ga0099848_1256826 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Synechococcus phage S-CRM01 | 610 | Open in IMG/M |
| 3300007541|Ga0099848_1261575 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae | 602 | Open in IMG/M |
| 3300007542|Ga0099846_1050984 | All Organisms → Viruses → Predicted Viral | 1569 | Open in IMG/M |
| 3300007542|Ga0099846_1079844 | All Organisms → Viruses → Predicted Viral | 1216 | Open in IMG/M |
| 3300007542|Ga0099846_1130881 | Not Available | 911 | Open in IMG/M |
| 3300007545|Ga0102873_1002020 | Not Available | 6483 | Open in IMG/M |
| 3300007546|Ga0102874_1002153 | Not Available | 6740 | Open in IMG/M |
| 3300007550|Ga0102880_1002077 | Not Available | 5929 | Open in IMG/M |
| 3300007562|Ga0102915_1000061 | All Organisms → Viruses | 29086 | Open in IMG/M |
| 3300007640|Ga0070751_1183878 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SCSM1 | 820 | Open in IMG/M |
| 3300007653|Ga0102868_1057494 | Not Available | 857 | Open in IMG/M |
| 3300007667|Ga0102910_1011682 | All Organisms → Viruses → Predicted Viral | 1960 | Open in IMG/M |
| 3300007735|Ga0104988_11027 | All Organisms → Viruses | 213274 | Open in IMG/M |
| 3300007960|Ga0099850_1024767 | All Organisms → Viruses → Predicted Viral | 2647 | Open in IMG/M |
| 3300007960|Ga0099850_1027419 | All Organisms → Viruses → Predicted Viral | 2501 | Open in IMG/M |
| 3300007960|Ga0099850_1104883 | All Organisms → Viruses → Predicted Viral | 1164 | Open in IMG/M |
| 3300007960|Ga0099850_1106424 | All Organisms → Viruses → Predicted Viral | 1154 | Open in IMG/M |
| 3300007973|Ga0105746_1109202 | Not Available | 913 | Open in IMG/M |
| 3300007973|Ga0105746_1226996 | Not Available | 641 | Open in IMG/M |
| 3300007973|Ga0105746_1314211 | Not Available | 544 | Open in IMG/M |
| 3300007974|Ga0105747_1135513 | Not Available | 788 | Open in IMG/M |
| 3300008052|Ga0102893_1133551 | Not Available | 728 | Open in IMG/M |
| 3300008055|Ga0108970_11158965 | All Organisms → Viruses → Predicted Viral | 3496 | Open in IMG/M |
| 3300008055|Ga0108970_11167747 | All Organisms → Viruses → Predicted Viral | 1282 | Open in IMG/M |
| 3300008055|Ga0108970_11701644 | Not Available | 8613 | Open in IMG/M |
| 3300008107|Ga0114340_1000423 | Not Available | 50509 | Open in IMG/M |
| 3300008107|Ga0114340_1023398 | All Organisms → Viruses → Predicted Viral | 3909 | Open in IMG/M |
| 3300008107|Ga0114340_1041307 | All Organisms → Viruses → Predicted Viral | 2061 | Open in IMG/M |
| 3300008107|Ga0114340_1080252 | All Organisms → Viruses → Predicted Viral | 1349 | Open in IMG/M |
| 3300008107|Ga0114340_1148270 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → Shandvirus → Shandvirus sh35 | 868 | Open in IMG/M |
| 3300008107|Ga0114340_1208999 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 644 | Open in IMG/M |
| 3300008107|Ga0114340_1235698 | Not Available | 572 | Open in IMG/M |
| 3300008108|Ga0114341_10046513 | All Organisms → Viruses → Predicted Viral | 2851 | Open in IMG/M |
| 3300008108|Ga0114341_10278104 | All Organisms → Viruses → Predicted Viral | 1673 | Open in IMG/M |
| 3300008108|Ga0114341_10424690 | Not Available | 633 | Open in IMG/M |
| 3300008110|Ga0114343_1089535 | All Organisms → Viruses → Predicted Viral | 1088 | Open in IMG/M |
| 3300008110|Ga0114343_1193646 | Not Available | 596 | Open in IMG/M |
| 3300008113|Ga0114346_1290155 | Not Available | 572 | Open in IMG/M |
| 3300008116|Ga0114350_1049388 | All Organisms → Viruses → Predicted Viral | 1539 | Open in IMG/M |
| 3300008117|Ga0114351_1098846 | All Organisms → Viruses → Predicted Viral | 1705 | Open in IMG/M |
| 3300008510|Ga0110928_1207205 | Not Available | 785 | Open in IMG/M |
| 3300008996|Ga0102831_1053449 | All Organisms → Viruses → Predicted Viral | 1353 | Open in IMG/M |
| 3300008996|Ga0102831_1322547 | Not Available | 511 | Open in IMG/M |
| 3300009009|Ga0105105_10004002 | Not Available | 5867 | Open in IMG/M |
| 3300009009|Ga0105105_10018694 | All Organisms → Viruses → Predicted Viral | 2883 | Open in IMG/M |
| 3300009039|Ga0105152_10486517 | Not Available | 525 | Open in IMG/M |
| 3300009051|Ga0102864_1042814 | All Organisms → Viruses → Predicted Viral | 1221 | Open in IMG/M |
| 3300009059|Ga0102830_1082181 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae | 960 | Open in IMG/M |
| 3300009081|Ga0105098_10038963 | All Organisms → Viruses → Predicted Viral | 1898 | Open in IMG/M |
| 3300009081|Ga0105098_10057806 | All Organisms → Viruses → Predicted Viral | 1596 | Open in IMG/M |
| 3300009124|Ga0118687_10122452 | All Organisms → cellular organisms → Bacteria | 914 | Open in IMG/M |
| 3300009124|Ga0118687_10422923 | Not Available | 517 | Open in IMG/M |
| 3300009149|Ga0114918_10260914 | Not Available | 981 | Open in IMG/M |
| 3300009152|Ga0114980_10023557 | All Organisms → Viruses → Predicted Viral | 3832 | Open in IMG/M |
| 3300009152|Ga0114980_10060068 | All Organisms → Viruses → Predicted Viral | 2295 | Open in IMG/M |
| 3300009152|Ga0114980_10644365 | Not Available | 596 | Open in IMG/M |
| 3300009152|Ga0114980_10762062 | Not Available | 540 | Open in IMG/M |
| 3300009159|Ga0114978_10005114 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 10525 | Open in IMG/M |
| 3300009159|Ga0114978_10103430 | All Organisms → Viruses → Predicted Viral | 1879 | Open in IMG/M |
| 3300009159|Ga0114978_10152763 | All Organisms → Viruses → Predicted Viral | 1486 | Open in IMG/M |
| 3300009159|Ga0114978_10308072 | Not Available | 968 | Open in IMG/M |
| 3300009159|Ga0114978_10564733 | Not Available | 661 | Open in IMG/M |
| 3300009168|Ga0105104_10744320 | Not Available | 566 | Open in IMG/M |
| 3300009169|Ga0105097_10079286 | All Organisms → Viruses → Predicted Viral | 1787 | Open in IMG/M |
| 3300009218|Ga0103848_1007983 | All Organisms → Viruses → Predicted Viral | 1846 | Open in IMG/M |
| 3300009223|Ga0103850_1012734 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae | 928 | Open in IMG/M |
| 3300009233|Ga0103856_10029165 | Not Available | 938 | Open in IMG/M |
| 3300009239|Ga0103858_10154193 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Synechococcus phage S-CBM2 | 593 | Open in IMG/M |
| 3300009331|Ga0103824_105289 | Not Available | 748 | Open in IMG/M |
| 3300009450|Ga0127391_1067822 | Not Available | 688 | Open in IMG/M |
| 3300009451|Ga0127402_1006183 | All Organisms → Viruses → Predicted Viral | 3511 | Open in IMG/M |
| 3300009499|Ga0114930_10363074 | Not Available | 678 | Open in IMG/M |
| 3300009504|Ga0114946_10190392 | All Organisms → Viruses → Predicted Viral | 1112 | Open in IMG/M |
| 3300009504|Ga0114946_10228246 | Not Available | 999 | Open in IMG/M |
| 3300009504|Ga0114946_10349647 | Not Available | 772 | Open in IMG/M |
| 3300009504|Ga0114946_10406642 | Not Available | 705 | Open in IMG/M |
| 3300009504|Ga0114946_10464756 | Not Available | 650 | Open in IMG/M |
| 3300009564|Ga0130019_1049568 | Not Available | 553 | Open in IMG/M |
| 3300010149|Ga0098049_1053912 | Not Available | 1281 | Open in IMG/M |
| 3300010293|Ga0116204_1229919 | Not Available | 593 | Open in IMG/M |
| 3300010296|Ga0129348_1039507 | All Organisms → Viruses → Predicted Viral | 1713 | Open in IMG/M |
| 3300010296|Ga0129348_1072518 | All Organisms → Viruses → Predicted Viral | 1228 | Open in IMG/M |
| 3300010296|Ga0129348_1086689 | All Organisms → Viruses → Predicted Viral | 1110 | Open in IMG/M |
| 3300010296|Ga0129348_1092394 | All Organisms → Viruses → Predicted Viral | 1070 | Open in IMG/M |
| 3300010296|Ga0129348_1108655 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 974 | Open in IMG/M |
| 3300010297|Ga0129345_1090954 | All Organisms → Viruses → Predicted Viral | 1136 | Open in IMG/M |
| 3300010297|Ga0129345_1101491 | All Organisms → Viruses → Predicted Viral | 1066 | Open in IMG/M |
| 3300010297|Ga0129345_1112750 | All Organisms → Viruses → Predicted Viral | 1001 | Open in IMG/M |
| 3300010297|Ga0129345_1309246 | Not Available | 547 | Open in IMG/M |
| 3300010299|Ga0129342_1017117 | All Organisms → Viruses → Predicted Viral | 2992 | Open in IMG/M |
| 3300010299|Ga0129342_1158121 | Not Available | 822 | Open in IMG/M |
| 3300010299|Ga0129342_1189404 | Not Available | 735 | Open in IMG/M |
| 3300010299|Ga0129342_1212679 | Not Available | 683 | Open in IMG/M |
| 3300010318|Ga0136656_1082757 | All Organisms → Viruses → Predicted Viral | 1135 | Open in IMG/M |
| 3300010318|Ga0136656_1085711 | All Organisms → Viruses → Predicted Viral | 1112 | Open in IMG/M |
| 3300010318|Ga0136656_1288678 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Synechococcus phage S-CRM01 | 535 | Open in IMG/M |
| 3300010318|Ga0136656_1317939 | Not Available | 504 | Open in IMG/M |
| 3300010354|Ga0129333_10000039 | All Organisms → Viruses | 69453 | Open in IMG/M |
| 3300010354|Ga0129333_10000945 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 25694 | Open in IMG/M |
| 3300010354|Ga0129333_10001002 | All Organisms → Viruses | 24978 | Open in IMG/M |
| 3300010354|Ga0129333_10016068 | Not Available | 7114 | Open in IMG/M |
| 3300010354|Ga0129333_10023431 | Not Available | 5859 | Open in IMG/M |
| 3300010354|Ga0129333_10030753 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae | 5069 | Open in IMG/M |
| 3300010354|Ga0129333_10031841 | All Organisms → Viruses → Predicted Viral | 4980 | Open in IMG/M |
| 3300010354|Ga0129333_10034894 | All Organisms → Viruses → Predicted Viral | 4747 | Open in IMG/M |
| 3300010354|Ga0129333_10050122 | All Organisms → Viruses → Predicted Viral | 3912 | Open in IMG/M |
| 3300010354|Ga0129333_10063179 | All Organisms → Viruses → Predicted Viral | 3449 | Open in IMG/M |
| 3300010354|Ga0129333_10071193 | All Organisms → Viruses → Predicted Viral | 3231 | Open in IMG/M |
| 3300010354|Ga0129333_10088863 | All Organisms → Viruses → Predicted Viral | 2858 | Open in IMG/M |
| 3300010354|Ga0129333_10094118 | All Organisms → Viruses → Predicted Viral | 2769 | Open in IMG/M |
| 3300010354|Ga0129333_10149340 | All Organisms → Viruses → Predicted Viral | 2145 | Open in IMG/M |
| 3300010354|Ga0129333_10269333 | All Organisms → Viruses → Predicted Viral | 1531 | Open in IMG/M |
| 3300010354|Ga0129333_10355484 | All Organisms → Viruses → Predicted Viral | 1302 | Open in IMG/M |
| 3300010354|Ga0129333_10425201 | All Organisms → Viruses → Predicted Viral | 1173 | Open in IMG/M |
| 3300010354|Ga0129333_10435279 | All Organisms → Viruses → Predicted Viral | 1157 | Open in IMG/M |
| 3300010354|Ga0129333_10468142 | All Organisms → Viruses → Predicted Viral | 1108 | Open in IMG/M |
| 3300010354|Ga0129333_10511056 | All Organisms → Viruses → Predicted Viral | 1052 | Open in IMG/M |
| 3300010354|Ga0129333_10574264 | Not Available | 981 | Open in IMG/M |
| 3300010354|Ga0129333_10584641 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 971 | Open in IMG/M |
| 3300010354|Ga0129333_10657927 | Not Available | 904 | Open in IMG/M |
| 3300010354|Ga0129333_10693635 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 876 | Open in IMG/M |
| 3300010354|Ga0129333_10771903 | Not Available | 821 | Open in IMG/M |
| 3300010354|Ga0129333_10847121 | Not Available | 777 | Open in IMG/M |
| 3300010354|Ga0129333_10851571 | Not Available | 774 | Open in IMG/M |
| 3300010354|Ga0129333_10887501 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → Shandvirus → Shandvirus sh35 | 755 | Open in IMG/M |
| 3300010354|Ga0129333_10894127 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → Shandvirus → Shandvirus sh35 | 751 | Open in IMG/M |
| 3300010354|Ga0129333_10915648 | Not Available | 741 | Open in IMG/M |
| 3300010354|Ga0129333_10957654 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Bellamyvirus → unclassified Bellamyvirus → Synechococcus phage SynMITS9220M01 | 721 | Open in IMG/M |
| 3300010354|Ga0129333_11181489 | Not Available | 636 | Open in IMG/M |
| 3300010354|Ga0129333_11305836 | Not Available | 599 | Open in IMG/M |
| 3300010354|Ga0129333_11476974 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Aurunvirus → Synechococcus virus STIM5 | 557 | Open in IMG/M |
| 3300010354|Ga0129333_11522753 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 547 | Open in IMG/M |
| 3300010354|Ga0129333_11536661 | Not Available | 545 | Open in IMG/M |
| 3300010354|Ga0129333_11586553 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 534 | Open in IMG/M |
| 3300010354|Ga0129333_11617757 | Not Available | 528 | Open in IMG/M |
| 3300010354|Ga0129333_11662919 | Not Available | 520 | Open in IMG/M |
| 3300010354|Ga0129333_11689380 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum → Candidatus Puniceispirillum marinum IMCC1322 | 515 | Open in IMG/M |
| 3300010354|Ga0129333_11762244 | Not Available | 502 | Open in IMG/M |
| 3300010368|Ga0129324_10420109 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae | 515 | Open in IMG/M |
| 3300010370|Ga0129336_10007323 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae | 6813 | Open in IMG/M |
| 3300010370|Ga0129336_10377241 | Not Available | 777 | Open in IMG/M |
| 3300010370|Ga0129336_10728765 | Not Available | 524 | Open in IMG/M |
| 3300010370|Ga0129336_10767268 | Not Available | 509 | Open in IMG/M |
| 3300010389|Ga0136549_10000402 | Not Available | 31515 | Open in IMG/M |
| 3300010389|Ga0136549_10013925 | All Organisms → Viruses | 5179 | Open in IMG/M |
| 3300010389|Ga0136549_10019876 | Not Available | 4059 | Open in IMG/M |
| 3300010389|Ga0136549_10093392 | All Organisms → Viruses → Predicted Viral | 1433 | Open in IMG/M |
| 3300010389|Ga0136549_10165069 | Not Available | 985 | Open in IMG/M |
| 3300010885|Ga0133913_13408111 | All Organisms → Viruses → Predicted Viral | 1041 | Open in IMG/M |
| 3300010997|Ga0139324_1122775 | Not Available | 673 | Open in IMG/M |
| 3300011268|Ga0151620_1000166 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 25405 | Open in IMG/M |
| 3300011268|Ga0151620_1000682 | Not Available | 13133 | Open in IMG/M |
| 3300011268|Ga0151620_1001478 | Not Available | 9036 | Open in IMG/M |
| 3300011268|Ga0151620_1009939 | All Organisms → Viruses → Predicted Viral | 3427 | Open in IMG/M |
| 3300011268|Ga0151620_1013006 | All Organisms → Viruses → Predicted Viral | 2955 | Open in IMG/M |
| 3300011268|Ga0151620_1050685 | All Organisms → Viruses → Predicted Viral | 1369 | Open in IMG/M |
| 3300012000|Ga0119951_1070945 | Not Available | 911 | Open in IMG/M |
| 3300012471|Ga0129334_1077749 | Not Available | 539 | Open in IMG/M |
| 3300012963|Ga0129340_1221755 | Not Available | 842 | Open in IMG/M |
| 3300012966|Ga0129341_1102533 | Not Available | 680 | Open in IMG/M |
| 3300012966|Ga0129341_1135022 | All Organisms → Viruses → Predicted Viral | 2366 | Open in IMG/M |
| 3300012966|Ga0129341_1151665 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 588 | Open in IMG/M |
| 3300012968|Ga0129337_1040854 | Not Available | 562 | Open in IMG/M |
| 3300013004|Ga0164293_10396449 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → Haifavirus → Haifavirus tim68 | 930 | Open in IMG/M |
| 3300013004|Ga0164293_10813202 | Not Available | 592 | Open in IMG/M |
| 3300013087|Ga0163212_1020830 | All Organisms → Viruses → Predicted Viral | 2372 | Open in IMG/M |
| 3300013087|Ga0163212_1060172 | All Organisms → Viruses → Predicted Viral | 1259 | Open in IMG/M |
| 3300013087|Ga0163212_1225169 | Not Available | 584 | Open in IMG/M |
| 3300013087|Ga0163212_1242404 | Not Available | 560 | Open in IMG/M |
| 3300013087|Ga0163212_1269029 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum → Candidatus Puniceispirillum marinum IMCC1322 | 528 | Open in IMG/M |
| 3300013087|Ga0163212_1276624 | Not Available | 520 | Open in IMG/M |
| 3300013087|Ga0163212_1295871 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 500 | Open in IMG/M |
| (restricted) 3300013125|Ga0172369_10429700 | Not Available | 656 | Open in IMG/M |
| (restricted) 3300013126|Ga0172367_10032847 | All Organisms → Viruses → Predicted Viral | 4483 | Open in IMG/M |
| (restricted) 3300013126|Ga0172367_10121072 | All Organisms → Viruses → Predicted Viral | 1791 | Open in IMG/M |
| (restricted) 3300013126|Ga0172367_10357981 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium microadriaticum | 839 | Open in IMG/M |
| (restricted) 3300013127|Ga0172365_10566410 | Not Available | 652 | Open in IMG/M |
| (restricted) 3300013127|Ga0172365_10566558 | Not Available | 652 | Open in IMG/M |
| (restricted) 3300013129|Ga0172364_10952081 | Not Available | 525 | Open in IMG/M |
| (restricted) 3300013131|Ga0172373_10125139 | All Organisms → Viruses → Predicted Viral | 1878 | Open in IMG/M |
| (restricted) 3300013138|Ga0172371_10351653 | All Organisms → Viruses → Predicted Viral | 1132 | Open in IMG/M |
| 3300013941|Ga0117792_1039195 | Not Available | 515 | Open in IMG/M |
| 3300014042|Ga0117790_1040679 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → Shandvirus → Shandvirus sh35 | 861 | Open in IMG/M |
| 3300014042|Ga0117790_1063353 | Not Available | 608 | Open in IMG/M |
| 3300014042|Ga0117790_1070705 | Not Available | 558 | Open in IMG/M |
| (restricted) 3300014720|Ga0172376_10433567 | Not Available | 748 | Open in IMG/M |
| (restricted) 3300014720|Ga0172376_10518621 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium microadriaticum | 664 | Open in IMG/M |
| 3300017743|Ga0181402_1087298 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Tamkungvirus → Tamkungvirus ST4 | 813 | Open in IMG/M |
| 3300017761|Ga0181356_1074855 | All Organisms → Viruses → Predicted Viral | 1131 | Open in IMG/M |
| 3300017761|Ga0181356_1215265 | Not Available | 562 | Open in IMG/M |
| 3300017774|Ga0181358_1282040 | Not Available | 512 | Open in IMG/M |
| 3300017778|Ga0181349_1195008 | Not Available | 703 | Open in IMG/M |
| 3300017788|Ga0169931_10090167 | All Organisms → Viruses → Predicted Viral | 2997 | Open in IMG/M |
| 3300017788|Ga0169931_10290187 | All Organisms → Viruses → Predicted Viral | 1295 | Open in IMG/M |
| 3300017949|Ga0181584_10276278 | All Organisms → Viruses → Predicted Viral | 1081 | Open in IMG/M |
| 3300017952|Ga0181583_10372340 | Not Available | 894 | Open in IMG/M |
| 3300017952|Ga0181583_10426883 | Not Available | 821 | Open in IMG/M |
| 3300017956|Ga0181580_10387371 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae | 933 | Open in IMG/M |
| 3300017956|Ga0181580_10640560 | Not Available | 681 | Open in IMG/M |
| 3300017967|Ga0181590_10037418 | All Organisms → Viruses → Predicted Viral | 3902 | Open in IMG/M |
| 3300017967|Ga0181590_10310806 | All Organisms → Viruses → Predicted Viral | 1143 | Open in IMG/M |
| 3300018413|Ga0181560_10013640 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 6314 | Open in IMG/M |
| 3300018418|Ga0181567_10568837 | All Organisms → Viruses | 735 | Open in IMG/M |
| 3300018420|Ga0181563_10255732 | All Organisms → Viruses → Predicted Viral | 1042 | Open in IMG/M |
| 3300018421|Ga0181592_10530557 | Not Available | 809 | Open in IMG/M |
| 3300018558|Ga0188836_100008 | Not Available | 5058 | Open in IMG/M |
| 3300018665|Ga0188882_1013937 | Not Available | 702 | Open in IMG/M |
| 3300018682|Ga0188851_1012227 | All Organisms → Viruses → Predicted Viral | 1110 | Open in IMG/M |
| 3300018775|Ga0188848_1004657 | All Organisms → Viruses → Predicted Viral | 1549 | Open in IMG/M |
| 3300019096|Ga0188835_1005814 | All Organisms → Viruses → Predicted Viral | 1169 | Open in IMG/M |
| 3300019756|Ga0194023_1060635 | Not Available | 760 | Open in IMG/M |
| 3300019784|Ga0181359_1032673 | All Organisms → Viruses → Predicted Viral | 2011 | Open in IMG/M |
| 3300019784|Ga0181359_1034783 | All Organisms → Viruses → Predicted Viral | 1950 | Open in IMG/M |
| 3300019784|Ga0181359_1074896 | All Organisms → Viruses → Predicted Viral | 1277 | Open in IMG/M |
| 3300019784|Ga0181359_1109545 | All Organisms → Viruses → Predicted Viral | 1002 | Open in IMG/M |
| 3300020074|Ga0194113_10000251 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 67036 | Open in IMG/M |
| 3300020074|Ga0194113_10129371 | All Organisms → Viruses → Predicted Viral | 2138 | Open in IMG/M |
| 3300020074|Ga0194113_10302076 | All Organisms → Viruses → Predicted Viral | 1214 | Open in IMG/M |
| 3300020074|Ga0194113_10477153 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium microadriaticum | 900 | Open in IMG/M |
| 3300020074|Ga0194113_10506160 | Not Available | 866 | Open in IMG/M |
| 3300020074|Ga0194113_10643279 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium microadriaticum | 742 | Open in IMG/M |
| 3300020074|Ga0194113_10846243 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 622 | Open in IMG/M |
| 3300020074|Ga0194113_10922505 | Not Available | 588 | Open in IMG/M |
| 3300020074|Ga0194113_11097523 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → Bristolvirus → Bristolvirus rhodeisland | 525 | Open in IMG/M |
| 3300020083|Ga0194111_10451018 | Not Available | 838 | Open in IMG/M |
| 3300020083|Ga0194111_10556421 | Not Available | 726 | Open in IMG/M |
| 3300020083|Ga0194111_10815004 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 561 | Open in IMG/M |
| 3300020141|Ga0211732_1070222 | Not Available | 6563 | Open in IMG/M |
| 3300020141|Ga0211732_1133587 | All Organisms → Viruses → Predicted Viral | 1438 | Open in IMG/M |
| 3300020151|Ga0211736_10247305 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → Bristolvirus → Bristolvirus rhodeisland | 879 | Open in IMG/M |
| 3300020151|Ga0211736_10256141 | Not Available | 7348 | Open in IMG/M |
| 3300020151|Ga0211736_10333359 | All Organisms → Viruses → Predicted Viral | 3997 | Open in IMG/M |
| 3300020151|Ga0211736_10372057 | Not Available | 12627 | Open in IMG/M |
| 3300020151|Ga0211736_10662945 | All Organisms → Viruses → Predicted Viral | 1950 | Open in IMG/M |
| 3300020151|Ga0211736_10794382 | All Organisms → Viruses → Predicted Viral | 1783 | Open in IMG/M |
| 3300020159|Ga0211734_10633107 | All Organisms → Viruses → Predicted Viral | 4525 | Open in IMG/M |
| 3300020160|Ga0211733_10335841 | Not Available | 988 | Open in IMG/M |
| 3300020161|Ga0211726_10148130 | All Organisms → Viruses → Predicted Viral | 2098 | Open in IMG/M |
| 3300020161|Ga0211726_10184368 | All Organisms → Viruses → Predicted Viral | 1790 | Open in IMG/M |
| 3300020161|Ga0211726_10246887 | Not Available | 609 | Open in IMG/M |
| 3300020172|Ga0211729_10529560 | All Organisms → Viruses → Predicted Viral | 1309 | Open in IMG/M |
| 3300020172|Ga0211729_10907970 | All Organisms → Viruses → Predicted Viral | 2772 | Open in IMG/M |
| 3300020172|Ga0211729_10989876 | All Organisms → Viruses → Predicted Viral | 1167 | Open in IMG/M |
| 3300020183|Ga0194115_10050020 | All Organisms → Viruses → Predicted Viral | 2656 | Open in IMG/M |
| 3300020183|Ga0194115_10245380 | Not Available | 850 | Open in IMG/M |
| 3300020183|Ga0194115_10325330 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 690 | Open in IMG/M |
| 3300020189|Ga0181578_10456263 | Not Available | 541 | Open in IMG/M |
| 3300020190|Ga0194118_10314460 | Not Available | 830 | Open in IMG/M |
| 3300020204|Ga0194116_10136327 | All Organisms → Viruses → Predicted Viral | 1498 | Open in IMG/M |
| 3300020205|Ga0211731_10882805 | Not Available | 921 | Open in IMG/M |
| 3300020205|Ga0211731_11748411 | All Organisms → Viruses → Predicted Viral | 4135 | Open in IMG/M |
| 3300020220|Ga0194119_10686789 | Not Available | 619 | Open in IMG/M |
| 3300020221|Ga0194127_10148087 | All Organisms → Viruses → Predicted Viral | 1690 | Open in IMG/M |
| 3300020314|Ga0211522_1033204 | Not Available | 937 | Open in IMG/M |
| 3300020438|Ga0211576_10000650 | All Organisms → Viruses | 28683 | Open in IMG/M |
| 3300020484|Ga0208049_110704 | Not Available | 672 | Open in IMG/M |
| 3300020498|Ga0208050_1000063 | All Organisms → Viruses | 28219 | Open in IMG/M |
| 3300020498|Ga0208050_1001722 | All Organisms → Viruses → Predicted Viral | 3026 | Open in IMG/M |
| 3300020516|Ga0207935_1029991 | Not Available | 669 | Open in IMG/M |
| 3300020519|Ga0208223_1002565 | All Organisms → Viruses → Predicted Viral | 3659 | Open in IMG/M |
| 3300020547|Ga0208361_1007603 | All Organisms → Viruses → Predicted Viral | 1685 | Open in IMG/M |
| 3300020558|Ga0208362_1051953 | Not Available | 649 | Open in IMG/M |
| 3300020560|Ga0208852_1076820 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Bellamyvirus → unclassified Bellamyvirus → Synechococcus phage SynMITS9220M01 | 513 | Open in IMG/M |
| 3300020574|Ga0208221_1008022 | All Organisms → Viruses → Predicted Viral | 2027 | Open in IMG/M |
| 3300021092|Ga0194122_10175471 | All Organisms → Viruses → Predicted Viral | 1139 | Open in IMG/M |
| 3300021092|Ga0194122_10585520 | Not Available | 550 | Open in IMG/M |
| 3300021323|Ga0210295_1056301 | Not Available | 711 | Open in IMG/M |
| 3300021356|Ga0213858_10038876 | All Organisms → Viruses → Predicted Viral | 2296 | Open in IMG/M |
| 3300021356|Ga0213858_10265431 | Not Available | 824 | Open in IMG/M |
| 3300021376|Ga0194130_10294432 | All Organisms → Viruses | 904 | Open in IMG/M |
| 3300021376|Ga0194130_10423474 | All Organisms → Viruses | 700 | Open in IMG/M |
| 3300021376|Ga0194130_10490330 | Not Available | 631 | Open in IMG/M |
| 3300021424|Ga0194117_10316798 | Not Available | 732 | Open in IMG/M |
| 3300021424|Ga0194117_10322828 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter calcoaceticus/baumannii complex → Acinetobacter baumannii | 723 | Open in IMG/M |
| 3300021425|Ga0213866_10035802 | All Organisms → Viruses → Predicted Viral | 2873 | Open in IMG/M |
| 3300021425|Ga0213866_10038561 | All Organisms → Viruses → Predicted Viral | 2755 | Open in IMG/M |
| 3300021425|Ga0213866_10353057 | Not Available | 726 | Open in IMG/M |
| 3300021959|Ga0222716_10269102 | All Organisms → Viruses → Predicted Viral | 1043 | Open in IMG/M |
| 3300021960|Ga0222715_10010930 | Not Available | 7239 | Open in IMG/M |
| 3300021960|Ga0222715_10247500 | All Organisms → Viruses → Predicted Viral | 1039 | Open in IMG/M |
| 3300021960|Ga0222715_10404756 | All Organisms → Viruses | 745 | Open in IMG/M |
| 3300021960|Ga0222715_10514016 | Not Available | 633 | Open in IMG/M |
| 3300021961|Ga0222714_10000454 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 47340 | Open in IMG/M |
| 3300021961|Ga0222714_10007909 | Not Available | 9621 | Open in IMG/M |
| 3300021961|Ga0222714_10015875 | Not Available | 6108 | Open in IMG/M |
| 3300021961|Ga0222714_10044881 | All Organisms → Viruses → Predicted Viral | 3122 | Open in IMG/M |
| 3300021961|Ga0222714_10088850 | All Organisms → Viruses → Predicted Viral | 1990 | Open in IMG/M |
| 3300021961|Ga0222714_10116058 | All Organisms → Viruses → Predicted Viral | 1662 | Open in IMG/M |
| 3300021961|Ga0222714_10116147 | All Organisms → Viruses → Predicted Viral | 1661 | Open in IMG/M |
| 3300021961|Ga0222714_10138599 | All Organisms → Viruses → Predicted Viral | 1476 | Open in IMG/M |
| 3300021961|Ga0222714_10171761 | All Organisms → Viruses → Predicted Viral | 1278 | Open in IMG/M |
| 3300021961|Ga0222714_10346637 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → Haifavirus → Haifavirus tim68 | 799 | Open in IMG/M |
| 3300021961|Ga0222714_10464759 | Not Available | 656 | Open in IMG/M |
| 3300021961|Ga0222714_10620831 | Not Available | 537 | Open in IMG/M |
| 3300021962|Ga0222713_10032075 | All Organisms → Viruses → Predicted Viral | 4222 | Open in IMG/M |
| 3300021962|Ga0222713_10054001 | All Organisms → Viruses → Predicted Viral | 3053 | Open in IMG/M |
| 3300021962|Ga0222713_10141266 | All Organisms → Viruses → Predicted Viral | 1673 | Open in IMG/M |
| 3300021963|Ga0222712_10000169 | Not Available | 93550 | Open in IMG/M |
| 3300021963|Ga0222712_10001886 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 25000 | Open in IMG/M |
| 3300021963|Ga0222712_10127615 | All Organisms → Viruses → Predicted Viral | 1744 | Open in IMG/M |
| 3300021963|Ga0222712_10288954 | All Organisms → Viruses → Predicted Viral | 1033 | Open in IMG/M |
| 3300021963|Ga0222712_10414601 | Not Available | 815 | Open in IMG/M |
| 3300021963|Ga0222712_10557739 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → Haifavirus → Haifavirus tim68 | 668 | Open in IMG/M |
| 3300021963|Ga0222712_10623383 | Not Available | 619 | Open in IMG/M |
| 3300021964|Ga0222719_10242008 | All Organisms → Viruses → Predicted Viral | 1205 | Open in IMG/M |
| 3300022063|Ga0212029_1062587 | Not Available | 544 | Open in IMG/M |
| 3300022069|Ga0212026_1061174 | Not Available | 571 | Open in IMG/M |
| 3300022176|Ga0212031_1013076 | All Organisms → Viruses → Predicted Viral | 1210 | Open in IMG/M |
| 3300022176|Ga0212031_1064211 | Not Available | 622 | Open in IMG/M |
| 3300022198|Ga0196905_1006548 | All Organisms → Viruses → Predicted Viral | 4046 | Open in IMG/M |
| 3300022198|Ga0196905_1013529 | All Organisms → Viruses → Predicted Viral | 2650 | Open in IMG/M |
| 3300022198|Ga0196905_1023618 | All Organisms → Viruses → Predicted Viral | 1902 | Open in IMG/M |
| 3300022198|Ga0196905_1029737 | All Organisms → Viruses → Predicted Viral | 1647 | Open in IMG/M |
| 3300022198|Ga0196905_1036269 | All Organisms → Viruses → Predicted Viral | 1457 | Open in IMG/M |
| 3300022198|Ga0196905_1041844 | All Organisms → Viruses → Predicted Viral | 1333 | Open in IMG/M |
| 3300022198|Ga0196905_1103729 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Synechococcus phage S-CBM2 | 757 | Open in IMG/M |
| 3300022198|Ga0196905_1113305 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae | 715 | Open in IMG/M |
| 3300022200|Ga0196901_1012261 | All Organisms → Viruses → Predicted Viral | 3594 | Open in IMG/M |
| 3300022200|Ga0196901_1082767 | All Organisms → Viruses → Predicted Viral | 1142 | Open in IMG/M |
| 3300022200|Ga0196901_1166961 | Not Available | 724 | Open in IMG/M |
| 3300022200|Ga0196901_1187126 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 671 | Open in IMG/M |
| 3300022200|Ga0196901_1222139 | Not Available | 597 | Open in IMG/M |
| 3300022200|Ga0196901_1242576 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → Shandvirus → Shandvirus sh35 | 562 | Open in IMG/M |
| 3300022407|Ga0181351_1006764 | All Organisms → Viruses → Predicted Viral | 4472 | Open in IMG/M |
| 3300022407|Ga0181351_1019938 | All Organisms → Viruses → Predicted Viral | 2827 | Open in IMG/M |
| 3300022909|Ga0255755_1134863 | All Organisms → Viruses → Predicted Viral | 1023 | Open in IMG/M |
| 3300022939|Ga0255754_10261757 | All Organisms → Viruses | 836 | Open in IMG/M |
| 3300023105|Ga0255782_10167029 | All Organisms → Viruses → Predicted Viral | 1114 | Open in IMG/M |
| 3300023108|Ga0255784_10158406 | All Organisms → Viruses → Predicted Viral | 1229 | Open in IMG/M |
| 3300023172|Ga0255766_10490715 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae | 568 | Open in IMG/M |
| (restricted) 3300023210|Ga0233412_10000101 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 46772 | Open in IMG/M |
| 3300024262|Ga0210003_1008206 | Not Available | 7513 | Open in IMG/M |
| 3300024262|Ga0210003_1051743 | All Organisms → Viruses → Predicted Viral | 2090 | Open in IMG/M |
| 3300024262|Ga0210003_1217387 | Not Available | 773 | Open in IMG/M |
| 3300024262|Ga0210003_1293933 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 625 | Open in IMG/M |
| 3300024343|Ga0244777_10000046 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 101906 | Open in IMG/M |
| 3300024343|Ga0244777_10663726 | Not Available | 627 | Open in IMG/M |
| 3300024346|Ga0244775_10006688 | Not Available | 11443 | Open in IMG/M |
| 3300024346|Ga0244775_10310864 | All Organisms → Viruses → Predicted Viral | 1305 | Open in IMG/M |
| 3300024346|Ga0244775_10917172 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → Bristolvirus → Bristolvirus rhodeisland | 695 | Open in IMG/M |
| 3300024348|Ga0244776_10152800 | All Organisms → Viruses → Predicted Viral | 1679 | Open in IMG/M |
| 3300024348|Ga0244776_10641815 | Not Available | 664 | Open in IMG/M |
| 3300024480|Ga0255223_1002178 | All Organisms → Viruses → Predicted Viral | 2536 | Open in IMG/M |
| 3300025070|Ga0208667_1010403 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 2141 | Open in IMG/M |
| 3300025135|Ga0209498_1074200 | All Organisms → Viruses → Predicted Viral | 1451 | Open in IMG/M |
| 3300025585|Ga0208546_1000822 | Not Available | 10455 | Open in IMG/M |
| 3300025646|Ga0208161_1000164 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 37093 | Open in IMG/M |
| 3300025646|Ga0208161_1002077 | Not Available | 10301 | Open in IMG/M |
| 3300025646|Ga0208161_1013509 | All Organisms → Viruses → Predicted Viral | 3286 | Open in IMG/M |
| 3300025646|Ga0208161_1050426 | All Organisms → Viruses → Predicted Viral | 1334 | Open in IMG/M |
| 3300025646|Ga0208161_1110832 | Not Available | 741 | Open in IMG/M |
| 3300025655|Ga0208795_1090947 | Not Available | 831 | Open in IMG/M |
| 3300025671|Ga0208898_1106904 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 837 | Open in IMG/M |
| 3300025674|Ga0208162_1008906 | All Organisms → Viruses → Predicted Viral | 4342 | Open in IMG/M |
| 3300025674|Ga0208162_1060099 | All Organisms → Viruses → Predicted Viral | 1239 | Open in IMG/M |
| 3300025687|Ga0208019_1036581 | All Organisms → Viruses → Predicted Viral | 1784 | Open in IMG/M |
| 3300025687|Ga0208019_1057791 | All Organisms → Viruses → Predicted Viral | 1314 | Open in IMG/M |
| 3300025687|Ga0208019_1080045 | All Organisms → Viruses → Predicted Viral | 1046 | Open in IMG/M |
| 3300025853|Ga0208645_1096614 | All Organisms → Viruses → Predicted Viral | 1234 | Open in IMG/M |
| 3300025889|Ga0208644_1068198 | All Organisms → Viruses → Predicted Viral | 1875 | Open in IMG/M |
| 3300026837|Ga0209856_1003867 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 702 | Open in IMG/M |
| 3300026902|Ga0209851_1003028 | All Organisms → Viruses → Predicted Viral | 1989 | Open in IMG/M |
| 3300027121|Ga0255074_1008631 | All Organisms → Viruses → Predicted Viral | 1385 | Open in IMG/M |
| 3300027123|Ga0255090_1023212 | All Organisms → Viruses → Predicted Viral | 1062 | Open in IMG/M |
| 3300027142|Ga0255065_1012372 | All Organisms → Viruses → Predicted Viral | 1756 | Open in IMG/M |
| 3300027156|Ga0255078_1106413 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Aurunvirus → Synechococcus virus STIM5 | 524 | Open in IMG/M |
| 3300027210|Ga0208802_1016582 | All Organisms → Viruses → Predicted Viral | 1009 | Open in IMG/M |
| 3300027229|Ga0208442_1002117 | All Organisms → Viruses → Predicted Viral | 4270 | Open in IMG/M |
| 3300027314|Ga0208811_1000316 | Not Available | 13438 | Open in IMG/M |
| 3300027393|Ga0209867_1000773 | Not Available | 5202 | Open in IMG/M |
| 3300027538|Ga0255085_1118828 | Not Available | 540 | Open in IMG/M |
| 3300027571|Ga0208897_1030864 | All Organisms → Viruses → Predicted Viral | 1473 | Open in IMG/M |
| 3300027597|Ga0255088_1065672 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → Bristolvirus → Bristolvirus rhodeisland | 694 | Open in IMG/M |
| 3300027659|Ga0208975_1216312 | Not Available | 506 | Open in IMG/M |
| 3300027688|Ga0209553_1047816 | All Organisms → Viruses → Predicted Viral | 1695 | Open in IMG/M |
| 3300027693|Ga0209704_1205522 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Aurunvirus → Synechococcus virus STIM5 | 574 | Open in IMG/M |
| 3300027707|Ga0209443_1092129 | All Organisms → Viruses → Predicted Viral | 1161 | Open in IMG/M |
| 3300027721|Ga0209492_1029772 | All Organisms → Viruses → Predicted Viral | 1898 | Open in IMG/M |
| 3300027756|Ga0209444_10242650 | Not Available | 631 | Open in IMG/M |
| 3300027759|Ga0209296_1001429 | Not Available | 18322 | Open in IMG/M |
| 3300027759|Ga0209296_1002670 | Not Available | 12588 | Open in IMG/M |
| 3300027762|Ga0209288_10000545 | Not Available | 11348 | Open in IMG/M |
| 3300027763|Ga0209088_10016481 | All Organisms → Viruses → Predicted Viral | 3887 | Open in IMG/M |
| 3300027763|Ga0209088_10134575 | All Organisms → Viruses → Predicted Viral | 1104 | Open in IMG/M |
| 3300027769|Ga0209770_10025626 | All Organisms → Viruses → Predicted Viral | 2580 | Open in IMG/M |
| 3300027816|Ga0209990_10213274 | Not Available | 891 | Open in IMG/M |
| 3300027899|Ga0209668_10173476 | All Organisms → Viruses → Predicted Viral | 1325 | Open in IMG/M |
| 3300027917|Ga0209536_100093163 | All Organisms → Viruses → Predicted Viral | 3845 | Open in IMG/M |
| 3300027917|Ga0209536_100153064 | All Organisms → Viruses → Predicted Viral | 2910 | Open in IMG/M |
| 3300027917|Ga0209536_100831504 | All Organisms → Viruses → Predicted Viral | 1143 | Open in IMG/M |
| 3300027917|Ga0209536_101377440 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Synechococcus phage S-CBM2 | 861 | Open in IMG/M |
| 3300027917|Ga0209536_102405170 | Not Available | 623 | Open in IMG/M |
| 3300027917|Ga0209536_102627981 | Not Available | 591 | Open in IMG/M |
| 3300027956|Ga0209820_1029186 | All Organisms → Viruses → Predicted Viral | 1430 | Open in IMG/M |
| 3300027956|Ga0209820_1073768 | Not Available | 916 | Open in IMG/M |
| 3300027972|Ga0209079_10195786 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 691 | Open in IMG/M |
| 3300028266|Ga0255227_1074515 | Not Available | 529 | Open in IMG/M |
| 3300028883|Ga0272443_10288726 | Not Available | 786 | Open in IMG/M |
| 3300029199|Ga0168647_100926 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 11119 | Open in IMG/M |
| 3300029930|Ga0119944_1000011 | Not Available | 29510 | Open in IMG/M |
| 3300029930|Ga0119944_1001689 | All Organisms → Viruses → Predicted Viral | 3886 | Open in IMG/M |
| 3300029930|Ga0119944_1001854 | All Organisms → Viruses → Predicted Viral | 3723 | Open in IMG/M |
| 3300029930|Ga0119944_1008184 | All Organisms → Viruses → Predicted Viral | 1618 | Open in IMG/M |
| 3300029930|Ga0119944_1016622 | All Organisms → Viruses → Predicted Viral | 1037 | Open in IMG/M |
| 3300029930|Ga0119944_1017135 | All Organisms → Viruses → Predicted Viral | 1016 | Open in IMG/M |
| 3300029930|Ga0119944_1020619 | Not Available | 897 | Open in IMG/M |
| 3300029930|Ga0119944_1025955 | Not Available | 774 | Open in IMG/M |
| 3300029930|Ga0119944_1029356 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → Bristolvirus → Bristolvirus rhodeisland | 714 | Open in IMG/M |
| 3300029930|Ga0119944_1043701 | All Organisms → Viruses | 549 | Open in IMG/M |
| 3300029933|Ga0119945_1008570 | All Organisms → Viruses → Predicted Viral | 1358 | Open in IMG/M |
| 3300029933|Ga0119945_1024186 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SCSM1 | 713 | Open in IMG/M |
| 3300029933|Ga0119945_1027143 | Not Available | 661 | Open in IMG/M |
| 3300029933|Ga0119945_1031554 | Not Available | 599 | Open in IMG/M |
| 3300029933|Ga0119945_1033291 | Not Available | 578 | Open in IMG/M |
| 3300031566|Ga0307378_10315286 | All Organisms → Viruses → Predicted Viral | 1471 | Open in IMG/M |
| 3300031566|Ga0307378_10623753 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 941 | Open in IMG/M |
| 3300031566|Ga0307378_10630938 | Not Available | 934 | Open in IMG/M |
| 3300031673|Ga0307377_11163205 | Not Available | 507 | Open in IMG/M |
| 3300031707|Ga0315291_10303983 | All Organisms → Viruses → Predicted Viral | 1562 | Open in IMG/M |
| 3300031707|Ga0315291_10707350 | Not Available | 893 | Open in IMG/M |
| 3300031707|Ga0315291_10944758 | Not Available | 732 | Open in IMG/M |
| 3300031746|Ga0315293_10049365 | All Organisms → Viruses → Predicted Viral | 3655 | Open in IMG/M |
| 3300031746|Ga0315293_10953219 | Not Available | 615 | Open in IMG/M |
| 3300031746|Ga0315293_11056801 | Not Available | 574 | Open in IMG/M |
| 3300031758|Ga0315907_10049460 | All Organisms → Viruses → Predicted Viral | 3705 | Open in IMG/M |
| 3300031758|Ga0315907_10426494 | All Organisms → Viruses → Predicted Viral | 1064 | Open in IMG/M |
| 3300031758|Ga0315907_11085572 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → Bristolvirus → Bristolvirus rhodeisland | 570 | Open in IMG/M |
| 3300031772|Ga0315288_10685824 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Nodensvirus → Synechococcus virus SPM2 | 969 | Open in IMG/M |
| 3300031772|Ga0315288_10849195 | Not Available | 835 | Open in IMG/M |
| 3300031784|Ga0315899_10116458 | All Organisms → Viruses → Predicted Viral | 2743 | Open in IMG/M |
| 3300031787|Ga0315900_10321223 | All Organisms → Viruses → Predicted Viral | 1269 | Open in IMG/M |
| 3300031787|Ga0315900_10400416 | All Organisms → Viruses → Predicted Viral | 1083 | Open in IMG/M |
| 3300031787|Ga0315900_10978065 | Not Available | 559 | Open in IMG/M |
| 3300031834|Ga0315290_10210174 | All Organisms → Viruses → Predicted Viral | 1693 | Open in IMG/M |
| 3300031857|Ga0315909_10969500 | Not Available | 517 | Open in IMG/M |
| 3300031873|Ga0315297_10386091 | All Organisms → Viruses → Predicted Viral | 1174 | Open in IMG/M |
| 3300031885|Ga0315285_10762056 | Not Available | 613 | Open in IMG/M |
| 3300031951|Ga0315904_10219075 | All Organisms → Viruses → Predicted Viral | 1851 | Open in IMG/M |
| 3300031951|Ga0315904_10376146 | All Organisms → Viruses → Predicted Viral | 1296 | Open in IMG/M |
| 3300031952|Ga0315294_10097039 | All Organisms → Viruses → Predicted Viral | 3055 | Open in IMG/M |
| 3300031952|Ga0315294_11490767 | Not Available | 530 | Open in IMG/M |
| 3300031963|Ga0315901_10132516 | All Organisms → Viruses → Predicted Viral | 2252 | Open in IMG/M |
| 3300031963|Ga0315901_10294196 | All Organisms → Viruses → Predicted Viral | 1349 | Open in IMG/M |
| 3300031999|Ga0315274_11377303 | Not Available | 681 | Open in IMG/M |
| 3300032018|Ga0315272_10667958 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → Bristolvirus → Bristolvirus rhodeisland | 527 | Open in IMG/M |
| 3300032050|Ga0315906_11139609 | Not Available | 572 | Open in IMG/M |
| 3300032053|Ga0315284_11312607 | Not Available | 784 | Open in IMG/M |
| 3300032093|Ga0315902_10559230 | Not Available | 974 | Open in IMG/M |
| 3300032173|Ga0315268_10067258 | All Organisms → Viruses → Predicted Viral | 3379 | Open in IMG/M |
| 3300032173|Ga0315268_10247197 | All Organisms → Viruses → Predicted Viral | 1716 | Open in IMG/M |
| 3300032173|Ga0315268_10363957 | All Organisms → Viruses → Predicted Viral | 1410 | Open in IMG/M |
| 3300033418|Ga0316625_100731213 | Not Available | 836 | Open in IMG/M |
| 3300033557|Ga0316617_101965579 | Not Available | 600 | Open in IMG/M |
| 3300033816|Ga0334980_0010862 | All Organisms → Viruses → Predicted Viral | 3967 | Open in IMG/M |
| 3300033816|Ga0334980_0029362 | All Organisms → Viruses → Predicted Viral | 2347 | Open in IMG/M |
| 3300033981|Ga0334982_0021691 | All Organisms → Viruses → Predicted Viral | 3734 | Open in IMG/M |
| 3300033981|Ga0334982_0394557 | Not Available | 630 | Open in IMG/M |
| 3300033981|Ga0334982_0503208 | Not Available | 535 | Open in IMG/M |
| 3300033994|Ga0334996_0010146 | Not Available | 6274 | Open in IMG/M |
| 3300033996|Ga0334979_0085051 | All Organisms → Viruses → Predicted Viral | 1991 | Open in IMG/M |
| 3300034012|Ga0334986_0108092 | All Organisms → Viruses → Predicted Viral | 1657 | Open in IMG/M |
| 3300034019|Ga0334998_0573746 | Not Available | 618 | Open in IMG/M |
| 3300034061|Ga0334987_0603960 | Not Available | 647 | Open in IMG/M |
| 3300034062|Ga0334995_0062291 | All Organisms → Viruses → Predicted Viral | 2979 | Open in IMG/M |
| 3300034062|Ga0334995_0452739 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 787 | Open in IMG/M |
| 3300034062|Ga0334995_0669060 | Not Available | 590 | Open in IMG/M |
| 3300034063|Ga0335000_0580664 | Not Available | 633 | Open in IMG/M |
| 3300034071|Ga0335028_0088078 | All Organisms → Viruses → Predicted Viral | 2049 | Open in IMG/M |
| 3300034073|Ga0310130_0011997 | All Organisms → Viruses → Predicted Viral | 2981 | Open in IMG/M |
| 3300034073|Ga0310130_0038939 | All Organisms → Viruses → Predicted Viral | 1443 | Open in IMG/M |
| 3300034096|Ga0335025_0659600 | Not Available | 510 | Open in IMG/M |
| 3300034102|Ga0335029_0008916 | Not Available | 7786 | Open in IMG/M |
| 3300034102|Ga0335029_0009259 | Not Available | 7630 | Open in IMG/M |
| 3300034102|Ga0335029_0011146 | Not Available | 6935 | Open in IMG/M |
| 3300034103|Ga0335030_0301474 | All Organisms → Viruses → Predicted Viral | 1073 | Open in IMG/M |
| 3300034104|Ga0335031_0243463 | All Organisms → Viruses → Predicted Viral | 1196 | Open in IMG/M |
| 3300034112|Ga0335066_0247439 | All Organisms → Viruses → Predicted Viral | 1032 | Open in IMG/M |
| 3300034272|Ga0335049_0213605 | All Organisms → Viruses → Predicted Viral | 1348 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 15.41% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 10.33% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 6.89% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 5.90% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 4.59% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 4.43% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 3.61% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 3.28% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 3.11% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 2.79% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 2.30% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 2.30% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 2.13% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 2.62% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 2.46% |
| Aquatic | Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Aquatic | 2.46% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.97% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 1.97% |
| Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Sand | 1.48% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 1.31% |
| Marine Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment | 1.15% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 1.15% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 0.98% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.98% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 0.98% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 0.82% |
| Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 0.82% |
| River Water | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water | 0.82% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 0.82% |
| Marine Methane Seep Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Methane Seep Sediment | 0.82% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.66% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.66% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.66% |
| Epidermal Mucus | Host-Associated → Fish → Skin → Epidermal Mucus → Unclassified → Epidermal Mucus | 0.66% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Sediment → Saline Water And Sediment | 0.49% |
| Estuary | Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary | 0.49% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 0.33% |
| Lake Water | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake Water | 0.33% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.33% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Epilimnion → Saline Water And Sediment | 0.33% |
| Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment | 0.33% |
| Meromictic Pond | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Meromictic Pond | 0.33% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.33% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 0.33% |
| Fracking Water | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water | 0.33% |
| Hydrocarbon Resource Environments | Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments | 0.33% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.16% |
| Anoxic Lake Water | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Lake Water | 0.16% |
| Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Lake Sediment | 0.16% |
| Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment | 0.16% |
| Watersheds | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Watersheds | 0.16% |
| Water Bodies | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Water Bodies | 0.16% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.16% |
| Meromictic Pond | Environmental → Aquatic → Freshwater → Pond → Unclassified → Meromictic Pond | 0.16% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 0.16% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine | 0.16% |
| Marine Sediment | Environmental → Aquatic → Marine → Wetlands → Sediment → Marine Sediment | 0.16% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 0.16% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 0.16% |
| Brackish Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Brackish Water | 0.16% |
| Marine | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Marine | 0.16% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000792 | Marine microbial communities from chronically polluted sediments in the Baltic Sea - site KBA sample SWE 02_21m | Environmental | Open in IMG/M |
| 3300001267 | Freshwater microbial communities from Lake Mendota, WI - 31AUG2010 deep hole epilimnion | Environmental | Open in IMG/M |
| 3300001275 | Freshwater microbial communities from Lake Mendota, WI - Practice 29OCT2010 epilimnion | Environmental | Open in IMG/M |
| 3300001282 | Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnion | Environmental | Open in IMG/M |
| 3300001419 | Saline surface water microbial communities from Etoliko Lagoon, Greece - halocline water (15 m) | Environmental | Open in IMG/M |
| 3300001605 | Tailings pond microbial communities from Northern Alberta - Syncrude Mildred Lake Settling Basin | Engineered | Open in IMG/M |
| 3300001838 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM33, ROCA_DNA217_0.2um_bLM_C_2a | Environmental | Open in IMG/M |
| 3300001844 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM35, ROCA_DNA220_0.2um_bLM_C_3a | Environmental | Open in IMG/M |
| 3300001847 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM41. ROCA_DNA251_0.2um_TAP-D_2a | Environmental | Open in IMG/M |
| 3300001848 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM47, ROCA_DNA265_0.2um_TAP-S_3a | Environmental | Open in IMG/M |
| 3300001849 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM26, ROCA_DNA190_2.0um_MCP-N_C_2b | Environmental | Open in IMG/M |
| 3300001855 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 | Environmental | Open in IMG/M |
| 3300001951 | Marine microbial communities from North Seamore Island, Equador - GS034 | Environmental | Open in IMG/M |
| 3300001953 | Marine microbial communities from Key West, Florida, USA - GS015 | Environmental | Open in IMG/M |
| 3300001968 | Marine microbial communities from Lake Gatun, Panama - GS020 | Environmental | Open in IMG/M |
| 3300002040 | GS000c - Sargasso Station 3 | Environmental | Open in IMG/M |
| 3300002133 | Marine microbial communities from the Baltic Sea, analyzing arctic terrigenous carbon compounds - S2T7BSa (116f) | Environmental | Open in IMG/M |
| 3300002228 | Marine microbial communities from the Baltic Sea - S2t7 FKBa (104N) | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003411 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD | Environmental | Open in IMG/M |
| 3300003430 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD | Environmental | Open in IMG/M |
| 3300003490 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN | Environmental | Open in IMG/M |
| 3300003491 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300003497 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN | Environmental | Open in IMG/M |
| 3300003580 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - Saanich Inlet SI074_LV_120m_DNA | Environmental | Open in IMG/M |
| 3300004097 | Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaG | Environmental | Open in IMG/M |
| 3300004128 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SN (version 2) | Environmental | Open in IMG/M |
| 3300004481 | Combined Assembly of Gp0112041, Gp0112042, Gp0112043 | Environmental | Open in IMG/M |
| 3300005512 | Saline surface water microbial communities from Etoliko Lagoon, Greece - halocline_water | Environmental | Open in IMG/M |
| 3300005525 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaG | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005528 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300005584 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF | Environmental | Open in IMG/M |
| 3300005645 | Brackish water microbial communities from Lake Sakinaw in Canada: eDNA_2 (120m) | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300005739 | Cyanobacteria communities in tropical freswater systems - freshwater lake in Singapore | Environmental | Open in IMG/M |
| 3300005758 | Cyanobacteria communities in tropical freswater systems - freshwater lake in Singapore | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300005940 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_25-Nov-14 | Environmental | Open in IMG/M |
| 3300005941 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 | Environmental | Open in IMG/M |
| 3300005943 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_4-Nov-14 | Environmental | Open in IMG/M |
| 3300006003 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_2-Sept-14 | Environmental | Open in IMG/M |
| 3300006005 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T2_25-Nov-14 | Environmental | Open in IMG/M |
| 3300006014 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T3_25-Nov-14 | Environmental | Open in IMG/M |
| 3300006025 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006030 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006033 | Freshwater microbial communities in response to fracking from Pennsylvania, USA - Allegheny Zone_MetaG_DW_15 | Environmental | Open in IMG/M |
| 3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
| 3300006637 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006639 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006868 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006917 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300007202 | Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Monthly Sampling-Site C) 9 sequencing projects | Environmental | Open in IMG/M |
| 3300007344 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 | Environmental | Open in IMG/M |
| 3300007345 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
| 3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
| 3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
| 3300007545 | Estuarine microbial communities from the Columbia River estuary - metaG 1547B-3 | Environmental | Open in IMG/M |
| 3300007546 | Estuarine microbial communities from the Columbia River estuary - metaG 1547A-02 | Environmental | Open in IMG/M |
| 3300007550 | Estuarine microbial communities from the Columbia River estuary - metaG 1549A-3 | Environmental | Open in IMG/M |
| 3300007562 | Estuarine microbial communities from the Columbia River estuary - metaG 1561A-02 | Environmental | Open in IMG/M |
| 3300007640 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 | Environmental | Open in IMG/M |
| 3300007653 | Estuarine microbial communities from the Columbia River estuary - metaG 1546C-3 | Environmental | Open in IMG/M |
| 3300007667 | Estuarine microbial communities from the Columbia River estuary - metaG 1558A-3 | Environmental | Open in IMG/M |
| 3300007735 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea ? 2014Oct | Environmental | Open in IMG/M |
| 3300007960 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG | Environmental | Open in IMG/M |
| 3300007973 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um | Environmental | Open in IMG/M |
| 3300007974 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2um | Environmental | Open in IMG/M |
| 3300008052 | Estuarine microbial communities from the Columbia River estuary - metaG 1553A-02 | Environmental | Open in IMG/M |
| 3300008055 | Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393 | Host-Associated | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008108 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA | Environmental | Open in IMG/M |
| 3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
| 3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
| 3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
| 3300008117 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008510 | Microbial Communities in Water bodies, Singapore - Site RA | Environmental | Open in IMG/M |
| 3300008996 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747 | Environmental | Open in IMG/M |
| 3300009009 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009039 | Lake sediment microbial communities from Lake Baikal, Russia to study Microbial Dark Matter (Phase II) - Lake Baikal sediment 0-5 cm | Environmental | Open in IMG/M |
| 3300009051 | Estuarine microbial communities from the Columbia River estuary - metaG 1449B-02 | Environmental | Open in IMG/M |
| 3300009059 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.703 | Environmental | Open in IMG/M |
| 3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300009124 | Marine sediment microbial communities from methane seeps within Hudson Canyon, US Atlantic Margin - Hudson Canyon PC-16 72 cmbsf | Environmental | Open in IMG/M |
| 3300009149 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG | Environmental | Open in IMG/M |
| 3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300009218 | Microbial communities of water from Amazon river, Brazil - RCM1 | Environmental | Open in IMG/M |
| 3300009223 | Microbial communities of water from Amazon river, Brazil - RCM3 | Environmental | Open in IMG/M |
| 3300009233 | Microbial communities of water from Amazon river, Brazil - RCM9 | Environmental | Open in IMG/M |
| 3300009239 | Microbial communities of water from Amazon river, Brazil - RCM11 | Environmental | Open in IMG/M |
| 3300009331 | Microbial communities of water from the North Atlantic ocean - ACM11 | Environmental | Open in IMG/M |
| 3300009450 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 4m depth; DNA IDBA-UD | Environmental | Open in IMG/M |
| 3300009451 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 8m depth; DNA IDBA-UD | Environmental | Open in IMG/M |
| 3300009499 | Deep subsurface microbial communities from Anholt, Denmark to uncover new lineages of life (NeLLi) - Anholt_01485 metaG | Environmental | Open in IMG/M |
| 3300009504 | Lake sediment microbial communities from Walker lake, Nevada to study Microbial Dark Matter (Phase II) - Walker Lake 11/02/13 Deep Sediment | Environmental | Open in IMG/M |
| 3300009564 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 6m depth; RNA IDBA-UD | Environmental | Open in IMG/M |
| 3300010149 | Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaG | Environmental | Open in IMG/M |
| 3300010293 | Anoxic lake water microbial communities from Lake Kivu, Rwanda to study Microbial Dark Matter (Phase II) - Lake Kivu water 52m metaG | Environmental | Open in IMG/M |
| 3300010296 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_DNA | Environmental | Open in IMG/M |
| 3300010297 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_DNA | Environmental | Open in IMG/M |
| 3300010299 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010318 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_DNA | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010368 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
| 3300010389 | Marine sediment microbial communities from methane seeps within Baltimore Canyon, US Atlantic Margin - Baltimore Canyon MUC-11 12-14 cmbsf | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300010997 | ECM15MPS05_Aassembled -- Sediment microbial communities from coastal marsh in Port Sulphur, LA sequencing method A (2X250bp) | Environmental | Open in IMG/M |
| 3300011268 | Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555 | Environmental | Open in IMG/M |
| 3300012000 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007A | Environmental | Open in IMG/M |
| 3300012471 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012963 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012966 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012968 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013087 | Freshwater microbial communities from Lake Malawi, Central Region, Malawi to study Microbial Dark Matter (Phase II) - Malawi_45m_30L | Environmental | Open in IMG/M |
| 3300013125 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_11.25m | Environmental | Open in IMG/M |
| 3300013126 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m | Environmental | Open in IMG/M |
| 3300013127 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 48cm | Environmental | Open in IMG/M |
| 3300013129 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 10cm | Environmental | Open in IMG/M |
| 3300013131 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10m | Environmental | Open in IMG/M |
| 3300013138 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_12m | Environmental | Open in IMG/M |
| 3300013941 | Epidermal mucus viral and microbial communities from European eel in Spain - water from Alfacada pond (Ebro delta) | Host-Associated | Open in IMG/M |
| 3300014042 | Epidermal mucus viral and microbial communities from European eel in Spain - Ebro delta (0.22 um filter) | Host-Associated | Open in IMG/M |
| 3300014720 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_35m | Environmental | Open in IMG/M |
| 3300017743 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 25 SPOT_SRF_2011-08-17 | Environmental | Open in IMG/M |
| 3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017788 | Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20L | Environmental | Open in IMG/M |
| 3300017949 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071406AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017952 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017956 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071403BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017967 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018413 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011509CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018418 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101403AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018420 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018421 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018558 | Metatranscriptome of marine microbial communities from Baltic Sea - GS676_0p8 | Environmental | Open in IMG/M |
| 3300018665 | Metatranscriptome of marine microbial communities from Baltic Sea - LD30M_ls2 | Environmental | Open in IMG/M |
| 3300018682 | Metatranscriptome of marine microbial communities from Baltic Sea - GS680_0p1 | Environmental | Open in IMG/M |
| 3300018775 | Metatranscriptome of marine microbial communities from Baltic Sea - GS679_0p8 | Environmental | Open in IMG/M |
| 3300019096 | Metatranscriptome of marine microbial communities from Baltic Sea - GS676_0p1 | Environmental | Open in IMG/M |
| 3300019756 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW6Sep16_MG | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020074 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200m | Environmental | Open in IMG/M |
| 3300020083 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015033 Kigoma Deep Cast 300m | Environmental | Open in IMG/M |
| 3300020141 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1 | Environmental | Open in IMG/M |
| 3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
| 3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
| 3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
| 3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
| 3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
| 3300020183 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015002 Mahale S4 surface | Environmental | Open in IMG/M |
| 3300020189 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071401CT metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020190 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015013 Mahale N5 surface | Environmental | Open in IMG/M |
| 3300020204 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015008 Mahale S9 surface | Environmental | Open in IMG/M |
| 3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
| 3300020220 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015018 Mahale Deep Cast 100m | Environmental | Open in IMG/M |
| 3300020221 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015036 Kigoma Deep Cast 100m | Environmental | Open in IMG/M |
| 3300020314 | Marine microbial communities from Tara Oceans - TARA_B100000035 (ERX556135-ERR598974) | Environmental | Open in IMG/M |
| 3300020438 | Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942) | Environmental | Open in IMG/M |
| 3300020484 | Freshwater microbial communities from Lake Mendota, WI - 8OCT2008 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020498 | Freshwater microbial communities from Lake Mendota, WI - 13JUN2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020516 | Freshwater microbial communities from Lake Mendota, WI - 30AUG2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020519 | Freshwater microbial communities from Lake Mendota, WI - 07OCT2009 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
| 3300020547 | Freshwater microbial communities from Lake Mendota, WI - 05AUG2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020558 | Freshwater microbial communities from Lake Mendota, WI - 13OCT2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020560 | Freshwater microbial communities from Lake Mendota, WI - 18JUN2009 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
| 3300020574 | Freshwater microbial communities from Lake Mendota, WI - 26JUN2009 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021092 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015021 Mahale Deep Cast 10m | Environmental | Open in IMG/M |
| 3300021323 | Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R9.63AS (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021356 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO245 | Environmental | Open in IMG/M |
| 3300021376 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015050 Kigoma 12 surface | Environmental | Open in IMG/M |
| 3300021424 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015009 Mahale N1 surface | Environmental | Open in IMG/M |
| 3300021425 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO284 | Environmental | Open in IMG/M |
| 3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
| 3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300021964 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34D | Environmental | Open in IMG/M |
| 3300022063 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v2) | Environmental | Open in IMG/M |
| 3300022069 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v2) | Environmental | Open in IMG/M |
| 3300022176 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v2) | Environmental | Open in IMG/M |
| 3300022198 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300022909 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaG | Environmental | Open in IMG/M |
| 3300022939 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101412BT metaG | Environmental | Open in IMG/M |
| 3300023105 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101408AT metaG | Environmental | Open in IMG/M |
| 3300023108 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101403AT metaG | Environmental | Open in IMG/M |
| 3300023172 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071403BT metaG | Environmental | Open in IMG/M |
| 3300023210 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_4_MG | Environmental | Open in IMG/M |
| 3300024262 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300024343 | Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fraction | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300024348 | 0.2um to 3um size fraction coassembly | Environmental | Open in IMG/M |
| 3300024480 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepC_0h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025070 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025135 | Lake sediment microbial communities from Walker lake, Nevada to study Microbial Dark Matter (Phase II) - Walker Lake 11/02/13 Deep Sediment (SPAdes) | Environmental | Open in IMG/M |
| 3300025585 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025646 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025655 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025671 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes) | Environmental | Open in IMG/M |
| 3300025674 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025687 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025853 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes) | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300026837 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T2_25-Nov-14 (SPAdes) | Environmental | Open in IMG/M |
| 3300026902 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_14-Oct-14 (SPAdes) | Environmental | Open in IMG/M |
| 3300027121 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepC_8h | Environmental | Open in IMG/M |
| 3300027123 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepA_8d | Environmental | Open in IMG/M |
| 3300027142 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepC_0h | Environmental | Open in IMG/M |
| 3300027156 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepA_8h | Environmental | Open in IMG/M |
| 3300027210 | Estuarine microbial communities from the Columbia River estuary - metaG 1449C-3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027229 | Estuarine microbial communities from the Columbia River estuary - metaG 1549B-3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027314 | Estuarine microbial communities from the Columbia River estuary - metaG 1561A-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027393 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_4-Nov-14 (SPAdes) | Environmental | Open in IMG/M |
| 3300027538 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepB_8d | Environmental | Open in IMG/M |
| 3300027571 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 (SPAdes) | Environmental | Open in IMG/M |
| 3300027597 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepB_8d | Environmental | Open in IMG/M |
| 3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027688 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027693 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027707 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DCMD (SPAdes) | Environmental | Open in IMG/M |
| 3300027721 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027756 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027762 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027763 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027769 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027816 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027899 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes) | Environmental | Open in IMG/M |
| 3300027917 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300027956 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027972 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300028266 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028883 | Marine sediment archaeal communities from Little Sippewissett salt marsh, Falmouth, MA, United States - SSM-Acet-12 | Environmental | Open in IMG/M |
| 3300029199 | Deep subsurface microbial communities from shale gas basins in Pennsylvania, USA - 1_Day0 | Environmental | Open in IMG/M |
| 3300029930 | Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727 | Environmental | Open in IMG/M |
| 3300029933 | Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727_2 | Environmental | Open in IMG/M |
| 3300031566 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-1 | Environmental | Open in IMG/M |
| 3300031673 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-3 | Environmental | Open in IMG/M |
| 3300031707 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20 | Environmental | Open in IMG/M |
| 3300031746 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20 | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031772 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20 | Environmental | Open in IMG/M |
| 3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031834 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031873 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0 | Environmental | Open in IMG/M |
| 3300031885 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_36 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300031952 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40 | Environmental | Open in IMG/M |
| 3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
| 3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
| 3300032018 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_middle | Environmental | Open in IMG/M |
| 3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
| 3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
| 3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
| 3300032173 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top | Environmental | Open in IMG/M |
| 3300033418 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_A | Environmental | Open in IMG/M |
| 3300033557 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_B | Environmental | Open in IMG/M |
| 3300033816 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Sep2004-rr0005 | Environmental | Open in IMG/M |
| 3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
| 3300033994 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046 | Environmental | Open in IMG/M |
| 3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
| 3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
| 3300034019 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Sep2014-rr0049 | Environmental | Open in IMG/M |
| 3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034063 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Oct2008D10-rr0053 | Environmental | Open in IMG/M |
| 3300034071 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Oct2008D10-rr0110 | Environmental | Open in IMG/M |
| 3300034073 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XL | Environmental | Open in IMG/M |
| 3300034096 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15Oct2015-rr0098 | Environmental | Open in IMG/M |
| 3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
| 3300034103 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Sep2002-rr0119 | Environmental | Open in IMG/M |
| 3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
| 3300034112 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191 | Environmental | Open in IMG/M |
| 3300034272 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2017-rr0156 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| BS_KBA_SWE02_21mDRAFT_101153132 | 3300000792 | Marine | MEDTLWTEIADMDGEIFDMEIPELKQEKFDFNEYINANYDY* |
| B570J13875_1001757 | 3300001267 | Freshwater | MFDELWQEIQDMPGEIFDLDIPELREGEKFDLNEYLNANYDY* |
| B570J13894_10227241 | 3300001275 | Freshwater | ILCLLRGKPTMFDELWSEIADSQGEIFDLDIPELRDEKFDVNEYLNANYDY* |
| B570J14230_100342395 | 3300001282 | Freshwater | MFDELWSEIQDAPGEIFDLDIPELRDTEKFDMNEYLNASYDY* |
| JGI11705J14877_1000281719 | 3300001419 | Saline Water And Sediment | MYDELWSEIVDAPGEIFDIPELQDEKDFKLDEYLKGDYDY* |
| JGI11705J14877_100581791 | 3300001419 | Saline Water And Sediment | MYDELWSEIADAPGEIFDIPELRELTDEDKFNVEAFINS |
| JGI11705J14877_101048061 | 3300001419 | Saline Water And Sediment | EVNMFDELWQEIQESEGEIFDMDIPEFDDKDDFNLNEYLSADYDY* |
| Draft_1003387511 | 3300001605 | Hydrocarbon Resource Environments | MFDELWSEIQDAPGEIFDLDIPELREDNEKFDFDGYLAADYDF* |
| Draft_103571392 | 3300001605 | Hydrocarbon Resource Environments | MFDEMWQEIQDMPGEIFDIPEMDDAEDFNLNDYLNADYDY* |
| RCM33_10129764 | 3300001838 | Marine Plankton | MFDEMWSEIQDMPGEIFDLDIPELSDEKFDINEYLNANYDY* |
| RCM35_10865963 | 3300001844 | Marine Plankton | MFDELWTEIQDAPGEIFDIPELNDEDFNWNEYLAADYDY* |
| RCM41_10153403 | 3300001847 | Marine Plankton | MYDELWSEIQDAPGEIFDIPEMNDEDFNLNEYLAADYDY* |
| RCM47_10079771 | 3300001848 | Marine Plankton | WSEIQDAPGEIFDLDIPELRDTEKFDMNEYLNANYDY* |
| RCM26_12341094 | 3300001849 | Marine Plankton | MFDELWSEIQDAPGEIFDLDIPELRDEKFDMNEYLAADYDY* |
| JGI2160J19893_100371272 | 3300001855 | Marine Sediment | MFDELWSEIQDMPGEIFDLDIPEPEEDSDKFNVNEYLNSNYDY* |
| GOS2249_10518412 | 3300001951 | Marine | MFDELWSEINDAQGEIFDIPELQELDQDRKFDVDEYLNSNYDY* |
| GOS2231_10204127 | 3300001953 | Marine | MYDELWIEIQDAPGEIFDLDIPELRDEKFDVNEYLNANYDY* |
| GOS2236_10205264 | 3300001968 | Marine | MFDELWSEIQDAPGEIFDIPELRDEEDFNLNEYLNGNIDY* |
| GOS2236_10494536 | 3300001968 | Marine | MYDELWTEIQDAPGEIFDIPELNDEEFNLNEYLAADYDY* |
| GOS2236_10543676 | 3300001968 | Marine | MFDELWSEIQDAPGEIFDLDIPELRDTEKFDMNEYLNANYDY* |
| GOS2236_10564791 | 3300001968 | Marine | PERHPMYDELWIEIQDAPGEIFDIPEMNDEDFNWNEYLAADYDY* |
| GOS2236_10644163 | 3300001968 | Marine | MYDELWIEIQDAPGEIFDLDIPELCDEKFDVNEYLNADYDY* |
| GOS2236_10675125 | 3300001968 | Marine | MFDELWSEIQDAPGEIFDLDIPELRDEKFDVNEYLNADYDY* |
| GOS2236_10821955 | 3300001968 | Marine | MFDELWSEIADAPGEIFDIPELRELDEEQKFDYNEYILSNIDY* |
| GOS2236_10927576 | 3300001968 | Marine | MYDELWIEIQDAPGEIFDLDIPELRDEKFDVNEYLNADYDY* |
| GOS2236_11033454 | 3300001968 | Marine | MFDELWSEIQDAPGEIFDIPELNDEDFNLNEYLAADYDY* |
| GOScombined01_1017868483 | 3300002040 | Marine | EIADAPGEIFDLDIPELRDLDEEQKFDYNEYILSNIDY* |
| S2T7BSa_14742452 | 3300002133 | Marine | MEDDLFSEIQDSPGEIFDIPELRDLDEDKFDVNEYLNSNYDY* |
| S2T7FKBa104N_16935613 | 3300002228 | Marine | MEDDLFSEIQDSPGEIFDIPELRDLDDEKFDVNEYLNSNYDY* |
| B570J40625_10000023664 | 3300002835 | Freshwater | MFDELWSEIQDAPGEIFDLDIPELKDEKFDVNEYLNSNYDY* |
| B570J40625_10000169536 | 3300002835 | Freshwater | MFDELWSEIQDAPGEIFDLDIPELRDEKFDVNEYLNANYDY* |
| B570J40625_1003424304 | 3300002835 | Freshwater | MFDELWIEIQDAPGEIFDIPELRDLDDEKFDVNDYINGNYDY* |
| B570J40625_1015986621 | 3300002835 | Freshwater | MFDELWTEIQDAPGEIFDLDIPELHDDEKFNMNEYLNANYDY* |
| JGI25911J50253_102073451 | 3300003411 | Freshwater Lake | MFDELWSEIADSQGEIFDLDIPELNDEKFDVNEYLNANYDY* |
| JGI25921J50272_1000012456 | 3300003430 | Freshwater Lake | MFDEMWQEIQDAPGEIFDIPEMNDEDFNLNEYLAADYDY* |
| JGI25921J50272_100534012 | 3300003430 | Freshwater Lake | MFDELWSEIQDAPGEIFDLDIPELRDEKFDVNEYLNADYDF* |
| JGI25926J51410_10066963 | 3300003490 | Freshwater Lake | MFDELWSEIADSQGEIFDLDIPELNDEKFDVNEYLNSNIDY* |
| JGI25924J51412_10117625 | 3300003491 | Freshwater Lake | MFDELWSEIADSQGEIFDLDIPELNDEKFDVNEYLNSNIDY |
| JGI25925J51416_100298513 | 3300003497 | Freshwater Lake | MYDELWSEIQDAPGEIFDIPELRELEEEKFNLNDYINGNIDY* |
| JGI26260J51721_10585642 | 3300003580 | Marine | MDDLLSEIMDSPGEIFDIPELRELEEEEKFNVENFINSNIDY* |
| Ga0055584_1009508163 | 3300004097 | Pelagic Marine | MDDLLSEIMDSPGEIFDIPELRELEEEEKFNVESFINSNIDY* |
| Ga0066180_103705472 | 3300004128 | Freshwater Lake | DELWSEIADSQGEIFDLDIPELNDEKFDVNEYLNSNIDY* |
| Ga0069718_156959895 | 3300004481 | Sediment | MYDELWSEIADAPGEIFDIPELREEEDFNLNEYLNANYDY* |
| Ga0069718_162924268 | 3300004481 | Sediment | MFDELWSEIADSQGEIFDLDIPELKDEKFDVNEYLNANYDY* |
| Ga0074648_10216029 | 3300005512 | Saline Water And Sediment | MFDELWQEIQESEGEIFDMDIPEFDDKDDFNLNEYLSADYDY* |
| Ga0074648_10306577 | 3300005512 | Saline Water And Sediment | MYDELWSEIADAPGEIFDIPELRELTDEDKFNVEAFINSDIDF* |
| Ga0068877_105880302 | 3300005525 | Freshwater Lake | MFDELWSEIQDMPGEIFDMDIPELKDEKFDVNEYLNGNYDY* |
| Ga0068876_100069109 | 3300005527 | Freshwater Lake | MFDELWSEIQDMPGEIFDMDIPELKDEKFDVNEYLNGNIDY* |
| Ga0068876_100690313 | 3300005527 | Freshwater Lake | MFDELWQEIQDAPGEIFDIPELRDEEKFDVNEYLNANYDY* |
| Ga0068876_101565324 | 3300005527 | Freshwater Lake | MFDELWSEIQDMPGEIFDLDIPELKDEESFNMNEYLNADYDY* |
| Ga0068876_102941223 | 3300005527 | Freshwater Lake | MFDEMWQEIQDMPGEIFDLDIPELKEEDFNLTDYINGEYDY* |
| Ga0068876_103219104 | 3300005527 | Freshwater Lake | MFDELWSEIQDMPGEIFDLDIPELKDEKFDVNEYLNANYDY* |
| Ga0068872_1000033388 | 3300005528 | Freshwater Lake | MFDELWSEIQDMPGEIFDLDIPELRDTEKFDVNEYLNANYDY* |
| Ga0049081_101505043 | 3300005581 | Freshwater Lentic | MFDEMWQEIQDMPGEIFDLDIPELKDEKFDVNEYLNANYDY* |
| Ga0049081_102537603 | 3300005581 | Freshwater Lentic | MFDELWSEIQDAPGEIFDLDIPELKDEKFDVNEYLNANYDY* |
| Ga0049080_100818414 | 3300005582 | Freshwater Lentic | MFDELWSEIQDMPGEIFDLDIPELENEKFDVNEYLNANYDY* |
| Ga0049082_100415642 | 3300005584 | Freshwater Lentic | MFDELWSEIQDAPGEIFDIPELRELEDEKFDVNEYLNSNIDY* |
| Ga0077109_11371832 | 3300005645 | Brackish Water | MYDELWSEIADSQGEIFDMDIPELRDEKFDVNEYLNSNIDY* |
| Ga0078894_1000319222 | 3300005662 | Freshwater Lake | MFDELWQEIQDMPGEIFDLDIPELKDDESFNMNDYLAADYDF* |
| Ga0078894_102866925 | 3300005662 | Freshwater Lake | VFDELWSEIQDAPGEIFDIPEMNDEDFNLNEYLAADYDY* |
| Ga0076948_100487322 | 3300005739 | Lake Water | MYDELWSEIQDSAGEIFDLDIPELRDTEKFDVNEYLNANYDY* |
| Ga0078117_10332948 | 3300005758 | Lake Water | MFDEMWQEIADAPGEIFDIPELNDEDFNLNDYLAADYDY* |
| Ga0079957_10000602 | 3300005805 | Lake | MFDELWQEIQDAPGEIFDLDIPELRDEEKFDVNEYLNGNYDY* |
| Ga0079957_10097933 | 3300005805 | Lake | MFDELWSEIQEAPGEIFDLDIPELRDDEKFDFNGYLAADYDY* |
| Ga0079957_10443754 | 3300005805 | Lake | MFDELWNEIQDMPGEIFDMDIPELKDEKFDVNEYLNGNIDY* |
| Ga0079957_10451905 | 3300005805 | Lake | MDFDTDILSEIEDSNGEIFDIPEFRDEEFDMNEYLNGNYDY* |
| Ga0079957_10481424 | 3300005805 | Lake | MFDAIDTDFWSEIQDAPGEIFDLPELRDEEDFNLNEYINGNIDY* |
| Ga0079957_10544755 | 3300005805 | Lake | MFEELWSEIQDAPGEIFDLDIPEIEDSEDFNLNDYLNGDYDY* |
| Ga0079957_10741464 | 3300005805 | Lake | MYDELWSEIADSQGEIFDLDIPELQDKEKFNLDEYLNGNYDY* |
| Ga0079957_10818315 | 3300005805 | Lake | PMFDELWSEIADAPGEIFDIPELRDLDEDNKFDYNEYILSNIDY* |
| Ga0079957_11282943 | 3300005805 | Lake | MFDELWQEIQDAPGEIFDIPELRDEEDFNINEYLAADYDY* |
| Ga0079957_11347241 | 3300005805 | Lake | MFDELWSEIADSQGEIFDIPEMQDTKDFDLNEYLNANYDY*Q* |
| Ga0079957_12275544 | 3300005805 | Lake | MFDELWSEIQDAPGEIFDIPEMQDSKDFNLDEYLKGDYDY* |
| Ga0079957_12331744 | 3300005805 | Lake | MYDELWSEIADAPGEIFDIPELRELDEEQKFNYNEYILSNIDY* |
| Ga0073913_100016455 | 3300005940 | Sand | MEDTLWTEIADMEGEIFDLDIPELKQEKFDFNEYINANYDY* |
| Ga0070743_1000296316 | 3300005941 | Estuarine | MFDELWSEIADAPGEIFDLPELRDLEEGKFDVNEYLNSNIDY* |
| Ga0070743_100673681 | 3300005941 | Estuarine | LWSEIQDAPGEIFDLDIPELKEEDFNLTEYINGEYDY* |
| Ga0073926_100594432 | 3300005943 | Sand | MYDELWTEIVDAPGELFDIPELREDEGFDFNEYLTADYDY* |
| Ga0073912_10071972 | 3300006003 | Sand | MFDELWSEIADAPGEIFDLPELRDLEEGKFDVNEYLNSN |
| Ga0073910_10001182 | 3300006005 | Sand | MFDELWSEIQDMPGEIFDLDIPELRDTEKFDMNEYLNASYDY* |
| Ga0073910_10003662 | 3300006005 | Sand | MFDELWSEIQDMPGEIFDLDIPELKDEKFDVNEYLNGNIDY* |
| Ga0073919_10059231 | 3300006014 | Sand | MFDELWSEIQDMPGEIFDLDIPELKDEKFDVNEYLN |
| Ga0075474_100560663 | 3300006025 | Aqueous | MFDELWSEIQDCQGEIFDLDIPELREDNKFDVEEYIKGEIDY* |
| Ga0075470_100012384 | 3300006030 | Aqueous | MFDELWTEIQDAPGEIFDIPELRELDEENKFNYNEYILGNIDY* |
| Ga0075012_106352702 | 3300006033 | Watersheds | MFDEMWQEIQDAPGEIFDLDIPELREGEKFDVNEYLNANYDY* |
| Ga0070744_100838282 | 3300006484 | Estuarine | MFDELWSEIQDAPGEIFDIPELRDLEDEKFDVNEYLNSNIDY* |
| Ga0075461_100106147 | 3300006637 | Aqueous | MFDELWSEIQDAPGEIFDIPELRELDEENKFNYNEYILGNIDY* |
| Ga0079301_10623422 | 3300006639 | Deep Subsurface | MFDELWSEIQDAPGEIFDLDIPELRDTEKFDVNEYLNANYDY* |
| Ga0098048_10015814 | 3300006752 | Marine | MDDLLSEIMDTPGEIFDIPELRELEEEEKFNVENFINSNIDY* |
| Ga0070749_1001445617 | 3300006802 | Aqueous | MFDELWSEIQDSQGEIFDLDIPELKDEKFDVNEYLNSNYDY* |
| Ga0070749_101126826 | 3300006802 | Aqueous | MFDELWSEIQDMPGEIFDIPEIQDEEEFNLKEYMEGDYDY* |
| Ga0070749_104048882 | 3300006802 | Aqueous | MFDELWSEIQDAPGEIFDLDIPELRDDNEKFDFDGYLAADYEY* |
| Ga0070754_100404136 | 3300006810 | Aqueous | MFDELWSEIQDMPGEIFDIPEIRDDEKFNLKEYMEGDYDY* |
| Ga0070754_101469413 | 3300006810 | Aqueous | MFDELWSEIQDMPGEIFDIPEIRDDEKFDLKEYMEGDYDY* |
| Ga0070754_103387071 | 3300006810 | Aqueous | PSLINSNPFSYSTMFDELWQEIQDMPGEIFDLDIPELRDTEKFDVNEYLNANYDY* |
| Ga0075481_101849823 | 3300006868 | Aqueous | MFDELWQEIQDMPGEIFDLDIPELRDTEKFDVNEYLNANYDY* |
| Ga0070750_101215582 | 3300006916 | Aqueous | MFDELWSEIQDMPGEIFDIPEIQDDEKFNLKEYMEGDYDY* |
| Ga0070750_102769343 | 3300006916 | Aqueous | MFDELWSEIQDMPGEIFDIPEMRELDDDNKFNVEDYLKADYDY* |
| Ga0070750_103786961 | 3300006916 | Aqueous | MYDELWSEIADAPGEIFDLPELRDLEEEKFDVNEYLNSNYD |
| Ga0070750_104285492 | 3300006916 | Aqueous | MFDELWQEIQDAPGEIFDLDIPELRDEEDFNLNEYINGNIDY* |
| Ga0075472_106277773 | 3300006917 | Aqueous | MFDELWTEIQDAPGEIFDIPELRDEEDFNLNEYLNGNYDY* |
| Ga0070746_101323593 | 3300006919 | Aqueous | MFDEMWQEIQDAPGEIFDIPELRDEEDFNLNEYINGNIDY* |
| Ga0070746_102059972 | 3300006919 | Aqueous | MFDELWQEIQDAPGEIFDLDIPELRDDEKFDVNEYLNGNIDY* |
| Ga0103274_12165714 | 3300007202 | Freshwater Lake | MFDELWSEIQDMPGEIFDLDIPELRDEKFDVNEYLNANYDY* |
| Ga0070745_10267545 | 3300007344 | Aqueous | MFDELWSEIQDMPGEIFDIPEIRDDEEFNLKEYMEGDYDY* |
| Ga0070752_13547491 | 3300007345 | Aqueous | ETFQEINDLPAEIYDIPELNDSDDFNLNDYINGNYDY* |
| Ga0099851_100156014 | 3300007538 | Aqueous | MFDELWTEIQDMPGEIFDLDIPELEEDSDKFNVNEYLNSNYDY* |
| Ga0099851_10819322 | 3300007538 | Aqueous | MFDELWSEIQDMPGEIFDLDIPELKDDDDFNVNDYLAGDYDY* |
| Ga0099851_11192064 | 3300007538 | Aqueous | MFDELWSEIQDMQGEIFDLDIPELREDDFNFNDYVAADYDY* |
| Ga0099851_11470413 | 3300007538 | Aqueous | MFDEMWQEIADAPGEIFDMDIPELRDEKFDVNEYLNGNIDY* |
| Ga0099851_11580131 | 3300007538 | Aqueous | MFDELWSEIQDSQGEIFDMDIPELKDEKFDVNEYLNGNIDY* |
| Ga0099851_12065702 | 3300007538 | Aqueous | MFDELWSEIQDMPGEIFDLDIPELKEEDFNLTEYINGEYDY* |
| Ga0099851_12411211 | 3300007538 | Aqueous | MFDEMWQEIQDAPGEIFDLDIPELRDEKFDVNEYINGNIDY* |
| Ga0099851_12844261 | 3300007538 | Aqueous | MFDEMWQEIQDSPGEIFDLPELRDEEDFNLNEYINGNIDY* |
| Ga0099851_13156652 | 3300007538 | Aqueous | MFDELWQEIQDMPGEIFDIPEMDDKEDFNMNEYLNGDYDY* |
| Ga0099851_13486531 | 3300007538 | Aqueous | MFDELWSEIADAPGEIFDLDIPELRDDEKFDFNGYLAADYDY* |
| Ga0099849_10505284 | 3300007539 | Aqueous | MFDELWSEIQDSQGEIFDMDIPELKDEKFDVNEYLKGNIDY* |
| Ga0099849_11338103 | 3300007539 | Aqueous | MFDELWTEIADSQGEIFDLDIPELRDDNEKFDFDGYLAADYDY* |
| Ga0099849_11535892 | 3300007539 | Aqueous | MFDELWQEIQDAPGEIFDIPELRDLDDEKFDVNDYINGNYDY* |
| Ga0099849_12196762 | 3300007539 | Aqueous | MYDELWSEIADAPGEIFDIPELRDDEDFNLNEYINGNIDY* |
| Ga0099849_12296022 | 3300007539 | Aqueous | MFDELWSEIQDAPGEIFDMDIPELRDEEQFNMNEYLNANYDY* |
| Ga0099849_12953331 | 3300007539 | Aqueous | MYDELWSEIADAPGEIFDLPELRDLEEDKFDVNEYLNSDYDY* |
| Ga0099848_10189922 | 3300007541 | Aqueous | MFDELWSEIQDSQGEIFDMDIPELRDTEKFDMNEYLNANYDY* |
| Ga0099848_10307705 | 3300007541 | Aqueous | MFDELWSEIQDMPGEIFDLDIPELKDEEKFNMNEYLNGDYDY* |
| Ga0099848_10432304 | 3300007541 | Aqueous | MFDELWSEIADAPGEIFDIPELQELDEDRKFDVNEYLNANYDY* |
| Ga0099848_10501351 | 3300007541 | Aqueous | TMFDELWSEIADAPGEIFDIPELQELDEDRKFDVNEYLNSNYDY* |
| Ga0099848_10669752 | 3300007541 | Aqueous | MFDELWSEIQDAPGEIFDLDIPELKEEDFNLTEYINGEYDY* |
| Ga0099848_10708212 | 3300007541 | Aqueous | MFDEMWQEIQDAPGEIFDIPELRDDEDFNLNEYINGNIDY* |
| Ga0099848_10712683 | 3300007541 | Aqueous | MFDELWSEIQDAPGEIFDLDIPELRDEEKFDVNEYLNGNYDY* |
| Ga0099848_11906132 | 3300007541 | Aqueous | MFDEMWQEIQDAPGEIFDIPELRDLDDEKFDVNDYINGNYDY* |
| Ga0099848_12072624 | 3300007541 | Aqueous | EMWQEIQDAPGEIFDIPELRDEEDFNLNEYINGNIDY* |
| Ga0099848_12190143 | 3300007541 | Aqueous | WSEIQDAPGEIFDIPELRELDEEQKFDYNEYILGNIDY* |
| Ga0099848_12568262 | 3300007541 | Aqueous | MFDEMWQEIQDAPGEIFDIPELHDEEDFNLNEYLNANYDY* |
| Ga0099848_12615752 | 3300007541 | Aqueous | MFDELWSEIQDSQGEIFDMDIPELRDEKFDVNEYLNGNIDY* |
| Ga0099846_10509843 | 3300007542 | Aqueous | PLHLTSPNQITIMFDELWNEIQETPGEIFDILELQEEENFDFDGYLAADYDY* |
| Ga0099846_10798443 | 3300007542 | Aqueous | MFDEMWQEIQDAPGEIFDIPKLRDEEDFNLNEYINGNIDY* |
| Ga0099846_11308812 | 3300007542 | Aqueous | MFDELWSEIQDAPGEIFDLDIPELRDDEKFDFNGYLAADYDY* |
| Ga0102873_100202017 | 3300007545 | Estuarine | MFDELWSEIADAPGEIFDLPELRELDEEKFNLNDYLNSNIDY* |
| Ga0102874_100215322 | 3300007546 | Estuarine | EIADAPGEIFDLPELRELDEEKFNLNDYLNSNIDY* |
| Ga0102880_10020771 | 3300007550 | Estuarine | WSEIADAPGEIFDLPELRELDEEKFNLNDYLNSNIDY* |
| Ga0102915_10000611 | 3300007562 | Estuarine | SEIADAPGEIFDLPELRELDEEKFNLNDYLNSNIDY* |
| Ga0070751_11838782 | 3300007640 | Aqueous | MFDELWSEIQDMPGEIFDIPELKDDEDFNMNDYLAADYDY* |
| Ga0102868_10574941 | 3300007653 | Estuarine | LWSEIADAPGEIFDLPELRELDEEKFNLNDYLNSNIDY* |
| Ga0102910_10116821 | 3300007667 | Estuarine | THQMFDELWSEIADAPGEIFDLPELRELDEEKFNLNDYLNSNIDY* |
| Ga0104988_11027174 | 3300007735 | Freshwater | MFDELWQEIQDAPGEIFDIPELNDEEFNMNEYLAADYDY* |
| Ga0099850_10247675 | 3300007960 | Aqueous | MFDELWSEIQDMPGEIFDMDIPELKDEKFDVNEYLKGNIDY* |
| Ga0099850_10274195 | 3300007960 | Aqueous | METDYLWSEIQDMPGEIFDIPEIQDEEEFNLKEYMEGDYDY* |
| Ga0099850_11048833 | 3300007960 | Aqueous | MYDELWSEIADAPGEIFDIPELRDEEDFNLNEYLNANYDY* |
| Ga0099850_11064242 | 3300007960 | Aqueous | MDFDTDILNEIEDSNGEIFDIPEFRDDEFDMNEYLNGNYDY* |
| Ga0105746_11092025 | 3300007973 | Estuary Water | TMFDELWSEIQDAPGEIFDLDIPELRDTEKFDMNEHLNASYDY* |
| Ga0105746_12269961 | 3300007973 | Estuary Water | MYDELWSEIQDAPGEIFDIPELRELDEENKFNLNDYINGNIDY* |
| Ga0105746_13142113 | 3300007973 | Estuary Water | DELWSEIADSQGEIFDLDIPELKDEKFDFNEYINASYDY* |
| Ga0105747_11355132 | 3300007974 | Estuary Water | MFDELWSEIADSQGEIFDLDIPELKDEKFDFNEYINASYDY* |
| Ga0102893_11335512 | 3300008052 | Estuarine | MFDELWSEIQDMPGEIFDMDIPELKDEKFDVNEYLNANYDY* |
| Ga0108970_111589654 | 3300008055 | Estuary | MEDTLWIEIADAPGEIFDLDIPELHDDEKFNMNEYLNANYDY* |
| Ga0108970_111677471 | 3300008055 | Estuary | QEIQDAPGEIFDIPELRDEEDFNMNEYLNGNYDY* |
| Ga0108970_1170164422 | 3300008055 | Estuary | MFDEMWQEIQDAPGEIFDIPELRDEEDFNMNEYLNGNYDY* |
| Ga0114340_100042333 | 3300008107 | Freshwater, Plankton | MFDELWQEIQDMPGEIFDMDIPELREDNKFDVNEYLNANYDY* |
| Ga0114340_10233987 | 3300008107 | Freshwater, Plankton | MFDELWQEIQDMPGEIFDLDIPELREGEKFDVNEYLNANYDY* |
| Ga0114340_10413076 | 3300008107 | Freshwater, Plankton | MFDELWIEIQDAPGEIFDMDIPELRDEEKFNVNEYLNANYDY* |
| Ga0114340_10802526 | 3300008107 | Freshwater, Plankton | FVTERHTMFDELWSEIQDMPGEIFDMDIPELKDEKFDVNEYLNGNIDY* |
| Ga0114340_11482703 | 3300008107 | Freshwater, Plankton | MFDELWQEIQDAPGEIFDLPELRDLDDEKFDVNEYLNANYDY* |
| Ga0114340_12089993 | 3300008107 | Freshwater, Plankton | FLRDSPMFDEMWQEIQDMPGEIFDLDIPELKDEKFDVNEYLNANYDY* |
| Ga0114340_12356982 | 3300008107 | Freshwater, Plankton | MFDELWSEIQDMPGEIFDLDIPELKDEESFNMNEYLNAD |
| Ga0114341_100465136 | 3300008108 | Freshwater, Plankton | MFDELWSEIQDMPGEIFDLDIPELKDEKFDVNEYLNGNYDY* |
| Ga0114341_102781045 | 3300008108 | Freshwater, Plankton | MFDELWSEIQDMPGEIFDLDIPELKDEKFDVNEYLQ* |
| Ga0114341_104246903 | 3300008108 | Freshwater, Plankton | MFDELWQEIQDAPGEIFDIPELRDEEDFNLNEYLNGNYDY* |
| Ga0114343_10895353 | 3300008110 | Freshwater, Plankton | MFDELWSEIQDMPGEIFDLDIPELKDEKFDVNEYLNGN |
| Ga0114343_11936461 | 3300008110 | Freshwater, Plankton | RVKGGNAMFDELWSEIQDMPGEIFDLDIPELKDEESFNMNEYLNADYDY* |
| Ga0114346_12901551 | 3300008113 | Freshwater, Plankton | MFDELWSEIQDMPGEIFDMDILELKDEMFDVNEYLNGNIDY* |
| Ga0114350_10493883 | 3300008116 | Freshwater, Plankton | MFDELWSEIQDAPGEIFDLNIPELRDDEKFDFDGYLAADYDF* |
| Ga0114351_10988461 | 3300008117 | Freshwater, Plankton | IQDMPGEIFDLDIPELREGEKFDVNEYLNANYDY* |
| Ga0110928_12072053 | 3300008510 | Water Bodies | MFDEMWSEIQDAPGEIFDLDIPELREDKEFNLNEYLNADYDY* |
| Ga0102831_10534495 | 3300008996 | Estuarine | MFDELWSEIADAPGEIFDIPELQELDQDRKFDVNEYLNSNIDY* |
| Ga0102831_13225471 | 3300008996 | Estuarine | HSSLRDTPMFDEMWQEIQDAPGEIFDIPELRDLDDDNKFDVNEYLNANYDY* |
| Ga0105105_100040028 | 3300009009 | Freshwater Sediment | MFDELWQEIQDMPGEIFDLDIPELKDEESFNMNDYLNADYDY* |
| Ga0105105_100186945 | 3300009009 | Freshwater Sediment | MDFDTYILNEIEDSDAEIFDIPEFHDEEFDMNEYLNGNYDY* |
| Ga0105152_104865172 | 3300009039 | Lake Sediment | MYDELWSEIQDAPGEIFDIPELRELDEENKFNLNEYFNGNIDY* |
| Ga0102864_10428145 | 3300009051 | Estuarine | HLLRGKPTMFDELWSEIQDAPGEIFDLDIPELRDNEKFDVNEYLNANYDY* |
| Ga0102830_10821815 | 3300009059 | Estuarine | MFDELWSEIADAPGEIFDIPELQELDQDRKFDVNEYLNSN |
| Ga0105098_100389634 | 3300009081 | Freshwater Sediment | MFDELWSEIQDMPGEIFDMDIPELRDEEKFNVNEYLNANYDY* |
| Ga0105098_100578063 | 3300009081 | Freshwater Sediment | MYDELWSEIADAPGEIFDIPELRDLDDDEKFNVNDYLNSNIDY* |
| Ga0118687_101224521 | 3300009124 | Sediment | EMWQEIQDAPGEIFDIPELRDLDDEKFNVNEYLNGNIDY* |
| Ga0118687_104229231 | 3300009124 | Sediment | MNDFDTDFWSEIQDAPGEIFDIPELRDLDDEKFNVNEYLNSNYDY* |
| Ga0114918_102609141 | 3300009149 | Deep Subsurface | MFEELWSEIQDAPGEIFDLPELRELDEEKFNLNDYLNSNIDY* |
| Ga0114980_100235576 | 3300009152 | Freshwater Lake | MEDTLWTEIADMDGEIFDLDIPELKQEKFDFNEYINANYDY* |
| Ga0114980_100600681 | 3300009152 | Freshwater Lake | MFDELWQEIQDSPGEIFDIPELRDLEEEKFNVNEYLNSDYDY* |
| Ga0114980_106443653 | 3300009152 | Freshwater Lake | MEDTLWTEIADMDGEIFDMEIPELKQEKFDFNEYINGNYDY* |
| Ga0114980_107620621 | 3300009152 | Freshwater Lake | MFDELWQEIQDSPGEIFDIPELRDLEEEKFNVNDYLNSDYDY* |
| Ga0114978_1000511431 | 3300009159 | Freshwater Lake | MEDTLWSEIADMEGEIFDLDIPELKQEKFDFNEYLNANYDY* |
| Ga0114978_101034303 | 3300009159 | Freshwater Lake | MFDELWSEIQDAPGEIFDIPELRDLEEEKFDVNAYLNSNYDY* |
| Ga0114978_101527637 | 3300009159 | Freshwater Lake | MYDELWSEIVDAPGEIFDIPELQDEKFDVNEYLNSNIDY* |
| Ga0114978_103080723 | 3300009159 | Freshwater Lake | MFDELWSEIQDAPGEIFDMDIPELRDEKFDVNEYLNSNYDY* |
| Ga0114978_105647331 | 3300009159 | Freshwater Lake | MEDTLWTEIADMDGEIFDMEIPELRQEKFDFNEYINANYDY* |
| Ga0105104_107443201 | 3300009168 | Freshwater Sediment | PMFDELWSEIQDMPGEIFDMDIPELRDTEKFDVNEYLNANYDY* |
| Ga0105097_100792865 | 3300009169 | Freshwater Sediment | MFDELWSEIRDMPGEIFDMDIPELRDTEKFDVNEYLNANYDY* |
| Ga0103848_10079836 | 3300009218 | River Water | EIQDAPGEIFDLDIPELRDAEKFDMNEYLNANYDY* |
| Ga0103850_10127345 | 3300009223 | River Water | MFDELWSEIQDAPGEIFDLDIPELRDAEKFDMNEYLNANYDY* |
| Ga0103856_100291654 | 3300009233 | River Water | MYDELWIEIQDAPGEIFDIPEMNDEDFNLNEYLAADYDY* |
| Ga0103858_101541932 | 3300009239 | River Water | MWEEIQDMPGEIFDLDIPELRDTEKFDVNEYLNANYDY* |
| Ga0103824_1052892 | 3300009331 | River Water | MFDELWSEIQETPGEIFDMDIPELRDEKFDVNEYLKGDYDY* |
| Ga0127391_10678222 | 3300009450 | Meromictic Pond | MYDELWSEIADAPGEIFDLPELRDLEEEKFDVNEYLNSNYDY* |
| Ga0127402_10061835 | 3300009451 | Meromictic Pond | MYDELWSEIADAPGEIFDLPELRDLEEGKFDVNEYLNSNIDY* |
| Ga0114930_103630743 | 3300009499 | Deep Subsurface | MEDTLWTEIADMDGEIFDMEIPELKQEKFDFNEYLNANYDY* |
| Ga0114946_101903922 | 3300009504 | Sediment | MFDELWQEIQDAPGEIFDLDIPELREDNEKFDFDGYLAADYDF* |
| Ga0114946_102282461 | 3300009504 | Sediment | FVLNQIKNMFDELWQEIQDSPGEIFDLDIPELRDDNKEFDFDGYLAADYDY* |
| Ga0114946_103496471 | 3300009504 | Sediment | MFDELWQEIQDSPGEIFDLDIPELRDDEKFNLNEYLNANYDY* |
| Ga0114946_104066422 | 3300009504 | Sediment | MFDELWQEIQDSPGEIFDLDILELRDDEKFNLNEYLNANYDY* |
| Ga0114946_104647561 | 3300009504 | Sediment | NMFDELWQEIQDSPGEIFDLDIPELRDDNKEFDFDGYLTSDYDY* |
| Ga0130019_10495683 | 3300009564 | Meromictic Pond | HDALPICEIADAPGEIFDLPELRDLEEEKFDVNEYLNSNYDY* |
| Ga0098049_10539125 | 3300010149 | Marine | MDDLLSEIMDTPGEIFDNPELRELEEEEKFNVENSINSNIDY* |
| Ga0116204_12299194 | 3300010293 | Anoxic Lake Water | SEIQDAPGEIFDLDISELKDEKFDLNEYLAADYDY* |
| Ga0129348_10395077 | 3300010296 | Freshwater To Marine Saline Gradient | MFDELWSEIADSQGEIFDLDIPELRDDNEKFDFDGYLAADYDY* |
| Ga0129348_10725183 | 3300010296 | Freshwater To Marine Saline Gradient | MYDELWSEIADAPGEIFDIPELRELTNEDKFDVEDYIKGNTDY* |
| Ga0129348_10866894 | 3300010296 | Freshwater To Marine Saline Gradient | MFDELWSEIQDSQGEIFDLDIPELKDEKFDVNEYLNGNIDY* |
| Ga0129348_10923941 | 3300010296 | Freshwater To Marine Saline Gradient | MFDELWSEIQDCQGEIFDLDIPELREDNKFDVEEYIKGEI |
| Ga0129348_11086552 | 3300010296 | Freshwater To Marine Saline Gradient | MFDELWNEIQETPGEIFDILELQEEENFDFDGYLAADYDY* |
| Ga0129345_10909541 | 3300010297 | Freshwater To Marine Saline Gradient | MYDELWSEIADAPGEIFDLPELRDLEEDKFDVNEYLNSNIDY |
| Ga0129345_11014916 | 3300010297 | Freshwater To Marine Saline Gradient | EIADSQGEIFDLDIPELRDDNEKFDFDGYLAADYDY* |
| Ga0129345_11127502 | 3300010297 | Freshwater To Marine Saline Gradient | MFDELWNEIQDMPGEIFDMDIPELKDEKFDVNEYLKGNIDY* |
| Ga0129345_13092462 | 3300010297 | Freshwater To Marine Saline Gradient | VPPLDPLHLISPNQITIMFDELWNEIQETPGEIFDLLELQEEENFDFDGYLAADYDY* |
| Ga0129342_10171177 | 3300010299 | Freshwater To Marine Saline Gradient | MFDELWSEIQDAPGEIFDMDIPELRDTEKFDMNEYLNANYDY* |
| Ga0129342_11581211 | 3300010299 | Freshwater To Marine Saline Gradient | TMFDELWSEIQDAPGEIFDMDIPELRDEEQFNMNEYLNANYDY* |
| Ga0129342_11894042 | 3300010299 | Freshwater To Marine Saline Gradient | MYDELWSEIADAPGEIFDIPELRDDEDFNLNEYLNSNIDY* |
| Ga0129342_12126791 | 3300010299 | Freshwater To Marine Saline Gradient | MFDELWSEIQDMPGEIFDIPEIQDEQEFNLKEYMEGDYDY* |
| Ga0136656_10827572 | 3300010318 | Freshwater To Marine Saline Gradient | MFDELWSEIQDMPGEIFDMEIPELKDEKFDVNEYLNGNIDY* |
| Ga0136656_10857111 | 3300010318 | Freshwater To Marine Saline Gradient | MFDEMWQEIQDAPGEIFDIPEIDDAEDFNLNEYINGNIDY* |
| Ga0136656_12886784 | 3300010318 | Freshwater To Marine Saline Gradient | LRTMFDELWQEIQDAPGEIFDLDIPELRDDEKFDVNEYLNGNIDY* |
| Ga0136656_13179392 | 3300010318 | Freshwater To Marine Saline Gradient | MFDELWNEIQDMPGEIFDMDIPELKDEKFDVNEYLNSNYDY* |
| Ga0129333_1000003973 | 3300010354 | Freshwater To Marine Saline Gradient | MFDEMWSEIQDAPGEIFDLDIPELRDTEKFDVNEYLNANYDY* |
| Ga0129333_1000094510 | 3300010354 | Freshwater To Marine Saline Gradient | MFDELWAEIQDMPGEIFDLDIPELREDFDFDGYIAADYDF* |
| Ga0129333_100010021 | 3300010354 | Freshwater To Marine Saline Gradient | EIQDMPGEIFDLDIPELKDEEKFNMNEYLNANYDY* |
| Ga0129333_1001606810 | 3300010354 | Freshwater To Marine Saline Gradient | MFDELWSEIQDAPGEIFDMDIPELRDDEKFNVNEYLNANYDY* |
| Ga0129333_100234319 | 3300010354 | Freshwater To Marine Saline Gradient | MFDEDFSNDLWQEIQDSSGEIFDLDIPELKEDDGFNLSDYFAGDYDY* |
| Ga0129333_1003075314 | 3300010354 | Freshwater To Marine Saline Gradient | MEFDSDLWSEIQDAPGEIFDLDIPELRDEKFDVNAYLNSSFDY* |
| Ga0129333_1003184116 | 3300010354 | Freshwater To Marine Saline Gradient | MFDELWSEIQDAPGEIFDLDIPELKDEKFDVNEYLNADYDY* |
| Ga0129333_100348949 | 3300010354 | Freshwater To Marine Saline Gradient | MYDELWSEIQDMPGEIFDLDIPELKDEKFDVNEYLNANYDY* |
| Ga0129333_100501224 | 3300010354 | Freshwater To Marine Saline Gradient | MFDELWSEIQDAPGEIFDLDIPELIDEEKFDVNEYLNSNYDY* |
| Ga0129333_100631797 | 3300010354 | Freshwater To Marine Saline Gradient | MFDEMWQEIQDMPGEIFDMDIPELRDTEKFDVNEYLNANYDY* |
| Ga0129333_100711939 | 3300010354 | Freshwater To Marine Saline Gradient | MFDELWQEIQDAPGEIFDIPELNDEEFNLNEYLAADYDY* |
| Ga0129333_100888637 | 3300010354 | Freshwater To Marine Saline Gradient | MFDELWSEIQDMPGEIFDMDIPELRDEKFDVNEYLNANYDY* |
| Ga0129333_100941183 | 3300010354 | Freshwater To Marine Saline Gradient | MYDELWSEIADAPGEIFDIPELRDLDEEQKFDYNEYILSNIDY* |
| Ga0129333_101493404 | 3300010354 | Freshwater To Marine Saline Gradient | MFDELWSEIQESQGEIFDLDIPELGDTEEFNLNEYLNGDYDY* |
| Ga0129333_102693334 | 3300010354 | Freshwater To Marine Saline Gradient | MFDELWSEIQDAPGEIFDIPELRELDEEQKFDYNEYILGNIDY* |
| Ga0129333_103554844 | 3300010354 | Freshwater To Marine Saline Gradient | MFDELWSEIQDAPGEIFDLDIPELRDDEKFDVNEYLNSNYDY* |
| Ga0129333_104252012 | 3300010354 | Freshwater To Marine Saline Gradient | MFDELWSEIQDAPGEIFDLDIPELRDEEKFDVNEYLNANYDY* |
| Ga0129333_104352792 | 3300010354 | Freshwater To Marine Saline Gradient | MFDELWQEIQDAPGEIFDLDIPELKDDESFDMNDYLKGDYDY* |
| Ga0129333_104681422 | 3300010354 | Freshwater To Marine Saline Gradient | MFDELWSEIQDAPGEIFDMDIPELRDDDKFDVNEYLNADYDY* |
| Ga0129333_105110562 | 3300010354 | Freshwater To Marine Saline Gradient | MFDELWSEIQDMPGEIFDLDIPELRDEKFDVNEYLNSNYDY* |
| Ga0129333_105742643 | 3300010354 | Freshwater To Marine Saline Gradient | MFDEMWQEIADAPGEIFDIPEIEDSEDFNLNEYLNADYDY* |
| Ga0129333_105846412 | 3300010354 | Freshwater To Marine Saline Gradient | MFDELWSEIQDAPGEIFDLDIPELRDDEKFNINEYLNANYDY* |
| Ga0129333_106579272 | 3300010354 | Freshwater To Marine Saline Gradient | MFDELWSEIADAPGEIFDIPELRDDEDFNLNEYLAADYDY* |
| Ga0129333_106936353 | 3300010354 | Freshwater To Marine Saline Gradient | MFDEDFSNDLWQEIQDMPGEIFDFDIPELKEDDFTINDYFEGDYDY* |
| Ga0129333_107719034 | 3300010354 | Freshwater To Marine Saline Gradient | MFEELWSEIQDAPGEIFDLDIPELEYERFDVNEYLNANYDY* |
| Ga0129333_108471212 | 3300010354 | Freshwater To Marine Saline Gradient | MFDELWSEIQDAPGEIFDLDIPELRDDEKFDVNEYLNANYDY* |
| Ga0129333_108515714 | 3300010354 | Freshwater To Marine Saline Gradient | MFDELWSEIQDAPGEIFDLDIPELRDDNEKFDFDGYLAADYDY* |
| Ga0129333_108875011 | 3300010354 | Freshwater To Marine Saline Gradient | MFDELWQEIQDMPGEIFDMDIPELRDEEKFNVNEYLNANYDY* |
| Ga0129333_108941271 | 3300010354 | Freshwater To Marine Saline Gradient | MFDELWQEIQDAPGEIFDIPELNDEDFNLNEYLAADYDY* |
| Ga0129333_109156485 | 3300010354 | Freshwater To Marine Saline Gradient | ELWSEIQDAPGEIFDIPELRDEEDFNLNEYLNANYDY* |
| Ga0129333_109576542 | 3300010354 | Freshwater To Marine Saline Gradient | MFDELWSEIQDMPGEIFDLDIPELKDEKFDVNEYLNSNYDY* |
| Ga0129333_111814891 | 3300010354 | Freshwater To Marine Saline Gradient | ERHTMFDELWSEIQDSQGEIFDMDIPELKDEKFDVNEYLNGNIDY* |
| Ga0129333_113058362 | 3300010354 | Freshwater To Marine Saline Gradient | MFDELWSEIQETPGEIFDLDIPELRDEKFDVNEYLNANYDY* |
| Ga0129333_114769742 | 3300010354 | Freshwater To Marine Saline Gradient | MFDEMWQEIQDAPGEIFDLDIPELREGEKFDVNDYINGNYDY* |
| Ga0129333_115227532 | 3300010354 | Freshwater To Marine Saline Gradient | MFDELWSEIQDAPGEIFDIPELNDEEFNLNEYLAADYDY* |
| Ga0129333_115366611 | 3300010354 | Freshwater To Marine Saline Gradient | ERHTMFDELWSEIQDSQGEIFDMDIPELKDEKFDVNEYLNANYDY* |
| Ga0129333_115865531 | 3300010354 | Freshwater To Marine Saline Gradient | MFDELWQEIQDAPGEIFDIPELRDLDDDKFDVNDYINGNYDY* |
| Ga0129333_116177574 | 3300010354 | Freshwater To Marine Saline Gradient | WSEIQDMPGEIFDLDIPELKDEKFDVNEYLNANYDY* |
| Ga0129333_116629191 | 3300010354 | Freshwater To Marine Saline Gradient | ELWQEIQDAPGEIFDIPELRDEEDFNLNEYLNGNIDY* |
| Ga0129333_116893802 | 3300010354 | Freshwater To Marine Saline Gradient | MFDELWSEIQDMPGEIFDLDIPELRDTEKFDMNEYLN |
| Ga0129333_117622442 | 3300010354 | Freshwater To Marine Saline Gradient | MFDELWSEIQDMPGEIFDLDIPELKDEEKFNMNEYLNANYDY* |
| Ga0129324_104201092 | 3300010368 | Freshwater To Marine Saline Gradient | MFDELWSEIQDSQGEIFDMDIPELKDEKFDMNEYLNGNIDY* |
| Ga0129336_100073231 | 3300010370 | Freshwater To Marine Saline Gradient | MYDELWTEIVDAPGELFDIPELREDEGFDFNEYLTADYD |
| Ga0129336_103772412 | 3300010370 | Freshwater To Marine Saline Gradient | MFDELWSEIQDMPGEIFDMDIPELRDEKFDVNEYLNGNIDY* |
| Ga0129336_107287652 | 3300010370 | Freshwater To Marine Saline Gradient | MFDELWSEIQDAPGEIFDIPELRDDEDFNLNEYLAADYDY* |
| Ga0129336_107672682 | 3300010370 | Freshwater To Marine Saline Gradient | MFDELWSEIQDAPGEIFDIPELRELDEENKFDYNEYILSNIDY* |
| Ga0136549_1000040223 | 3300010389 | Marine Methane Seep Sediment | MFDELWNEIQETPGEIFDILELQEEQENFDFDGYLAADYDY* |
| Ga0136549_100139256 | 3300010389 | Marine Methane Seep Sediment | MFDEMWQEIQDAPGEIFDIPEMRDEEDFNLNEYINGNIDY* |
| Ga0136549_100198769 | 3300010389 | Marine Methane Seep Sediment | MYDELWSEIADAPGEIFDIPELRELTDDDKFNVEDYIKGNTDY* |
| Ga0136549_100933924 | 3300010389 | Marine Methane Seep Sediment | MFDEMWQEIQDMPGEIFDIPEMDDKEDFNMNEYLNGDYDY* |
| Ga0136549_101650692 | 3300010389 | Marine Methane Seep Sediment | MFDEMWQEIQDAPGEIFDIPEIDDAEDFNLNDYLNSDYDY* |
| Ga0133913_134081111 | 3300010885 | Freshwater Lake | MCDELWQEIQDSPGEIFDIPELRDLEEEKFNVNEYLNSDYDY |
| Ga0139324_11227752 | 3300010997 | Sediment | MFDELWTEIQDMPGEIFDLDIPELDEDSDKFNVNEYLNSNYDY* |
| Ga0151620_100016664 | 3300011268 | Freshwater | MFDEMWQEIADAPGEIFDIPELRDEEDFNLNDYLAADYDY* |
| Ga0151620_10006822 | 3300011268 | Freshwater | MFDEMWQEIQDMPGEIFDLDIPELRDTEKFDVNEYLNANYDY* |
| Ga0151620_10014789 | 3300011268 | Freshwater | MFDELWSEIQDMPGEIYDLDIPELKEEDFNMTEYINGDYDY* |
| Ga0151620_10099398 | 3300011268 | Freshwater | MFDELWSEIQDAPGEIFDMDIPELKDEKFDMNEYLNGNIDY* |
| Ga0151620_10130066 | 3300011268 | Freshwater | MFDELWSEIQDAPGEIFDLDIPEIEDSTEFNLNDYLNGDYDY* |
| Ga0151620_10506854 | 3300011268 | Freshwater | MFDEMWSEIQDAPGEIFDMDIPELRDDEKFDVNEYLNANYDY* |
| Ga0119951_10709453 | 3300012000 | Freshwater | MYDELWIEIADAPGEIFDIPELRDEEDFNLNEYLNANYDY* |
| Ga0129334_10777491 | 3300012471 | Aqueous | QTMFDELWSEIQDMPGEIFDLDIPELRDEKFDVNEYLNANYDY* |
| Ga0129340_12217554 | 3300012963 | Aqueous | HTMFDELWSEIQDMQGEIFDLDIPELREDDFNFNDYVAADYDY* |
| Ga0129341_11025333 | 3300012966 | Aqueous | TMYDELWSEIADAPGEIFDIPELRDDEDFNLNEYLNSNIDY* |
| Ga0129341_11350221 | 3300012966 | Aqueous | TMFDELWSEIQDMQGEIFDLDIPELREDDFNFNDYVAADYDY* |
| Ga0129341_11516652 | 3300012966 | Aqueous | MCDELWNEIQETPGEIFDILELQEEENFDFDGYLAADYDY* |
| Ga0129337_10408542 | 3300012968 | Aqueous | MFDELWSEIQDMPGEIFDLDIPELRDSEKFDMNEYLNANYDY* |
| Ga0164293_103964491 | 3300013004 | Freshwater | MFDELWQEIQDMPGEIFDLNVPEIEDQDDGFNLNEYLNADYDY* |
| Ga0164293_108132021 | 3300013004 | Freshwater | MFDELWSEIADSQGEIFDLDIPELRDEKFDVNEYLNANYDY* |
| Ga0163212_10208302 | 3300013087 | Freshwater | VFDELWQEIQDAPGEIFDLDIPELRDNEKFDLNEYLAADYDY* |
| Ga0163212_10601724 | 3300013087 | Freshwater | MFDEMWQEIQDMPGEIFDLDIPELRDTEKFDVNEYLNSNIDY* |
| Ga0163212_12251692 | 3300013087 | Freshwater | MFDELWSEIQESEGEIFDLDIPELRDTEKFDLNEYLAADYDY* |
| Ga0163212_12424042 | 3300013087 | Freshwater | MFDELWSEIQDAPGEIFDLDIPELRDPEKFDLNEYLAADYDY* |
| Ga0163212_12690292 | 3300013087 | Freshwater | MFDELWSEIQESEGEIFDLNIPELRDTEKFDLNEYLAADYDY* |
| Ga0163212_12766242 | 3300013087 | Freshwater | MYDELWTEIADSQGEIFDLDIPELKDEKFDLNEYLAADYDY* |
| Ga0163212_12958712 | 3300013087 | Freshwater | VFDELWQEIQDAPGEIFDLNIPELRDNEKFDLNEYLAADYDY* |
| (restricted) Ga0172369_104297001 | 3300013125 | Freshwater | MFDELWSEIADSQGEIFDLDIPELRDEKFDVNEYLNSNYDY* |
| (restricted) Ga0172367_1003284713 | 3300013126 | Freshwater | MFDELWQEIQDMPGEIFDLDIPELKDEKFDVNEYLNSNYDY* |
| (restricted) Ga0172367_101210723 | 3300013126 | Freshwater | MYDELWSEIADAPGEIFDLDIPELKDDKFDVNEYLNGNIDY* |
| (restricted) Ga0172367_103579813 | 3300013126 | Freshwater | MFDELWSEIQDAPGEIFDLDISELKDEKFDLNEYLAADYDY* |
| (restricted) Ga0172365_105664102 | 3300013127 | Sediment | VFDELWQEIQDAPGEIFDLDIPELRDNEKFNLNEYLAADYDY* |
| (restricted) Ga0172365_105665582 | 3300013127 | Sediment | MFDELWSEIADSQGEIFDLDIPELCDEKFDVNEYLNSNYDY* |
| (restricted) Ga0172364_109520813 | 3300013129 | Sediment | PERHSMFDELWSEIQDAPGEIFDLDISELREDNKFDLNEYLAADYDY* |
| (restricted) Ga0172373_101251394 | 3300013131 | Freshwater | MYDELWSEIADAPGEIFDLDIPELKDEKFDVNEYLNGNIDY* |
| (restricted) Ga0172371_103516533 | 3300013138 | Freshwater | MFDELWSEIQDAPGEIFDLDIPELREDNKFDLNEYL |
| Ga0117792_10391951 | 3300013941 | Epidermal Mucus | MFDELWTEIQDAPGEIFDLDIPELKDEKFDVNEYLNANYDY* |
| Ga0117790_10406791 | 3300014042 | Epidermal Mucus | MTSGERRSHLLKSQTEVIMFDEMWQEIQDMPGEIFDIPEMDDKEDFNMNEYLNGDYDY* |
| Ga0117790_10633533 | 3300014042 | Epidermal Mucus | METDYIWQEIQDMPGEIFDIPEIQDEKEFNLKEYMEGDYDY* |
| Ga0117790_10707052 | 3300014042 | Epidermal Mucus | VVEGFPQMFDELWTEIQDAPGEIFDLPELRDLEDDKFDVNEYLNGNIDY* |
| (restricted) Ga0172376_104335672 | 3300014720 | Freshwater | MFDELWSEIQDAPGEIFDMDIPELKDEKFDVNEYLNANYDY* |
| (restricted) Ga0172376_105186213 | 3300014720 | Freshwater | MFDELWSEIQDAPGEIFDLDIPELREDNKFDLNEYLAADYDY* |
| Ga0181402_10872983 | 3300017743 | Seawater | HSFTLSNTMDDLLSEIMDSPGEIFDIPELRELEEEEKFNVESFINSNIDY |
| Ga0181356_10748555 | 3300017761 | Freshwater Lake | MFDELWSEIADSQGEIFDIPELRELEEEKFDVNEYLNSNIDY |
| Ga0181356_12152652 | 3300017761 | Freshwater Lake | TFVPERSPMFDELWSEIADSQGEIFDLDIPELNDEKFDVNEYLNSNIDY |
| Ga0181358_12820402 | 3300017774 | Freshwater Lake | FDELWSEIADSQGEIFDLDIPELNDEKFDVNEYLNSNIDY |
| Ga0181349_11950083 | 3300017778 | Freshwater Lake | MYDELWSEIADSQGEIFDLDIPELNDEKFDVNEYLNS |
| Ga0169931_100901674 | 3300017788 | Freshwater | MFDELWQEIADSQGEIFDLDIPELRDDEKFDLDDYLNSNYDY |
| Ga0169931_102901871 | 3300017788 | Freshwater | MFDELWSEIADSQGEIFDLDIPELCDEKFDVNEYLNSNYDY |
| Ga0181584_102762785 | 3300017949 | Salt Marsh | MFDELWSEIQDAPGEIFDIPEMQELDEDKKFNVTEYLNSNYDY |
| Ga0181583_103723405 | 3300017952 | Salt Marsh | EIADAPGEIFDIPELQDLDDENKFDVNEYLNANYDY |
| Ga0181583_104268832 | 3300017952 | Salt Marsh | MFEELWSEIADAPGEIFDIPEMQELEEKFDVNEYLNGNYDY |
| Ga0181580_103873714 | 3300017956 | Salt Marsh | MFDELWSEIQDSQGEIFDMDIPELKDEKFDVNEYLNGNIDY |
| Ga0181580_106405602 | 3300017956 | Salt Marsh | MFDELWSEIADAPGEIFDIPEMQELEEKFDVNEYLNGNYDY |
| Ga0181590_100374186 | 3300017967 | Salt Marsh | MFDELWSEIQDMPGEIFDLDIPELEEDSDKFNVNEYLNSNYDY |
| Ga0181590_103108067 | 3300017967 | Salt Marsh | DIADAPGEIFDIPELQDLDEENKFDVNEYLNANYDY |
| Ga0181560_1001364018 | 3300018413 | Salt Marsh | DELWSEIQDAPGEIFDIPEMQELDEDKKFDVNDYLNSDIDY |
| Ga0181567_105688374 | 3300018418 | Salt Marsh | DELWSEIQDAPGEIFDIPEMQELDEDKKFDVNDYLKSNIDY |
| Ga0181563_102557325 | 3300018420 | Salt Marsh | MFDELWSEIQDAPGEIFDLDIPELQDEKFDVNEYLNSNYDY |
| Ga0181592_105305571 | 3300018421 | Salt Marsh | IADAPGEIFDIPELQDLDEENKFDVNEYLNANYDY |
| Ga0188836_1000087 | 3300018558 | Freshwater Lake | MYDELWSEIQDAPGEIFDIPELRELDEENKFNLNEYLNGNIDY |
| Ga0188882_10139371 | 3300018665 | Freshwater Lake | MFDELWSEIADAPGEIFDLPELRDLEEGKFDVNEYLNSNIDYR |
| Ga0188851_10122274 | 3300018682 | Freshwater Lake | MEDDLFSEIQDSPGEIFDIPELRDLDEDKFDMNEYLNSNYDY |
| Ga0188848_10046572 | 3300018775 | Freshwater Lake | MFEELWSEIQDAPGEIFDIPELRDLDEDKFDVNEYLNSNIDY |
| Ga0188835_10058142 | 3300019096 | Freshwater Lake | MEDDLFSEIQDSPGEIFDIPELRDLDEDKFDVNEYLNSNYDY |
| Ga0194023_10606352 | 3300019756 | Freshwater | MYDELWSEIADAPGEIFDIPELRELTDDDKFDVEDFIKGNTDY |
| Ga0181359_10326735 | 3300019784 | Freshwater Lake | MFDELWSEIQDMPGEIFDLDIPELKDEKFDVNEYLNANYDY |
| Ga0181359_10347835 | 3300019784 | Freshwater Lake | MDFDTDLWSEIQDAPGEIFDIPELNDEKFDFNEYLSANYDY |
| Ga0181359_10748961 | 3300019784 | Freshwater Lake | MYDELWSEIQDAPGEIFDIPELRELEEEKFNLNDYINGNIDY |
| Ga0181359_11095451 | 3300019784 | Freshwater Lake | RSPMFDELWSEIADSQGEIFDLDIPELNDEKFDVNEYLNSNIDY |
| Ga0194113_1000025158 | 3300020074 | Freshwater Lake | MDFDTDFWGEIQDAPGEIFDIPEFDDSDDFNLNEYLNASYDY |
| Ga0194113_101293712 | 3300020074 | Freshwater Lake | MFDELWSEIQDMPGEIFDMDIPELKDEKFDLNEYLAADYDY |
| Ga0194113_103020764 | 3300020074 | Freshwater Lake | MFDELWSEIQESEGEIFDLNIPELRDTEKFDLNEYLNANYDY |
| Ga0194113_104771532 | 3300020074 | Freshwater Lake | MFDELWSEIQESEGEIFDLDIPELRDTEKFDLNEYLAADYDY |
| Ga0194113_105061603 | 3300020074 | Freshwater Lake | MFDELWSEIQESEGEIFDLNIPELRDTEKFDLNEYLA |
| Ga0194113_106432793 | 3300020074 | Freshwater Lake | MFDELWSEIQESEGEIFDLNIPELRDPEKFDLNEYLAADYDY |
| Ga0194113_108462433 | 3300020074 | Freshwater Lake | MFDELWSEIQESEGEIFDLNIPELRDTEKFDLNEYLAADYDY |
| Ga0194113_109225052 | 3300020074 | Freshwater Lake | MFDELWSEIQDAPGEIFDLDIPELRDTEKFDLNEYLAADYDY |
| Ga0194113_110975233 | 3300020074 | Freshwater Lake | VPERHSMFDELWSEIQESEGEIFDLNIPELRDTEKFDLNEYLNANYDY |
| Ga0194111_104510183 | 3300020083 | Freshwater Lake | VFDELWQEIQDAPGEIFDLDIPELRDNEKFDLNEYLAADYDY |
| Ga0194111_105564211 | 3300020083 | Freshwater Lake | MFDELWSEIQESEGEIFDLNIPELRDTEKFDLNEYLAADY |
| Ga0194111_108150043 | 3300020083 | Freshwater Lake | FDELWSEIQESEGEIFDLNIPELRDTEKFDLNEYLAADYDY |
| Ga0211732_10702226 | 3300020141 | Freshwater | MYDELWSEIADAPGEIFDIPELRDLDDDEKFNVNDYLNSNIDY |
| Ga0211732_11335874 | 3300020141 | Freshwater | MFDELWSEIADSQGEIFDLDIPELKDEKFDVNEYLNSNYDY |
| Ga0211736_102473051 | 3300020151 | Freshwater | MYDELWSEIADAPGEIFDIPELREDEDFNLNEYLNGNIDY |
| Ga0211736_1025614115 | 3300020151 | Freshwater | MFDELWSEIQDAPGEIFDIPELRELDEEKFNLNDYINGNYDY |
| Ga0211736_1033335911 | 3300020151 | Freshwater | MFDELWSEIADSQGEIFDLDIPELKDEKFDLNAYINGDYDY |
| Ga0211736_1037205736 | 3300020151 | Freshwater | MFDELWQEIQDMPGEIFDMDIPELREDNKFDVNEYLNANYDY |
| Ga0211736_106629455 | 3300020151 | Freshwater | MFDELWSEIADAPGEIFDLPELRELDEEKFNVNDYLNSNIDY |
| Ga0211736_107943823 | 3300020151 | Freshwater | MFDELWSEIADSQGEIFDLDIPELKDEKFDVNEYLNANYDY |
| Ga0211734_106331075 | 3300020159 | Freshwater | MYDELWSEIQDAPGEIFDIPELRDLDEENKFNLNEYINGNYDY |
| Ga0211733_103358411 | 3300020160 | Freshwater | LKSQTEVIMFDEMWQEIQDMPGEIFDLDIPELKDEEKFNMNEYLNGDYDY |
| Ga0211726_101481303 | 3300020161 | Freshwater | MFDELWQEIQDMPGEIFDLDIPELKDDETFNMNDYLAADYDF |
| Ga0211726_101843683 | 3300020161 | Freshwater | MYDELWSEIQDAPGEIFDIPELRELEDEKFNLNDYINGNIDY |
| Ga0211726_102468871 | 3300020161 | Freshwater | MFDELWSEIQDMPGEIFDLDIPELKDEEKFNMNEYLNGDYDY |
| Ga0211729_105295606 | 3300020172 | Freshwater | MFDELWQEIQDSPGEIFDIPELRDLEDEKFNVNDYLNSNIDY |
| Ga0211729_109079708 | 3300020172 | Freshwater | MFDELWSEIADSQGEIFDLDIPELKDEKFDVNEYL |
| Ga0211729_109898761 | 3300020172 | Freshwater | LLRGTPMFDELWQEIQDMPGEIFDLDIPELKDDETFNMNDYLAADYDF |
| Ga0194115_100500205 | 3300020183 | Freshwater Lake | MFDELWQEIQETPGEIFDLDIPELRDEKFDVNEYLNANYDY |
| Ga0194115_102453804 | 3300020183 | Freshwater Lake | EKHTMFDELWSEIQDAPGEIFDLDIPELRDPEKFDLNEYLAADYDY |
| Ga0194115_103253303 | 3300020183 | Freshwater Lake | AEKHSMFDELWSEIQDAPGEIFDLDIPELRDPEKFDLNEYLAADYDY |
| Ga0181578_104562632 | 3300020189 | Salt Marsh | MFDELWSEIQDSQGEIFDMDIPELRDEKFDVNEYLNGNIDY |
| Ga0194118_103144601 | 3300020190 | Freshwater Lake | HSMFDELWSEIQDAPGEIFDLDIPELRDTEKFDLNEYLAADYDY |
| Ga0194116_101363274 | 3300020204 | Freshwater Lake | MFDELWSEIQDASGEIFDLDIPELRDTEKFDLNEYLAADYDY |
| Ga0211731_108828052 | 3300020205 | Freshwater | MYDELWSEIQDAPGEIFDIPELREDEDFNLNEYLNGNIDYXNDS |
| Ga0211731_1174841112 | 3300020205 | Freshwater | MWDEIQDMPGEIFDLPELRELDEEKFNLNDYLNSNIDY |
| Ga0194119_106867893 | 3300020220 | Freshwater Lake | VFDELWQEIQDAPGEIFDLDIPELRDNEKFNLNEYLAADYDY |
| Ga0194127_101480875 | 3300020221 | Freshwater Lake | VPERPTVFDELWQEIQDAPGEIFDLDIPELRDNEKFNLNEYLAADYDY |
| Ga0211522_10332042 | 3300020314 | Marine | MFDELWSEINDAQGEIFDIPELQELDQDRKFDVDEYLNSNYDY |
| Ga0211576_1000065015 | 3300020438 | Marine | MDDLLSEIMDSPGEIFDIPELRELEEEEKFNVESFINSNIDY |
| Ga0208049_1107041 | 3300020484 | Freshwater | MFDELWSEIQDAPGEIFDLDIPELKDEKFDVNEYLNSNYDY |
| Ga0208050_100006321 | 3300020498 | Freshwater | MFDELWSEIQDAPGEIFDLDIPELRDTEKFDMNEYLNASYDY |
| Ga0208050_10017225 | 3300020498 | Freshwater | MFDELWSEIQDAPGEIFDLDIPELRDEKFDVNEYLNANYDY |
| Ga0207935_10299912 | 3300020516 | Freshwater | MFDELWQEIQDMPGEIFDLDIPELREGEKFDLNEYLNANYDY |
| Ga0208223_10025659 | 3300020519 | Freshwater | MFDELWQEIQDMPGEIFDLDIPELKDDESFNMNDYLAADYDF |
| Ga0208361_10076034 | 3300020547 | Freshwater | MFDELWSEIQDMPGEIFDLDIPELKDEKFDVNEYLNANYDYXNHDQQR |
| Ga0208362_10519531 | 3300020558 | Freshwater | MFDELWSEIQDAPGEIFDLDIPELKDEKFDVNEYLNSN |
| Ga0208852_10768203 | 3300020560 | Freshwater | QTMFDELWSEIQDMPGEIFDLDIPELRDEKFDVNEYLNANYDY |
| Ga0208221_10080222 | 3300020574 | Freshwater | MFDELWQEIQDMPGEIFDLNVPEIEDQDDGFNLNEYLNADYDY |
| Ga0194122_101754711 | 3300021092 | Freshwater Lake | MDFDTDLWSEIADAPGEIFDIPELREDEDFNFNDYLNADYDY |
| Ga0194122_105855201 | 3300021092 | Freshwater Lake | MFDELWSEIQESEGEIFDLNIPELRDTEKFDLNEYLAADYD |
| Ga0210295_10563012 | 3300021323 | Estuarine | MFDELWSEIQDAPGEIFDLDIPELKDEKFDVNEYLNANYDY |
| Ga0213858_100388762 | 3300021356 | Seawater | MFDELWAEIQDMPGEIFDLDIPELRDENDFNINEYLNSDIDF |
| Ga0213858_102654312 | 3300021356 | Seawater | MFDELWSEIQDCQGEIFDLDIPELREDNKFDVEEYIKGEIDY |
| Ga0194130_102944321 | 3300021376 | Freshwater Lake | PERHSMFDELWSEIQESEGEIFDLNIPELRDTEKFDLNEYLNANYDY |
| Ga0194130_104234744 | 3300021376 | Freshwater Lake | FDELWSEIQDAPGEIFDLDIPELRDTEKFDLNEYLAADYDY |
| Ga0194130_104903301 | 3300021376 | Freshwater Lake | LWSEIQDAPGEIFDLDIPELRDTEKFDLNEYLAADYDY |
| Ga0194117_103167981 | 3300021424 | Freshwater Lake | DELWSEIQESEGEIFDLNIPELRDTEKFDLNEYLAADYDY |
| Ga0194117_103228281 | 3300021424 | Freshwater Lake | MFDELWSEIQESEGEIFDLNIPELRDTEKFDLNEY |
| Ga0213866_100358025 | 3300021425 | Seawater | MFDELWQEIQDAPGEIFDLDIPELRDDEKFDANEYLNGNIDY |
| Ga0213866_100385611 | 3300021425 | Seawater | MYDELWSEIADAPGEIFDLPELRDLEEDKFDVNEYLNSNYDY |
| Ga0213866_103530572 | 3300021425 | Seawater | MYDELWSEIADAPGEIFDLLELQEEQENFDFDGYLAADYDY |
| Ga0222716_102691023 | 3300021959 | Estuarine Water | MFDELWSEIADAPGEIFDIPELQELDQDRKFDVNEYLNGNIDY |
| Ga0222715_100109304 | 3300021960 | Estuarine Water | MFDELWSEIQDAPGEIFDLDIPEIEDQDSFNINEYLNADYDY |
| Ga0222715_102475004 | 3300021960 | Estuarine Water | MFDELWSEIQDAPGEIFDMDIPELKDEKFDMNEYLNGNIDY |
| Ga0222715_104047564 | 3300021960 | Estuarine Water | FDELWSEIQDAPGEIFDIPELRELDEENKFNYNEYILGNIDY |
| Ga0222715_105140161 | 3300021960 | Estuarine Water | MFDELWNEIQDMPGEIFDMDIPELKDEKFDVNEYLNANYDY |
| Ga0222714_1000045410 | 3300021961 | Estuarine Water | MFDELWSEIADAPGEIFDIPEMQELDQDRKFDVNEYLNSNYDY |
| Ga0222714_100079098 | 3300021961 | Estuarine Water | MFDELWQEIQDMPGEIFDLDIPELRDTEKFDMNEYLNANYDY |
| Ga0222714_1001587516 | 3300021961 | Estuarine Water | MDFDTDFWGEIQDAPGEIFDIPEFDDADDFNLNEYLNADYDY |
| Ga0222714_100448818 | 3300021961 | Estuarine Water | MFDEMWQEIQDAPGEIFDIPELRDEEDFNMNEYLNGNYDY |
| Ga0222714_100888506 | 3300021961 | Estuarine Water | MFDELWSEIQDAPGEIFDIPELQDEKFDVNEYLNSNYDY |
| Ga0222714_101160584 | 3300021961 | Estuarine Water | MYDELWSEIVDAPGEIFDIPELRELDEENKFNYNEYILGNIDY |
| Ga0222714_101161473 | 3300021961 | Estuarine Water | MFDELWSEIADAPGEIFDMDIPELKDEKFDVNEYLNANYDY |
| Ga0222714_101385991 | 3300021961 | Estuarine Water | MFDELWNEIQDMPGEIFDMDIPELKDEKFDVNEYLNGNIDY |
| Ga0222714_101717614 | 3300021961 | Estuarine Water | MFDELWSEIQDAPGEIFDLDIPELRDTEKFDVNEYLNANYDY |
| Ga0222714_103466374 | 3300021961 | Estuarine Water | MFDELWSEIQDMPGEIFDMDIPELKDEKFDVNEYLNANYDY |
| Ga0222714_104647591 | 3300021961 | Estuarine Water | MFDEMWQEIQDMPGEIFDLDIPELRDTEKFDVNEYLNANYDY |
| Ga0222714_106208311 | 3300021961 | Estuarine Water | ISMFDELWSEIQDAPGEIFDLDIPELKDEKFDVNEYLNANYDY |
| Ga0222713_100320759 | 3300021962 | Estuarine Water | MFDELWSEIQDMPGEIYDLDIPELKEEDFNMTEYINGDYDY |
| Ga0222713_100540016 | 3300021962 | Estuarine Water | MFEELWSEIVDAPGEIFDIPELRELDEENKFNYNEYILGNIDY |
| Ga0222713_101412666 | 3300021962 | Estuarine Water | RGTPMFDEMWQEIQDMPGEIFDLDIPELRDTEKFDVNEYLNANYDY |
| Ga0222712_1000016966 | 3300021963 | Estuarine Water | MFDELWNEIQETPGEIFDILELQEEQEKFDFDGYLAADYDF |
| Ga0222712_1000188620 | 3300021963 | Estuarine Water | MYDELWSEIQDAPGEIFDIPEMQDNEDFNFDEYLKGDYDY |
| Ga0222712_101276154 | 3300021963 | Estuarine Water | MFDELWSEIQDAPGEIFDLDIPELRDTEKFDMNEYLNASYDYXCQFS |
| Ga0222712_102889542 | 3300021963 | Estuarine Water | MEDTLWTEIADMDGEIFDMEIPELKQEKFDFNEYINGNYDY |
| Ga0222712_104146013 | 3300021963 | Estuarine Water | MYDELWSEIQDMPGEIFDLDIPELKDEKFDVNEYLNANYDY |
| Ga0222712_105577392 | 3300021963 | Estuarine Water | MFDELWSEIQDAPGEIFDIPELNDEEFNLNEYLAADYDY |
| Ga0222712_106233831 | 3300021963 | Estuarine Water | MFDELWSEIQDAPGEIFDLDIPELRDEEKFNINEYLNSNYDY |
| Ga0222719_102420082 | 3300021964 | Estuarine Water | MFDELWSEIQDMPGEIFDIPEMRELDDDNKFNVEDYLKADYDY |
| Ga0212029_10625871 | 3300022063 | Aqueous | MFDELWTEIQDMPGEIFDLDIPELEEDSDKFNVNEYLNSNYDY |
| Ga0212026_10611742 | 3300022069 | Aqueous | MFDELWFEIQDCQGEIFDLDIPELREDNKFDVEEYIKGEIDY |
| Ga0212031_10130766 | 3300022176 | Aqueous | MFDEMWQEIQDAPGEIFDIPELHDEEDFNLNEYLNANYDY |
| Ga0212031_10642111 | 3300022176 | Aqueous | MFDEMWQEIQDAPGEIFDIPELRDEEDFNLNEYINGNIDY |
| Ga0196905_10065486 | 3300022198 | Aqueous | MFDELWSEIQDAPGEIFDLDIPELKEEDFNLTEYINGEYDY |
| Ga0196905_10135296 | 3300022198 | Aqueous | MFDEMWQEIQDAPGEIFDLDIPELRDEKFDVNEYINGNIDY |
| Ga0196905_10236185 | 3300022198 | Aqueous | MFDELWSEIQDMPGEIFDIPEIQDEQEFNLKEYMEGDYDY |
| Ga0196905_10297373 | 3300022198 | Aqueous | MFDELWSEIQDAPGEIFDMDIPELRDEEQFNMNEYLNANYDY |
| Ga0196905_10362693 | 3300022198 | Aqueous | MFDEMWQEIADAPGEIFDMDIPELRDEKFDVNEYLNGNIDY |
| Ga0196905_10418441 | 3300022198 | Aqueous | MFDEMWQEIQDAPGEIFDIPELRDDEDFNLNEYINGNIDY |
| Ga0196905_11037292 | 3300022198 | Aqueous | MFDELWSEIQDSQGEIFDLDIPELKDEKFDVNEYLNGNIDY |
| Ga0196905_11133053 | 3300022198 | Aqueous | MFDELWSEIADAPGEIFDIPELQELDEDRKFDVNEYLNANYDY |
| Ga0196901_10122617 | 3300022200 | Aqueous | MFDELWSEIQDMPGEIFDLDIPELKDDDDFNVNDYLAGDYDY |
| Ga0196901_10827674 | 3300022200 | Aqueous | MFDELWSEIQDMQGEIFDLDIPELREDDFNFNDYVAADYDY |
| Ga0196901_11669613 | 3300022200 | Aqueous | MFDELWNEIQDMPGEIFDMDIPELKDEKFDVNEYLNGNI |
| Ga0196901_11871261 | 3300022200 | Aqueous | ERHTMFDELWSEIQESQGEIFDMDIPELRDTEKFDMNEYLNANYDY |
| Ga0196901_12221393 | 3300022200 | Aqueous | MFDELWSEIQDMPGEIFDIPEIQDEQEFNLKEYMEGDYD |
| Ga0196901_12425761 | 3300022200 | Aqueous | MFDELWIEIQDAPGEIFDIPELRDLDDEKFDVNDYINGNYDYXCCFKSP |
| Ga0181351_100676414 | 3300022407 | Freshwater Lake | ELWSEIADSQGEIFDLDIPELKDEKFDVNEYLNANYDY |
| Ga0181351_10199382 | 3300022407 | Freshwater Lake | MFDELWTEIADSQGEIFDLDIPELRDEKFDVNEYLNANYDY |
| Ga0255755_11348631 | 3300022909 | Salt Marsh | VVRNRPMFDELWSEIQDAPGEIFDIPEMQELDEDKKFDVNDYLNSDIDY |
| Ga0255754_102617571 | 3300022939 | Salt Marsh | VVRNRPMFDELWSEIQDAPGEIFDIPEMQELDEDKKFDVNDYLKSNIDY |
| Ga0255782_101670294 | 3300023105 | Salt Marsh | MFDELWSEIQDAPGEIFDIPEMQELDEDKKFDVNDYLNS |
| Ga0255784_101584061 | 3300023108 | Salt Marsh | MFDELWSEIQDAPGEIFDIPEMQELDEDKKFDVNDYLNSDI |
| Ga0255766_104907152 | 3300023172 | Salt Marsh | MFDELWSEIQDSQGEIFDMDIPELKDEKFDVNEYLNG |
| (restricted) Ga0233412_1000010132 | 3300023210 | Seawater | MDDLLSEIMDSPGEIFDIPELRELEEEEKFNVENFINSNIDY |
| Ga0210003_10082063 | 3300024262 | Deep Subsurface | MFDELWSEIADAPGEIFDLPELRDLEEGKFDVNEYLNSNIDY |
| Ga0210003_10517431 | 3300024262 | Deep Subsurface | MFDELWSEIADAPGEIFDLPELRELDEEKFNLNDYLNSNIDY |
| Ga0210003_12173871 | 3300024262 | Deep Subsurface | QDSPGEIFDITDLQEEEEKFDFDGYLAADYDFXLWEL |
| Ga0210003_12939331 | 3300024262 | Deep Subsurface | MFEELWNEIQDSPGEIFDITDLQEEEEKFDFDGYLAADYDFXLWEL |
| Ga0244777_100000461 | 3300024343 | Estuarine | ELWSEIADAPGEIFDLPELRELDEEKFNLNDYLNSNIDY |
| Ga0244777_106637261 | 3300024343 | Estuarine | MFDELWSEIQDAPGEIFDIPELRELDEENKFNYNEYILGNIDY |
| Ga0244775_100066889 | 3300024346 | Estuarine | MFDELWSEIQDAPGEIFDIPELRDLEDEKFDVNEYLNSNIDY |
| Ga0244775_103108646 | 3300024346 | Estuarine | MFDELWSEIADAPGEIFDIPELQELDQDRKFDVNEYLNSNIDY |
| Ga0244775_109171723 | 3300024346 | Estuarine | MFDELWQEIQDMPGEIFDIPEMDDKEDFNMNEYLNGDYDY |
| Ga0244776_101528001 | 3300024348 | Estuarine | EIADAPGEIFDLPELRELDEEKFNLNDYLNSNIDY |
| Ga0244776_106418152 | 3300024348 | Estuarine | MFDELWNEIQDMPGEIFDMDIPELKDEKFDVNEYLNGNYDY |
| Ga0255223_10021788 | 3300024480 | Freshwater | MFDEMWSEIQDAPGEIFDMDIPELRDDEKFDVNEYLNANYDY |
| Ga0208667_10104034 | 3300025070 | Marine | MDDLLSEIMDTPGEIFDIPELRELEEEEKFNVENFINSNIDY |
| Ga0209498_10742004 | 3300025135 | Sediment | MFDELWQEIQDSPGEIFDLDILELRDDEKFNLNEYLNANYDY |
| Ga0208546_100082219 | 3300025585 | Aqueous | MFDELWTEIQDAPGEIFDIPELRELDEENKFNYNEYILGNIDY |
| Ga0208161_10001647 | 3300025646 | Aqueous | MFDELWTEIQDMPGEIFDLDIPELEEDSDKFNVNEYLNSNYDYX |
| Ga0208161_100207714 | 3300025646 | Aqueous | MFDEDFSNDLWQEIQDSSGEIFDLDIPELKEDDGFNLSDYFAGDYDY |
| Ga0208161_10135091 | 3300025646 | Aqueous | MFDELWSEIQDMPGEIFDIPEIQDEEEFNLKEYMEGDYDY |
| Ga0208161_10504264 | 3300025646 | Aqueous | MFDELWSEIQDSQGEIFDMDIPELRDTEKFDMNEYLNANYDY |
| Ga0208161_11108321 | 3300025646 | Aqueous | LRGALPPMFDELWSEIQDAPGEIFDLDIPELKEEDFNLTEYINGEYDY |
| Ga0208795_10909473 | 3300025655 | Aqueous | MFDEMWQEIADAPGEIFDMDIPELRDEKFDVNEYLNGNI |
| Ga0208898_11069042 | 3300025671 | Aqueous | MFDELWSEIQDMPGEIFDIPEIRDDEKFNLKEYMEGDYDY |
| Ga0208162_10089066 | 3300025674 | Aqueous | MFDEMWQEIQDSPGEIFDLPELRDEEDFNLNEYINGNIDY |
| Ga0208162_10600992 | 3300025674 | Aqueous | MFDELWSEIADSQGEIFDLDIPELRDDNEKFDFDGYLAADYDY |
| Ga0208019_10365814 | 3300025687 | Aqueous | MFDELWSEIQDMPGEIFDMDIPELKDEKFDVNEYLKGNIDY |
| Ga0208019_10577914 | 3300025687 | Aqueous | METDYLWSEIQDMPGEIFDIPEIQDEEEFNLKEYMEGDYDY |
| Ga0208019_10800451 | 3300025687 | Aqueous | MYDELWSEIADAPGEIFDLPELRDLEEDKFDVNEYLNSDYDY |
| Ga0208645_10966146 | 3300025853 | Aqueous | MFDELWFEIQDCQGEIFDLDIPELREDNKFDVEEYIKGEI |
| Ga0208644_10681982 | 3300025889 | Aqueous | MFDELWSEIQDSQGEIFDLDIPELKDEKFDVNEYLNSNYDY |
| Ga0209856_10038673 | 3300026837 | Sand | MYDELWSEIQDAPGEIFDIPELRELEEEKFNLNDYINGNYDY |
| Ga0209851_10030284 | 3300026902 | Sand | MFDELWSEIQDMPGEIFDLDIPELRDTEKFDMNEYLNASYDYX |
| Ga0255074_10086314 | 3300027121 | Freshwater | WSEIQDAPGEIFDLDIPELKDEKFDVNEYLNANYDY |
| Ga0255090_10232124 | 3300027123 | Freshwater | MFDEMWSEIQDAPGEIFDMDIPELRDDEKFDVNEYLNANYDYXXTIS |
| Ga0255065_10123722 | 3300027142 | Freshwater | MFDELWSEIQDAPGEIFDIPELRDDEDFNLNEYLAADYDY |
| Ga0255078_11064131 | 3300027156 | Freshwater | MFDELWSEIQDMPGEIFDLDIPELKDEKFDVNEYLNGNIDY |
| Ga0208802_10165821 | 3300027210 | Estuarine | MFDELWSEIQDMPGEIFDLDIPELRDEKFDVNEYLNANYDY |
| Ga0208442_100211712 | 3300027229 | Estuarine | LWSEIADAPGEIFDLPELRELDEEKFNLNDYLNSNIDY |
| Ga0208811_100031628 | 3300027314 | Estuarine | SEIADAPGEIFDLPELRELDEEKFNLNDYLNSNIDY |
| Ga0209867_10007735 | 3300027393 | Sand | MEDTLWTEIADMEGEIFDLDIPELKQEKFDFNEYINANYDY |
| Ga0255085_11188282 | 3300027538 | Freshwater | MFDELWSEIQDAPGEIFDLDIPELKDEKFDVNEYLNANYDYX |
| Ga0208897_10308643 | 3300027571 | Estuarine | MFDELWSEIQDAPGEIFDLDIPELKEEDFNLTEYING |
| Ga0255088_10656721 | 3300027597 | Freshwater | FLRDTPTMYDELWSEIQDAPGEIFDIPELRELEEEKFNLNDYINGNIDY |
| Ga0208975_12163122 | 3300027659 | Freshwater Lentic | MFDEMWQEIQDMPGEIFDLDIPELKDEKFDVNEYLNANYDY |
| Ga0209553_10478162 | 3300027688 | Freshwater Lake | MFDELWSEIADSQGEIFDLDIPELNDEKFDVNEYLNANYDY |
| Ga0209704_12055222 | 3300027693 | Freshwater Sediment | MFDEMWQEIQDAPGEIFDLDIPELREGEKFDVNEYLNANYDY |
| Ga0209443_10921291 | 3300027707 | Freshwater Lake | MFDELWSEIQDSQGEIFDIPELRELEEEKFNLNDYINGNIDY |
| Ga0209492_10297725 | 3300027721 | Freshwater Sediment | MFDELWSEIQDMPGEIFDMDIPELRDTEKFDVNEYLNANYDY |
| Ga0209444_102426502 | 3300027756 | Freshwater Lake | MFDELWSEIQDAPGEIFDIPELRELEEEKFDVNEYLNSNIDY |
| Ga0209296_100142910 | 3300027759 | Freshwater Lake | MFDELWSEIQDAPGEIFDMDIPELRDEKFDVNEYLNSNYDY |
| Ga0209296_10026708 | 3300027759 | Freshwater Lake | MFDELWQEIQDSPGEIFDIPELRDLEEEKFNVNEYLNSDYDY |
| Ga0209288_1000054510 | 3300027762 | Freshwater Sediment | MDFDTYILNEIEDSDAEIFDIPEFHDEEFDMNEYLNGNYDY |
| Ga0209088_100164814 | 3300027763 | Freshwater Lake | MEDTLWTEIADMDGEIFDLDIPELKQEKFDFNEYINANYDY |
| Ga0209088_101345754 | 3300027763 | Freshwater Lake | MEDTLWSEIADMEGEIFDLDIPELKQEKFDFNEYLNANYDY |
| Ga0209770_100256267 | 3300027769 | Freshwater Lake | MFDEMWQEIQDAPGEIFDIPEMNDEDFNLNEYLAADYDY |
| Ga0209990_102132745 | 3300027816 | Freshwater Lake | LWSEIQDMPGEIFDLDIPELKDEESFNMNEYLNADYDY |
| Ga0209668_101734765 | 3300027899 | Freshwater Lake Sediment | MFDELWSEIQDAPGEIFDLDIPELRDEKFDVNEYLNADYDF |
| Ga0209536_1000931633 | 3300027917 | Marine Sediment | MFDEMWQEIQDAPGEIFDIPELRDLDDEKFNVNDYINGNYDY |
| Ga0209536_1001530645 | 3300027917 | Marine Sediment | MFDELWSEIQDAPGEIFDLDIPELRDDNEKFDFDGYLAADYDY |
| Ga0209536_1008315043 | 3300027917 | Marine Sediment | MFDELWTEIADAPGEIFDIPEMQELEEKFDVNEYLNGNYDY |
| Ga0209536_1013774402 | 3300027917 | Marine Sediment | MFDEMWQEIQDAPGEIFDIPELRDDEEFNLNEYINGNIDYA |
| Ga0209536_1024051701 | 3300027917 | Marine Sediment | MFDELWSEIQDMPGEIFDLDIPEPEEDSDKFNVNEYLNSNYDY |
| Ga0209536_1026279812 | 3300027917 | Marine Sediment | MFDELWSEIQESQGEIFDMDIPELKDEKFDVNEYLKGDYDY |
| Ga0209820_10291861 | 3300027956 | Freshwater Sediment | SEIVDAPGEIFDIPELRDLDDDEKFNVNDYLNSNIDY |
| Ga0209820_10737683 | 3300027956 | Freshwater Sediment | MFDELWSEIQDMPGEIFDMDIPELRDEEKFNVNEYLNANYDY |
| Ga0209079_101957864 | 3300027972 | Freshwater Sediment | APMFDELWSEIQDMPGEIFDMDIPELRDEEKFNVNEYLNANYDY |
| Ga0255227_10745151 | 3300028266 | Freshwater | SPMFDEMWSEIQDAPGEIFDMDIPELRDDEKFDVNEYLNANYDY |
| Ga0272443_102887263 | 3300028883 | Marine Sediment | MFDELWSEIQDSQGEIFDLDIPELREDNKFDVEEYIKGEIDY |
| Ga0168647_10092610 | 3300029199 | Deep Subsurface | MFDELWTEIQETPGEIFDILELQEEQEKFDFDGYLAADYDY |
| Ga0119944_100001133 | 3300029930 | Aquatic | MFDEMWQEIQDMPGEIFDLDIPELREDNKFDVNEYLNANYDY |
| Ga0119944_10016898 | 3300029930 | Aquatic | MFDELWQEIQDAPGEIFDLDIPELKDEKFDVNEYLNANYDYX |
| Ga0119944_10018547 | 3300029930 | Aquatic | MFDELWSEIQDAPGEIFDIPELNDEDFNMNEYLAADYDY |
| Ga0119944_10081843 | 3300029930 | Aquatic | MYDELWSEIADAPGEIFDIPELNDEEFNMNEYLAADYDY |
| Ga0119944_10166222 | 3300029930 | Aquatic | MFDELWQEIQDMPGEIFDLDIPELKDEKFDVNEYLNANYDY |
| Ga0119944_10171356 | 3300029930 | Aquatic | FDELWQEIQDMPGEIFDLDIPELRDEKFDVNEYLNASYDY |
| Ga0119944_10206192 | 3300029930 | Aquatic | MFDEMWQEIQDMPGEIFDLDIPELRDDEKFDMNEYLNASYDY |
| Ga0119944_10259552 | 3300029930 | Aquatic | MFDELWQEIQDAPGEIFDIPELNDEEFNMNEYLAADYDY |
| Ga0119944_10293563 | 3300029930 | Aquatic | MFDELWQEIQDAPGEIFDLDIPELKDEKFDVNEYLNANYDY |
| Ga0119944_10437013 | 3300029930 | Aquatic | RQTMFDELWSEIQDAPGEIFDIPELRELDEENKFDYNEYILSNIDY |
| Ga0119945_10085702 | 3300029933 | Aquatic | MFDELWQEIQDMPGEIFDLDIPELRDEKFDVNEYLNASYDY |
| Ga0119945_10241862 | 3300029933 | Aquatic | MYDELWVEIADAPGEIFDIPELRDDEDFNLNDYLAADYDY |
| Ga0119945_10271433 | 3300029933 | Aquatic | MFDELWSEIQDAPGEIFDIPELRELDEENKFDYNEYILSNIDY |
| Ga0119945_10315541 | 3300029933 | Aquatic | MFDELWSEIQDAPGEIFDIPELRDEEDFNLNEYLNGNYDY |
| Ga0119945_10332913 | 3300029933 | Aquatic | MFDELWQEIQDAPGEIFDIPELNDEEFNLNEYLAADYDY |
| Ga0307378_103152861 | 3300031566 | Soil | TDPMFEELWSEIQDAPGEIFDLPELRELDEEKFNLNDYLNSNIDY |
| Ga0307378_106237533 | 3300031566 | Soil | MFEELWNEIQDSPGEIFDITDLQEEEEKFDFDGYLAADYDF |
| Ga0307378_106309385 | 3300031566 | Soil | PKQMFEELWSEIQDAPGEIFDLDIPELQDKEKFNFDEYLKGDYDY |
| Ga0307377_111632052 | 3300031673 | Soil | DTPTMFDELWSEIADAPGEIFDLPELRDLEEGKFDVNEYLNSNIDY |
| Ga0315291_103039833 | 3300031707 | Sediment | MFDELWSEIQDAPGEIFDLPELRDLDEEKFNLNDYLNSNIDY |
| Ga0315291_107073503 | 3300031707 | Sediment | MEDTLWTEIADMDGEIFDMEIPELKQEKFDFNEYLNANYDY |
| Ga0315291_109447582 | 3300031707 | Sediment | MEDTLWSEIADMDGEIFDMEIPELKQEKFDFNEYLNANYD |
| Ga0315293_100493653 | 3300031746 | Sediment | MYDELWQEIQDSPGEIFDIPELRDLEDEKFDVNAYLNSNIDY |
| Ga0315293_109532192 | 3300031746 | Sediment | MFDELWSEIQDAPGEIFDIPELRELDEENKFNLNDYINGNIDY |
| Ga0315293_110568011 | 3300031746 | Sediment | MYDELWSEIADSQGEIFDMDIPELRDEKFDVNEYLNSNIDY |
| Ga0315907_100494607 | 3300031758 | Freshwater | MFDELWQEIQDMPGEIFDLDIPELREGEKFDVNEYLNANYDY |
| Ga0315907_104264943 | 3300031758 | Freshwater | MFDELWSEIQDAPGEIFDLNIPELRDDEKFDFDGYLAADYDF |
| Ga0315907_110855721 | 3300031758 | Freshwater | VPERHTMFDELWQEIQDAPGEIFDIPELRDEEKFDVNEYLNANYDY |
| Ga0315288_106858242 | 3300031772 | Sediment | MFDELWSEIADSQGEIFDMDIPELRDEKFDVNEYLNSNVDY |
| Ga0315288_108491952 | 3300031772 | Sediment | MYDELWQEIQDSPGEIFDIPELRELDEENKFNLNDYINGNYDY |
| Ga0315899_101164586 | 3300031784 | Freshwater | MFDELWIEIQDAPGEIFDMDIPELRDEEKFNVNEYLNANYDY |
| Ga0315900_103212235 | 3300031787 | Freshwater | FDELWSEIQDAPGEIFDMDIPELKDEKFDVNEYLNGNYDY |
| Ga0315900_104004164 | 3300031787 | Freshwater | MFDELWSEIQDAPGEIFDMDIPELKDEKFDVNEYLNANYDY |
| Ga0315900_109780651 | 3300031787 | Freshwater | MFDELWQEIQDAPGEIFDLPELRDLDDEKFDVNEYLNANYDY |
| Ga0315290_102101743 | 3300031834 | Sediment | MEDTLWTEIADMDGEIFDLDIPELKQEKFDFNEYINSNIDY |
| Ga0315909_109695002 | 3300031857 | Freshwater | MFDELWSEIQDAPGEIFDIPEMQDSKDFNLDEYLK |
| Ga0315297_103860912 | 3300031873 | Sediment | MEDTLWSEIADMDGEIFDMEIPELKQEKFDFNEYINANYDY |
| Ga0315285_107620561 | 3300031885 | Sediment | MEDTLWTEIADMDGEIFDMEIPELKQEKFDFNEYINANYDY |
| Ga0315904_102190756 | 3300031951 | Freshwater | MFDELWSEIQDMPGEIFDLDIPELKDEKFDVNEYLNGNYDY |
| Ga0315904_103761462 | 3300031951 | Freshwater | MFDELWSEIQEAPGEIFDLDIPELRDDEQFNMNEYLNADYDY |
| Ga0315294_100970394 | 3300031952 | Sediment | MEDTLWTEIADMDGEIFDMEIPELKQEKFDFNEYINSNIDY |
| Ga0315294_114907671 | 3300031952 | Sediment | MYDELWQEIQDSPGEIFDIPELRDLEDEKFDVNAYLNSNID |
| Ga0315901_101325161 | 3300031963 | Freshwater | DELWSEIQDMPGEIFDLDIPELKDEKFDVNEYLNGNYDY |
| Ga0315901_102941964 | 3300031963 | Freshwater | MFDELWQEIQDMPGEIFDMDIPELREDNKFDVNEYLNANYDYXC |
| Ga0315274_113773031 | 3300031999 | Sediment | ELWSEIADSQGEIFDMDIPELRDEKFDVNEYLNSNIDY |
| Ga0315272_106679582 | 3300032018 | Sediment | MEDTLWSEIADMEGEIFDLDIPELKQEKFDFNEYINANYDY |
| Ga0315906_111396092 | 3300032050 | Freshwater | MFDELWSEIQDAPGEIFDMDIPELKDEKFDVNEYLNGNYDY |
| Ga0315284_113126072 | 3300032053 | Sediment | MEDTLWSEIADMDGEIFDMEIPELKQEKFDFNEYINANYDYXNENR |
| Ga0315902_105592301 | 3300032093 | Freshwater | MTDELWSEIQDAPGEIFDIPEMQDSKDFNLDEYLKGDYDYXNPLPRT |
| Ga0315268_100672588 | 3300032173 | Sediment | MFDELWSEIQDAPGEIFDLPELRELDEEKFNLNDYLNSNIDY |
| Ga0315268_102471971 | 3300032173 | Sediment | MFDELWSEIQDAPGEIFDIPELQDEKFDVNEYLNSHR |
| Ga0315268_103639571 | 3300032173 | Sediment | MYDELWSEIVDAPGEIFDLPELRDEKDFDLNEYLNANYDY |
| Ga0316625_1007312132 | 3300033418 | Soil | MFDELWSEIQDAPGEIFDMDIPELRDDDKFDVNEYLNADYDY |
| Ga0316617_1019655792 | 3300033557 | Soil | MFDELWSEIQDAPGEIFDLDIPELRDDEKFNVNEYLNANYDY |
| Ga0334980_0010862_3813_3944 | 3300033816 | Freshwater | MFDELWSEIADAPGEIFDIPELRDLDDENKFNVNEYLNANYDY |
| Ga0334980_0029362_24_155 | 3300033816 | Freshwater | MFDELWSEIADAPGEIFDIPELRDLDDENKFNVNEYLAADYDY |
| Ga0334982_0021691_767_889 | 3300033981 | Freshwater | MYDELWTEIVDAPGELFDIPELREDEGFDFNEYLTADYDY |
| Ga0334982_0394557_523_630 | 3300033981 | Freshwater | LWSEIQDMPGEIFDIVEDYDDKFDFNEYMNADYDY |
| Ga0334982_0503208_418_534 | 3300033981 | Freshwater | DKLWTEIVDAPGEIFDIPELREDEGFDFNEYLTADYDY |
| Ga0334996_0010146_637_765 | 3300033994 | Freshwater | MFDELWQEIQDAPGEIFDIPELRDLDDDKFDVNDYINGNYDY |
| Ga0334979_0085051_1321_1446 | 3300033996 | Freshwater | MFDELWSEIADSQGEIFDLDIPELRDEKFDVNEYLNANYDY |
| Ga0334986_0108092_201_329 | 3300034012 | Freshwater | MFDELWSEIQEAPGEIFDLDIPELRDEEKFDVNEYLNGNYDY |
| Ga0334998_0573746_90_236 | 3300034019 | Freshwater | MAMFLRDTMYDELWTEIVDAPGEIFDIPELREDEAFDFNEYLTADYDY |
| Ga0334987_0603960_84_212 | 3300034061 | Freshwater | MFDELWSEIQDAPGEIFDMDIPELRDTEKFDVNEYLNANYDY |
| Ga0334995_0062291_2662_2787 | 3300034062 | Freshwater | MFDELWSEIQDSPGDIFDMDIPELKDEKFDVNEYLNANYDY |
| Ga0334995_0452739_479_607 | 3300034062 | Freshwater | MFDELWQEIQDAPGEIFDLDIPELRDTEKFDVNEYLNANYDY |
| Ga0334995_0669060_190_318 | 3300034062 | Freshwater | MFDEMWQEIQDAPGEIFDIPELRDLDDDKFDVNDYINGNYDY |
| Ga0335000_0580664_180_308 | 3300034063 | Freshwater | MFDELWSEIQDAPGEIFDLDIPELRDEEKFDVNEYLNANYDY |
| Ga0335028_0088078_1940_2047 | 3300034071 | Freshwater | MFDELWSEIQDAPGEIFDLDIPELKDEKFDVNEYLN |
| Ga0310130_0011997_171_296 | 3300034073 | Fracking Water | MFDEMWQEIQDAPGEIFDLDIPELRDDKFDVNEYLNADYDY |
| Ga0310130_0038939_538_666 | 3300034073 | Fracking Water | MFDELWSEIQEAPGEIFDLDIPELRDTKEFDMNEYLNADYDY |
| Ga0335025_0659600_402_509 | 3300034096 | Freshwater | MFDELWSEIQDAPGEIFDLDIPELRDEKFDVNEYLN |
| Ga0335029_0008916_1008_1130 | 3300034102 | Freshwater | MYDELWTEIQDAPGEIFDIPELRDDEDFNVNEYLNSNYDY |
| Ga0335029_0009259_7412_7540 | 3300034102 | Freshwater | MFDELWSEIQEAPGEIFDLDIPELRDEEKFDVNEYLNANYDY |
| Ga0335029_0011146_2512_2640 | 3300034102 | Freshwater | MFEELWSEIQDAPGEIFDLNIPEIEDSEDFNFNDYLNGDYEY |
| Ga0335030_0301474_341_463 | 3300034103 | Freshwater | MFDELWSEIQDAPGEIFDIPELRDEEDFNLNEYLNANYDY |
| Ga0335031_0243463_357_488 | 3300034104 | Freshwater | MFDELWSEIQDAPGEIFDLPELRDLDEDNKFDVNEYLNGNYDY |
| Ga0335066_0247439_23_148 | 3300034112 | Freshwater | MFDELWSEIQDMPPEIFDLDIPELKDEKFDVNEYLNANYDY |
| Ga0335049_0213605_183_302 | 3300034272 | Freshwater | MFDELWSEIQDAPGEIFDIPELNDEEFNLNEYLAANYDY |
| ⦗Top⦘ |