


| Basic Information | |
|---|---|
| Family ID | F001520 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 679 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MNAIKFLFAAYIATWVIHGVYLGSLVRRFSRLRQQLKELGKGK |
| Number of Associated Samples | 297 |
| Number of Associated Scaffolds | 679 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 88.92 % |
| % of genes near scaffold ends (potentially truncated) | 14.73 % |
| % of genes from short scaffolds (< 2000 bps) | 65.24 % |
| Associated GOLD sequencing projects | 255 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.46 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (94.845 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (12.960 % of family members) |
| Environment Ontology (ENVO) | Unclassified (25.773 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (61.561 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 54.93% β-sheet: 0.00% Coil/Unstructured: 45.07% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 679 Family Scaffolds |
|---|---|---|
| PF01578 | Cytochrom_C_asm | 28.87 |
| PF07238 | PilZ | 16.94 |
| PF00535 | Glycos_transf_2 | 6.19 |
| PF03379 | CcmB | 5.45 |
| PF00005 | ABC_tran | 5.01 |
| PF01797 | Y1_Tnp | 3.39 |
| PF03100 | CcmE | 1.62 |
| PF06739 | SBBP | 1.62 |
| PF01431 | Peptidase_M13 | 1.18 |
| PF00719 | Pyrophosphatase | 0.59 |
| PF02954 | HTH_8 | 0.59 |
| PF01740 | STAS | 0.59 |
| PF08241 | Methyltransf_11 | 0.59 |
| PF03551 | PadR | 0.44 |
| PF09721 | Exosortase_EpsH | 0.29 |
| PF00392 | GntR | 0.29 |
| PF14306 | PUA_2 | 0.29 |
| PF05649 | Peptidase_M13_N | 0.29 |
| PF01915 | Glyco_hydro_3_C | 0.29 |
| PF13847 | Methyltransf_31 | 0.15 |
| PF01145 | Band_7 | 0.15 |
| PF13828 | DUF4190 | 0.15 |
| PF05016 | ParE_toxin | 0.15 |
| PF11138 | DUF2911 | 0.15 |
| PF03572 | Peptidase_S41 | 0.15 |
| PF02771 | Acyl-CoA_dh_N | 0.15 |
| PF00486 | Trans_reg_C | 0.15 |
| PF00588 | SpoU_methylase | 0.15 |
| PF00117 | GATase | 0.15 |
| PF14559 | TPR_19 | 0.15 |
| PF08695 | Coa1 | 0.15 |
| PF13401 | AAA_22 | 0.15 |
| PF08533 | Glyco_hydro_42C | 0.15 |
| PF01850 | PIN | 0.15 |
| PF14378 | PAP2_3 | 0.15 |
| PF02803 | Thiolase_C | 0.15 |
| PF02563 | Poly_export | 0.15 |
| PF01212 | Beta_elim_lyase | 0.15 |
| PF13229 | Beta_helix | 0.15 |
| PF00691 | OmpA | 0.15 |
| PF07676 | PD40 | 0.15 |
| PF07606 | DUF1569 | 0.15 |
| PF00999 | Na_H_Exchanger | 0.15 |
| PF00905 | Transpeptidase | 0.15 |
| PF03841 | SelA | 0.15 |
| PF02706 | Wzz | 0.15 |
| PF00361 | Proton_antipo_M | 0.15 |
| PF09360 | zf-CDGSH | 0.15 |
| PF13618 | Gluconate_2-dh3 | 0.15 |
| PF01182 | Glucosamine_iso | 0.15 |
| PF14310 | Fn3-like | 0.15 |
| PF01370 | Epimerase | 0.15 |
| PF13492 | GAF_3 | 0.15 |
| PF11984 | DUF3485 | 0.15 |
| PF03641 | Lysine_decarbox | 0.15 |
| PF13419 | HAD_2 | 0.15 |
| PF07394 | DUF1501 | 0.15 |
| PF09517 | RE_Eco29kI | 0.15 |
| COG ID | Name | Functional Category | % Frequency in 679 Family Scaffolds |
|---|---|---|---|
| COG2386 | ABC-type transport system involved in cytochrome c biogenesis, permease component | Posttranslational modification, protein turnover, chaperones [O] | 5.45 |
| COG1943 | REP element-mobilizing transposase RayT | Mobilome: prophages, transposons [X] | 3.39 |
| COG2332 | Cytochrome c biogenesis protein CcmE | Posttranslational modification, protein turnover, chaperones [O] | 1.62 |
| COG3590 | Predicted metalloendopeptidase | Posttranslational modification, protein turnover, chaperones [O] | 1.47 |
| COG0221 | Inorganic pyrophosphatase | Energy production and conversion [C] | 0.59 |
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.44 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.44 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.44 |
| COG1167 | DNA-binding transcriptional regulator, MocR family, contains an aminotransferase domain | Transcription [K] | 0.29 |
| COG1472 | Periplasmic beta-glucosidase and related glycosidases | Carbohydrate transport and metabolism [G] | 0.29 |
| COG1921 | Seryl-tRNA(Sec) selenium transferase | Translation, ribosomal structure and biogenesis [J] | 0.29 |
| COG0025 | NhaP-type Na+/H+ or K+/H+ antiporter | Inorganic ion transport and metabolism [P] | 0.15 |
| COG0075 | Archaeal aspartate aminotransferase or a related aminotransferase, includes purine catabolism protein PucG | Amino acid transport and metabolism [E] | 0.15 |
| COG0076 | Glutamate or tyrosine decarboxylase or a related PLP-dependent protein | Amino acid transport and metabolism [E] | 0.15 |
| COG0112 | Glycine/serine hydroxymethyltransferase | Amino acid transport and metabolism [E] | 0.15 |
| COG0156 | 7-keto-8-aminopelargonate synthetase or related enzyme | Coenzyme transport and metabolism [H] | 0.15 |
| COG0183 | Acetyl-CoA acetyltransferase | Lipid transport and metabolism [I] | 0.15 |
| COG0219 | tRNA(Leu) C34 or U34 (ribose-2'-O)-methylase TrmL, contains SPOUT domain | Translation, ribosomal structure and biogenesis [J] | 0.15 |
| COG0363 | 6-phosphogluconolactonase/Glucosamine-6-phosphate isomerase/deaminase | Carbohydrate transport and metabolism [G] | 0.15 |
| COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 0.15 |
| COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 0.15 |
| COG0475 | Kef-type K+ transport system, membrane component KefB | Inorganic ion transport and metabolism [P] | 0.15 |
| COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 0.15 |
| COG0565 | tRNA C32,U32 (ribose-2'-O)-methylase TrmJ or a related methyltransferase | Translation, ribosomal structure and biogenesis [J] | 0.15 |
| COG0566 | tRNA G18 (ribose-2'-O)-methylase SpoU | Translation, ribosomal structure and biogenesis [J] | 0.15 |
| COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 0.15 |
| COG0793 | C-terminal processing protease CtpA/Prc, contains a PDZ domain | Posttranslational modification, protein turnover, chaperones [O] | 0.15 |
| COG1003 | Glycine cleavage system protein P (pyridoxal-binding), C-terminal domain | Amino acid transport and metabolism [E] | 0.15 |
| COG1104 | Cysteine desulfurase/Cysteine sulfinate desulfinase IscS or related enzyme, NifS family | Amino acid transport and metabolism [E] | 0.15 |
| COG1596 | Periplasmic protein Wza involved in polysaccharide export, contains SLBB domain of the beta-grasp fold | Cell wall/membrane/envelope biogenesis [M] | 0.15 |
| COG1611 | Nucleotide monophosphate nucleosidase PpnN/YdgH, Lonely Guy (LOG) family | Nucleotide transport and metabolism [F] | 0.15 |
| COG1874 | Beta-galactosidase GanA | Carbohydrate transport and metabolism [G] | 0.15 |
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 0.15 |
| COG1982 | Arginine/lysine/ornithine decarboxylase | Amino acid transport and metabolism [E] | 0.15 |
| COG2008 | Threonine aldolase | Amino acid transport and metabolism [E] | 0.15 |
| COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 0.15 |
| COG3004 | Na+/H+ antiporter NhaA | Energy production and conversion [C] | 0.15 |
| COG3033 | Tryptophanase | Amino acid transport and metabolism [E] | 0.15 |
| COG3206 | Exopolysaccharide export protein/domain GumC/Wzc1 | Cell wall/membrane/envelope biogenesis [M] | 0.15 |
| COG3263 | NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domains | Energy production and conversion [C] | 0.15 |
| COG3524 | Capsule polysaccharide export protein KpsE/RkpR | Cell wall/membrane/envelope biogenesis [M] | 0.15 |
| COG3765 | LPS O-antigen chain length determinant protein, WzzB/FepE family | Cell wall/membrane/envelope biogenesis [M] | 0.15 |
| COG3944 | Capsular polysaccharide biosynthesis protein YveK | Cell wall/membrane/envelope biogenesis [M] | 0.15 |
| COG4651 | Predicted Kef-type K+ transport protein, K+/H+ antiporter domain | Inorganic ion transport and metabolism [P] | 0.15 |
| COG4992 | Acetylornithine/succinyldiaminopimelate/putrescine aminotransferase | Amino acid transport and metabolism [E] | 0.15 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 94.85 % |
| Unclassified | root | N/A | 5.15 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459012|GOYVCMS01EYEWP | All Organisms → cellular organisms → Bacteria → Acidobacteria | 524 | Open in IMG/M |
| 2199352024|deeps__Contig_78559 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1514 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101471399 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 776 | Open in IMG/M |
| 3300000567|JGI12270J11330_10024574 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3644 | Open in IMG/M |
| 3300000567|JGI12270J11330_10025056 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3599 | Open in IMG/M |
| 3300000567|JGI12270J11330_10047099 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2345 | Open in IMG/M |
| 3300000567|JGI12270J11330_10218122 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 636 | Open in IMG/M |
| 3300000579|AP72_2010_repI_A01DRAFT_1000112 | All Organisms → cellular organisms → Bacteria | 13352 | Open in IMG/M |
| 3300000789|JGI1027J11758_12814526 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 511 | Open in IMG/M |
| 3300000789|JGI1027J11758_12815505 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 717 | Open in IMG/M |
| 3300001084|JGI12648J13191_1011495 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 857 | Open in IMG/M |
| 3300001166|JGI12694J13545_1014517 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 792 | Open in IMG/M |
| 3300001356|JGI12269J14319_10031285 | All Organisms → cellular organisms → Bacteria | 3529 | Open in IMG/M |
| 3300001356|JGI12269J14319_10253151 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 655 | Open in IMG/M |
| 3300001546|JGI12659J15293_10011208 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2500 | Open in IMG/M |
| 3300001593|JGI12635J15846_10130543 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1758 | Open in IMG/M |
| 3300001593|JGI12635J15846_10139794 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1678 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100118334 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2493 | Open in IMG/M |
| 3300003218|JGI26339J46600_10073499 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 872 | Open in IMG/M |
| 3300003219|JGI26341J46601_10012799 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2751 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10039256 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1758 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10171910 | All Organisms → cellular organisms → Bacteria | 877 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10465826 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300004080|Ga0062385_10038188 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1987 | Open in IMG/M |
| 3300004080|Ga0062385_10208748 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1060 | Open in IMG/M |
| 3300004082|Ga0062384_100214324 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1145 | Open in IMG/M |
| 3300004091|Ga0062387_100116483 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1473 | Open in IMG/M |
| 3300004091|Ga0062387_101741284 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 507 | Open in IMG/M |
| 3300004092|Ga0062389_100555839 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1305 | Open in IMG/M |
| 3300004152|Ga0062386_100204052 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1556 | Open in IMG/M |
| 3300004152|Ga0062386_100863389 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 747 | Open in IMG/M |
| 3300004152|Ga0062386_100956170 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 709 | Open in IMG/M |
| 3300004463|Ga0063356_101842056 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 910 | Open in IMG/M |
| 3300004633|Ga0066395_10072157 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1593 | Open in IMG/M |
| 3300004633|Ga0066395_10110833 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1338 | Open in IMG/M |
| 3300004633|Ga0066395_10157909 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1155 | Open in IMG/M |
| 3300004633|Ga0066395_10462931 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 725 | Open in IMG/M |
| 3300004635|Ga0062388_100763218 | All Organisms → cellular organisms → Bacteria | 911 | Open in IMG/M |
| 3300005177|Ga0066690_10528125 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 792 | Open in IMG/M |
| 3300005179|Ga0066684_10680058 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 690 | Open in IMG/M |
| 3300005180|Ga0066685_10914863 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 585 | Open in IMG/M |
| 3300005332|Ga0066388_102148192 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1006 | Open in IMG/M |
| 3300005332|Ga0066388_107520622 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300005434|Ga0070709_10000469 | All Organisms → cellular organisms → Bacteria | 23952 | Open in IMG/M |
| 3300005434|Ga0070709_10102155 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1912 | Open in IMG/M |
| 3300005434|Ga0070709_10427846 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 993 | Open in IMG/M |
| 3300005434|Ga0070709_10891815 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 703 | Open in IMG/M |
| 3300005435|Ga0070714_100181825 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1913 | Open in IMG/M |
| 3300005435|Ga0070714_100804225 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 911 | Open in IMG/M |
| 3300005435|Ga0070714_101101208 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 774 | Open in IMG/M |
| 3300005436|Ga0070713_100010080 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 6813 | Open in IMG/M |
| 3300005436|Ga0070713_100696088 | All Organisms → cellular organisms → Bacteria | 970 | Open in IMG/M |
| 3300005436|Ga0070713_100711909 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 959 | Open in IMG/M |
| 3300005436|Ga0070713_101182987 | Not Available | 740 | Open in IMG/M |
| 3300005445|Ga0070708_100126340 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2364 | Open in IMG/M |
| 3300005467|Ga0070706_100087446 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2889 | Open in IMG/M |
| 3300005468|Ga0070707_100404026 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1326 | Open in IMG/M |
| 3300005529|Ga0070741_10069165 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 3999 | Open in IMG/M |
| 3300005532|Ga0070739_10214882 | All Organisms → cellular organisms → Bacteria | 970 | Open in IMG/M |
| 3300005533|Ga0070734_10000011 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 658267 | Open in IMG/M |
| 3300005533|Ga0070734_10000180 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 169498 | Open in IMG/M |
| 3300005533|Ga0070734_10000725 | All Organisms → cellular organisms → Bacteria | 60845 | Open in IMG/M |
| 3300005533|Ga0070734_10177647 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1230 | Open in IMG/M |
| 3300005533|Ga0070734_10240848 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1038 | Open in IMG/M |
| 3300005533|Ga0070734_10408269 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 775 | Open in IMG/M |
| 3300005534|Ga0070735_10000639 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 36637 | Open in IMG/M |
| 3300005534|Ga0070735_10001802 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 20055 | Open in IMG/M |
| 3300005534|Ga0070735_10002484 | All Organisms → cellular organisms → Bacteria | 16680 | Open in IMG/M |
| 3300005534|Ga0070735_10007633 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 8601 | Open in IMG/M |
| 3300005534|Ga0070735_10025519 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 4186 | Open in IMG/M |
| 3300005534|Ga0070735_10088464 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1964 | Open in IMG/M |
| 3300005534|Ga0070735_10542222 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 692 | Open in IMG/M |
| 3300005537|Ga0070730_10000895 | All Organisms → cellular organisms → Bacteria | 31139 | Open in IMG/M |
| 3300005537|Ga0070730_10028990 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 4198 | Open in IMG/M |
| 3300005537|Ga0070730_10833509 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 580 | Open in IMG/M |
| 3300005538|Ga0070731_10000084 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 181212 | Open in IMG/M |
| 3300005538|Ga0070731_10010844 | All Organisms → cellular organisms → Bacteria | 6725 | Open in IMG/M |
| 3300005538|Ga0070731_10012357 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 6211 | Open in IMG/M |
| 3300005538|Ga0070731_10017322 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 5068 | Open in IMG/M |
| 3300005538|Ga0070731_10031318 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 3600 | Open in IMG/M |
| 3300005541|Ga0070733_10000086 | All Organisms → cellular organisms → Bacteria | 86180 | Open in IMG/M |
| 3300005541|Ga0070733_10000217 | All Organisms → cellular organisms → Bacteria | 50811 | Open in IMG/M |
| 3300005541|Ga0070733_10012389 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 5356 | Open in IMG/M |
| 3300005541|Ga0070733_10092078 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1928 | Open in IMG/M |
| 3300005541|Ga0070733_10156959 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1478 | Open in IMG/M |
| 3300005541|Ga0070733_10244971 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1178 | Open in IMG/M |
| 3300005541|Ga0070733_10249958 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1166 | Open in IMG/M |
| 3300005541|Ga0070733_10401207 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 912 | Open in IMG/M |
| 3300005542|Ga0070732_10003858 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 8066 | Open in IMG/M |
| 3300005542|Ga0070732_10078533 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1931 | Open in IMG/M |
| 3300005542|Ga0070732_10107627 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1645 | Open in IMG/M |
| 3300005542|Ga0070732_10155308 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1363 | Open in IMG/M |
| 3300005542|Ga0070732_10237519 | All Organisms → cellular organisms → Bacteria | 1091 | Open in IMG/M |
| 3300005542|Ga0070732_10363251 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 872 | Open in IMG/M |
| 3300005555|Ga0066692_10472216 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 799 | Open in IMG/M |
| 3300005575|Ga0066702_10214198 | All Organisms → cellular organisms → Bacteria | 1170 | Open in IMG/M |
| 3300005591|Ga0070761_10016807 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 4065 | Open in IMG/M |
| 3300005591|Ga0070761_10021188 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 3621 | Open in IMG/M |
| 3300005591|Ga0070761_10036896 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2736 | Open in IMG/M |
| 3300005602|Ga0070762_10164813 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1335 | Open in IMG/M |
| 3300005602|Ga0070762_10620323 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 719 | Open in IMG/M |
| 3300005602|Ga0070762_10832062 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 626 | Open in IMG/M |
| 3300005602|Ga0070762_11137207 | Not Available | 539 | Open in IMG/M |
| 3300005610|Ga0070763_10041076 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2164 | Open in IMG/M |
| 3300005764|Ga0066903_100054563 | All Organisms → cellular organisms → Bacteria | 4913 | Open in IMG/M |
| 3300005764|Ga0066903_100120565 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 3643 | Open in IMG/M |
| 3300005764|Ga0066903_102586370 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 984 | Open in IMG/M |
| 3300005764|Ga0066903_106460493 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 611 | Open in IMG/M |
| 3300005921|Ga0070766_10001711 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 10770 | Open in IMG/M |
| 3300005921|Ga0070766_10227946 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1175 | Open in IMG/M |
| 3300005952|Ga0080026_10003105 | All Organisms → cellular organisms → Bacteria | 3917 | Open in IMG/M |
| 3300005993|Ga0080027_10286870 | Not Available | 653 | Open in IMG/M |
| 3300005994|Ga0066789_10069315 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1529 | Open in IMG/M |
| 3300005994|Ga0066789_10511158 | Not Available | 501 | Open in IMG/M |
| 3300005995|Ga0066790_10008612 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 4505 | Open in IMG/M |
| 3300006028|Ga0070717_10194950 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1772 | Open in IMG/M |
| 3300006028|Ga0070717_10817576 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 848 | Open in IMG/M |
| 3300006050|Ga0075028_100109696 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 1418 | Open in IMG/M |
| 3300006052|Ga0075029_100034104 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2903 | Open in IMG/M |
| 3300006052|Ga0075029_100099077 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1748 | Open in IMG/M |
| 3300006052|Ga0075029_100136150 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1501 | Open in IMG/M |
| 3300006052|Ga0075029_100171114 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1344 | Open in IMG/M |
| 3300006052|Ga0075029_100198027 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1253 | Open in IMG/M |
| 3300006052|Ga0075029_100672545 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 696 | Open in IMG/M |
| 3300006052|Ga0075029_100702092 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 683 | Open in IMG/M |
| 3300006052|Ga0075029_101105080 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300006052|Ga0075029_101273398 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 515 | Open in IMG/M |
| 3300006059|Ga0075017_100001626 | All Organisms → cellular organisms → Bacteria | 13870 | Open in IMG/M |
| 3300006059|Ga0075017_100105738 | All Organisms → cellular organisms → Bacteria | 1965 | Open in IMG/M |
| 3300006086|Ga0075019_10647554 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 665 | Open in IMG/M |
| 3300006086|Ga0075019_10951225 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 553 | Open in IMG/M |
| 3300006162|Ga0075030_100003803 | All Organisms → cellular organisms → Bacteria | 13668 | Open in IMG/M |
| 3300006162|Ga0075030_100120119 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2136 | Open in IMG/M |
| 3300006162|Ga0075030_100189610 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1657 | Open in IMG/M |
| 3300006163|Ga0070715_10600029 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
| 3300006173|Ga0070716_101215366 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 606 | Open in IMG/M |
| 3300006176|Ga0070765_100074135 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2866 | Open in IMG/M |
| 3300006176|Ga0070765_100146738 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2100 | Open in IMG/M |
| 3300006176|Ga0070765_100235562 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1674 | Open in IMG/M |
| 3300006354|Ga0075021_10747322 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 630 | Open in IMG/M |
| 3300006755|Ga0079222_11770113 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 596 | Open in IMG/M |
| 3300006804|Ga0079221_11127644 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 603 | Open in IMG/M |
| 3300006893|Ga0073928_10043868 | All Organisms → cellular organisms → Bacteria | 4104 | Open in IMG/M |
| 3300006893|Ga0073928_10064159 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3225 | Open in IMG/M |
| 3300007982|Ga0102924_1001314 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 29232 | Open in IMG/M |
| 3300007982|Ga0102924_1072942 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1853 | Open in IMG/M |
| 3300007982|Ga0102924_1411163 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 505 | Open in IMG/M |
| 3300009089|Ga0099828_10401938 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1235 | Open in IMG/M |
| 3300009521|Ga0116222_1194327 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 874 | Open in IMG/M |
| 3300009522|Ga0116218_1018231 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3110 | Open in IMG/M |
| 3300009525|Ga0116220_10298125 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 709 | Open in IMG/M |
| 3300009623|Ga0116133_1039225 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1172 | Open in IMG/M |
| 3300009623|Ga0116133_1174821 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 570 | Open in IMG/M |
| 3300009624|Ga0116105_1187313 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 565 | Open in IMG/M |
| 3300009628|Ga0116125_1000645 | All Organisms → cellular organisms → Bacteria | 16073 | Open in IMG/M |
| 3300009628|Ga0116125_1197880 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 571 | Open in IMG/M |
| 3300009628|Ga0116125_1225863 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 539 | Open in IMG/M |
| 3300009640|Ga0116126_1026929 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2459 | Open in IMG/M |
| 3300009698|Ga0116216_10940474 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 517 | Open in IMG/M |
| 3300009792|Ga0126374_10052659 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2075 | Open in IMG/M |
| 3300009824|Ga0116219_10097720 | All Organisms → cellular organisms → Bacteria | 1714 | Open in IMG/M |
| 3300009826|Ga0123355_10003963 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 21427 | Open in IMG/M |
| 3300009826|Ga0123355_10016599 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 11614 | Open in IMG/M |
| 3300010043|Ga0126380_10077965 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1907 | Open in IMG/M |
| 3300010043|Ga0126380_11938594 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 537 | Open in IMG/M |
| 3300010048|Ga0126373_10055309 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3539 | Open in IMG/M |
| 3300010048|Ga0126373_10212833 | All Organisms → cellular organisms → Bacteria | 1880 | Open in IMG/M |
| 3300010048|Ga0126373_10218417 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1858 | Open in IMG/M |
| 3300010048|Ga0126373_10335392 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1520 | Open in IMG/M |
| 3300010048|Ga0126373_10576085 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1176 | Open in IMG/M |
| 3300010048|Ga0126373_12932578 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 532 | Open in IMG/M |
| 3300010048|Ga0126373_12981046 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 528 | Open in IMG/M |
| 3300010339|Ga0074046_10292607 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1002 | Open in IMG/M |
| 3300010341|Ga0074045_10031144 | All Organisms → cellular organisms → Bacteria | 4027 | Open in IMG/M |
| 3300010341|Ga0074045_10872059 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300010343|Ga0074044_10119413 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1770 | Open in IMG/M |
| 3300010358|Ga0126370_10027572 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3370 | Open in IMG/M |
| 3300010358|Ga0126370_10632093 | All Organisms → cellular organisms → Bacteria | 929 | Open in IMG/M |
| 3300010358|Ga0126370_11952491 | Not Available | 572 | Open in IMG/M |
| 3300010359|Ga0126376_10586638 | All Organisms → cellular organisms → Bacteria | 1051 | Open in IMG/M |
| 3300010359|Ga0126376_11251997 | Not Available | 759 | Open in IMG/M |
| 3300010361|Ga0126378_10851441 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1020 | Open in IMG/M |
| 3300010361|Ga0126378_11185421 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 862 | Open in IMG/M |
| 3300010361|Ga0126378_11536212 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 755 | Open in IMG/M |
| 3300010361|Ga0126378_11736677 | Not Available | 709 | Open in IMG/M |
| 3300010361|Ga0126378_11955221 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 668 | Open in IMG/M |
| 3300010361|Ga0126378_12223647 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 626 | Open in IMG/M |
| 3300010361|Ga0126378_13001628 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 538 | Open in IMG/M |
| 3300010366|Ga0126379_10523723 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1261 | Open in IMG/M |
| 3300010366|Ga0126379_11378343 | Not Available | 811 | Open in IMG/M |
| 3300010376|Ga0126381_100416542 | All Organisms → cellular organisms → Bacteria | 1876 | Open in IMG/M |
| 3300010376|Ga0126381_102102505 | All Organisms → cellular organisms → Bacteria | 813 | Open in IMG/M |
| 3300010376|Ga0126381_103000877 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
| 3300010379|Ga0136449_100397004 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2450 | Open in IMG/M |
| 3300010379|Ga0136449_100901786 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1440 | Open in IMG/M |
| 3300010379|Ga0136449_100944652 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1397 | Open in IMG/M |
| 3300010379|Ga0136449_101234507 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1173 | Open in IMG/M |
| 3300010379|Ga0136449_101603882 | Not Available | 988 | Open in IMG/M |
| 3300010398|Ga0126383_10145289 | All Organisms → cellular organisms → Bacteria | 2203 | Open in IMG/M |
| 3300010398|Ga0126383_13271451 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 529 | Open in IMG/M |
| 3300011120|Ga0150983_11684326 | All Organisms → cellular organisms → Bacteria | 794 | Open in IMG/M |
| 3300011120|Ga0150983_14880686 | Not Available | 613 | Open in IMG/M |
| 3300012210|Ga0137378_10080940 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2962 | Open in IMG/M |
| 3300012210|Ga0137378_11073716 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 719 | Open in IMG/M |
| 3300012211|Ga0137377_10280745 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1598 | Open in IMG/M |
| 3300012350|Ga0137372_10498992 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 906 | Open in IMG/M |
| 3300012354|Ga0137366_10156960 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1711 | Open in IMG/M |
| 3300012469|Ga0150984_115988646 | Not Available | 562 | Open in IMG/M |
| 3300012683|Ga0137398_10650057 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 731 | Open in IMG/M |
| 3300012925|Ga0137419_11618063 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 551 | Open in IMG/M |
| 3300012929|Ga0137404_12106227 | Not Available | 527 | Open in IMG/M |
| 3300012930|Ga0137407_11656586 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 609 | Open in IMG/M |
| 3300012971|Ga0126369_10338747 | All Organisms → cellular organisms → Bacteria | 1521 | Open in IMG/M |
| 3300012971|Ga0126369_11548899 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 752 | Open in IMG/M |
| 3300012984|Ga0164309_10468641 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 957 | Open in IMG/M |
| 3300014052|Ga0120109_1117648 | Not Available | 618 | Open in IMG/M |
| 3300014156|Ga0181518_10198426 | All Organisms → cellular organisms → Bacteria | 1045 | Open in IMG/M |
| 3300014158|Ga0181521_10024963 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4785 | Open in IMG/M |
| 3300014164|Ga0181532_10002444 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 17355 | Open in IMG/M |
| 3300014165|Ga0181523_10001683 | All Organisms → cellular organisms → Bacteria | 23121 | Open in IMG/M |
| 3300014168|Ga0181534_10007319 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6062 | Open in IMG/M |
| 3300014201|Ga0181537_10652049 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 717 | Open in IMG/M |
| 3300014489|Ga0182018_10013528 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 5678 | Open in IMG/M |
| 3300014498|Ga0182019_10030610 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3009 | Open in IMG/M |
| 3300014501|Ga0182024_10016647 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 13918 | Open in IMG/M |
| 3300014501|Ga0182024_10017563 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 13412 | Open in IMG/M |
| 3300014501|Ga0182024_10054490 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 6280 | Open in IMG/M |
| 3300014501|Ga0182024_11186900 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 894 | Open in IMG/M |
| 3300014838|Ga0182030_10735072 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 917 | Open in IMG/M |
| 3300015371|Ga0132258_10864802 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2282 | Open in IMG/M |
| 3300015371|Ga0132258_12659885 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1249 | Open in IMG/M |
| 3300016294|Ga0182041_11787061 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 570 | Open in IMG/M |
| 3300016404|Ga0182037_10404857 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1125 | Open in IMG/M |
| 3300016404|Ga0182037_11124075 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 688 | Open in IMG/M |
| 3300016445|Ga0182038_10203378 | All Organisms → cellular organisms → Bacteria | 1560 | Open in IMG/M |
| 3300016750|Ga0181505_10149013 | Not Available | 661 | Open in IMG/M |
| 3300016750|Ga0181505_10804767 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 501 | Open in IMG/M |
| 3300016750|Ga0181505_11190806 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 569 | Open in IMG/M |
| 3300017822|Ga0187802_10006138 | All Organisms → cellular organisms → Bacteria | 3686 | Open in IMG/M |
| 3300017822|Ga0187802_10063296 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1365 | Open in IMG/M |
| 3300017822|Ga0187802_10094271 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1123 | Open in IMG/M |
| 3300017823|Ga0187818_10019084 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2934 | Open in IMG/M |
| 3300017823|Ga0187818_10052804 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1747 | Open in IMG/M |
| 3300017823|Ga0187818_10069384 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1518 | Open in IMG/M |
| 3300017823|Ga0187818_10073955 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1467 | Open in IMG/M |
| 3300017823|Ga0187818_10363911 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 639 | Open in IMG/M |
| 3300017924|Ga0187820_1157571 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 687 | Open in IMG/M |
| 3300017924|Ga0187820_1309701 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 521 | Open in IMG/M |
| 3300017925|Ga0187856_1017007 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3853 | Open in IMG/M |
| 3300017928|Ga0187806_1083391 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1005 | Open in IMG/M |
| 3300017932|Ga0187814_10268719 | Not Available | 649 | Open in IMG/M |
| 3300017933|Ga0187801_10033191 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1821 | Open in IMG/M |
| 3300017933|Ga0187801_10374131 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 589 | Open in IMG/M |
| 3300017934|Ga0187803_10002595 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 7100 | Open in IMG/M |
| 3300017934|Ga0187803_10184824 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 821 | Open in IMG/M |
| 3300017936|Ga0187821_10196796 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 774 | Open in IMG/M |
| 3300017943|Ga0187819_10092795 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1803 | Open in IMG/M |
| 3300017943|Ga0187819_10524941 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 674 | Open in IMG/M |
| 3300017943|Ga0187819_10722020 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 561 | Open in IMG/M |
| 3300017946|Ga0187879_10293497 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 904 | Open in IMG/M |
| 3300017948|Ga0187847_10087442 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1727 | Open in IMG/M |
| 3300017948|Ga0187847_10463929 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
| 3300017955|Ga0187817_11034810 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 526 | Open in IMG/M |
| 3300017959|Ga0187779_10247051 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1129 | Open in IMG/M |
| 3300017959|Ga0187779_10613418 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 729 | Open in IMG/M |
| 3300017959|Ga0187779_10740156 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 667 | Open in IMG/M |
| 3300017959|Ga0187779_10851864 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 625 | Open in IMG/M |
| 3300017959|Ga0187779_10875248 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300017961|Ga0187778_10051072 | All Organisms → cellular organisms → Bacteria | 2529 | Open in IMG/M |
| 3300017961|Ga0187778_10210819 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1240 | Open in IMG/M |
| 3300017961|Ga0187778_10221324 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1210 | Open in IMG/M |
| 3300017961|Ga0187778_11028582 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 571 | Open in IMG/M |
| 3300017970|Ga0187783_10015213 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 5676 | Open in IMG/M |
| 3300017970|Ga0187783_10099723 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2141 | Open in IMG/M |
| 3300017970|Ga0187783_10697651 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 733 | Open in IMG/M |
| 3300017970|Ga0187783_11152779 | Not Available | 558 | Open in IMG/M |
| 3300017972|Ga0187781_10002644 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 13559 | Open in IMG/M |
| 3300017972|Ga0187781_10005894 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 9051 | Open in IMG/M |
| 3300017972|Ga0187781_10008784 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 7317 | Open in IMG/M |
| 3300017972|Ga0187781_10056121 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → unclassified Gemmatimonas → Gemmatimonas sp. SG8_28 | 2709 | Open in IMG/M |
| 3300017972|Ga0187781_10068675 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2440 | Open in IMG/M |
| 3300017972|Ga0187781_10517683 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 857 | Open in IMG/M |
| 3300017972|Ga0187781_10782943 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
| 3300017972|Ga0187781_11045915 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 598 | Open in IMG/M |
| 3300017972|Ga0187781_11130129 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 575 | Open in IMG/M |
| 3300017972|Ga0187781_11187017 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 561 | Open in IMG/M |
| 3300017973|Ga0187780_10048001 | All Organisms → cellular organisms → Bacteria | 2967 | Open in IMG/M |
| 3300017973|Ga0187780_11420124 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 512 | Open in IMG/M |
| 3300017975|Ga0187782_10059267 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2788 | Open in IMG/M |
| 3300017975|Ga0187782_10108159 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2049 | Open in IMG/M |
| 3300017975|Ga0187782_10110609 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2026 | Open in IMG/M |
| 3300017975|Ga0187782_10219181 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1426 | Open in IMG/M |
| 3300017975|Ga0187782_10221833 | All Organisms → cellular organisms → Bacteria | 1417 | Open in IMG/M |
| 3300017975|Ga0187782_10348676 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1121 | Open in IMG/M |
| 3300017975|Ga0187782_10603930 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 843 | Open in IMG/M |
| 3300017975|Ga0187782_11376049 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 554 | Open in IMG/M |
| 3300017995|Ga0187816_10191042 | All Organisms → cellular organisms → Bacteria | 890 | Open in IMG/M |
| 3300017995|Ga0187816_10526475 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 533 | Open in IMG/M |
| 3300018006|Ga0187804_10218521 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 817 | Open in IMG/M |
| 3300018006|Ga0187804_10435642 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300018006|Ga0187804_10481133 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 556 | Open in IMG/M |
| 3300018007|Ga0187805_10021695 | All Organisms → cellular organisms → Bacteria | 2804 | Open in IMG/M |
| 3300018034|Ga0187863_10093424 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1688 | Open in IMG/M |
| 3300018034|Ga0187863_10105071 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1582 | Open in IMG/M |
| 3300018044|Ga0187890_10500228 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 683 | Open in IMG/M |
| 3300018058|Ga0187766_10594071 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 755 | Open in IMG/M |
| 3300018062|Ga0187784_10190169 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1676 | Open in IMG/M |
| 3300018062|Ga0187784_10203668 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1615 | Open in IMG/M |
| 3300018062|Ga0187784_10976923 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 673 | Open in IMG/M |
| 3300018085|Ga0187772_10001746 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 10499 | Open in IMG/M |
| 3300018085|Ga0187772_10029006 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3273 | Open in IMG/M |
| 3300018085|Ga0187772_10055664 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2444 | Open in IMG/M |
| 3300018085|Ga0187772_10087783 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1983 | Open in IMG/M |
| 3300018085|Ga0187772_10093617 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1925 | Open in IMG/M |
| 3300018085|Ga0187772_10361935 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1004 | Open in IMG/M |
| 3300018085|Ga0187772_10476067 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 878 | Open in IMG/M |
| 3300018085|Ga0187772_10775738 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 691 | Open in IMG/M |
| 3300018086|Ga0187769_10025193 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3988 | Open in IMG/M |
| 3300018086|Ga0187769_10048647 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2939 | Open in IMG/M |
| 3300018086|Ga0187769_10203760 | All Organisms → cellular organisms → Bacteria | 1465 | Open in IMG/M |
| 3300018086|Ga0187769_10531455 | All Organisms → cellular organisms → Bacteria | 888 | Open in IMG/M |
| 3300018088|Ga0187771_10016567 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 5431 | Open in IMG/M |
| 3300018088|Ga0187771_10057313 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3051 | Open in IMG/M |
| 3300018088|Ga0187771_10116135 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2172 | Open in IMG/M |
| 3300018088|Ga0187771_10374153 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1199 | Open in IMG/M |
| 3300018088|Ga0187771_11399201 | Not Available | 593 | Open in IMG/M |
| 3300018088|Ga0187771_11419689 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 589 | Open in IMG/M |
| 3300018090|Ga0187770_10908207 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
| 3300018090|Ga0187770_10972405 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 682 | Open in IMG/M |
| 3300018090|Ga0187770_11315291 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 586 | Open in IMG/M |
| 3300018090|Ga0187770_11484804 | Not Available | 552 | Open in IMG/M |
| 3300018431|Ga0066655_11390084 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 509 | Open in IMG/M |
| 3300018468|Ga0066662_11833161 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300019278|Ga0187800_1049223 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 507 | Open in IMG/M |
| 3300019786|Ga0182025_1233663 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2207 | Open in IMG/M |
| 3300019888|Ga0193751_1014980 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3962 | Open in IMG/M |
| 3300020021|Ga0193726_1068310 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1657 | Open in IMG/M |
| 3300020579|Ga0210407_10033180 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3840 | Open in IMG/M |
| 3300020579|Ga0210407_10158817 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1745 | Open in IMG/M |
| 3300020579|Ga0210407_10298044 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1259 | Open in IMG/M |
| 3300020580|Ga0210403_10031132 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4265 | Open in IMG/M |
| 3300020580|Ga0210403_10198834 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1644 | Open in IMG/M |
| 3300020580|Ga0210403_10520625 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 965 | Open in IMG/M |
| 3300020580|Ga0210403_10546909 | All Organisms → cellular organisms → Bacteria | 938 | Open in IMG/M |
| 3300020580|Ga0210403_10651421 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 847 | Open in IMG/M |
| 3300020580|Ga0210403_10940595 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 679 | Open in IMG/M |
| 3300020581|Ga0210399_10000595 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 28866 | Open in IMG/M |
| 3300020581|Ga0210399_10094303 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2442 | Open in IMG/M |
| 3300020581|Ga0210399_10120068 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2160 | Open in IMG/M |
| 3300020581|Ga0210399_10250486 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1476 | Open in IMG/M |
| 3300020581|Ga0210399_10413621 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1124 | Open in IMG/M |
| 3300020581|Ga0210399_10534542 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 973 | Open in IMG/M |
| 3300020582|Ga0210395_10000006 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 370563 | Open in IMG/M |
| 3300020582|Ga0210395_10001710 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 17000 | Open in IMG/M |
| 3300020582|Ga0210395_10075433 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2483 | Open in IMG/M |
| 3300020582|Ga0210395_10127394 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1893 | Open in IMG/M |
| 3300020582|Ga0210395_10855654 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 677 | Open in IMG/M |
| 3300020583|Ga0210401_10096922 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2771 | Open in IMG/M |
| 3300020583|Ga0210401_10723156 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 856 | Open in IMG/M |
| 3300020583|Ga0210401_10901064 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 743 | Open in IMG/M |
| 3300021088|Ga0210404_10176112 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1135 | Open in IMG/M |
| 3300021088|Ga0210404_10308805 | All Organisms → cellular organisms → Bacteria | 871 | Open in IMG/M |
| 3300021088|Ga0210404_10528680 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 667 | Open in IMG/M |
| 3300021088|Ga0210404_10834090 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 527 | Open in IMG/M |
| 3300021168|Ga0210406_10000334 | All Organisms → cellular organisms → Bacteria | 67456 | Open in IMG/M |
| 3300021168|Ga0210406_10019342 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 6380 | Open in IMG/M |
| 3300021168|Ga0210406_10495803 | All Organisms → cellular organisms → Bacteria | 966 | Open in IMG/M |
| 3300021170|Ga0210400_10000973 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 29450 | Open in IMG/M |
| 3300021170|Ga0210400_10020446 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5176 | Open in IMG/M |
| 3300021171|Ga0210405_10227328 | All Organisms → cellular organisms → Bacteria | 1478 | Open in IMG/M |
| 3300021178|Ga0210408_10054064 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3137 | Open in IMG/M |
| 3300021180|Ga0210396_10098875 | All Organisms → cellular organisms → Bacteria | 2641 | Open in IMG/M |
| 3300021180|Ga0210396_10099384 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2633 | Open in IMG/M |
| 3300021180|Ga0210396_10151708 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2081 | Open in IMG/M |
| 3300021181|Ga0210388_10018703 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 5583 | Open in IMG/M |
| 3300021181|Ga0210388_10439611 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1146 | Open in IMG/M |
| 3300021181|Ga0210388_10693707 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 887 | Open in IMG/M |
| 3300021181|Ga0210388_10936767 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 745 | Open in IMG/M |
| 3300021401|Ga0210393_10064610 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2884 | Open in IMG/M |
| 3300021401|Ga0210393_10274435 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1369 | Open in IMG/M |
| 3300021401|Ga0210393_11088330 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 645 | Open in IMG/M |
| 3300021402|Ga0210385_10016020 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4666 | Open in IMG/M |
| 3300021402|Ga0210385_10044139 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2950 | Open in IMG/M |
| 3300021402|Ga0210385_10250612 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1301 | Open in IMG/M |
| 3300021402|Ga0210385_10268571 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1258 | Open in IMG/M |
| 3300021402|Ga0210385_11392260 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300021403|Ga0210397_10226346 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1347 | Open in IMG/M |
| 3300021403|Ga0210397_10289952 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1199 | Open in IMG/M |
| 3300021404|Ga0210389_10065949 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2776 | Open in IMG/M |
| 3300021404|Ga0210389_10806686 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 733 | Open in IMG/M |
| 3300021405|Ga0210387_10073926 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2795 | Open in IMG/M |
| 3300021405|Ga0210387_10141733 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2049 | Open in IMG/M |
| 3300021406|Ga0210386_11049846 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 693 | Open in IMG/M |
| 3300021407|Ga0210383_11705508 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 516 | Open in IMG/M |
| 3300021420|Ga0210394_10000005 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 547201 | Open in IMG/M |
| 3300021420|Ga0210394_10221697 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1651 | Open in IMG/M |
| 3300021420|Ga0210394_10963457 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 740 | Open in IMG/M |
| 3300021433|Ga0210391_10038801 | All Organisms → cellular organisms → Bacteria | 3808 | Open in IMG/M |
| 3300021433|Ga0210391_10628028 | All Organisms → cellular organisms → Bacteria | 843 | Open in IMG/M |
| 3300021474|Ga0210390_10220408 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1605 | Open in IMG/M |
| 3300021474|Ga0210390_10344591 | All Organisms → cellular organisms → Bacteria | 1261 | Open in IMG/M |
| 3300021475|Ga0210392_10637644 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 792 | Open in IMG/M |
| 3300021475|Ga0210392_11211250 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 565 | Open in IMG/M |
| 3300021476|Ga0187846_10008779 | All Organisms → cellular organisms → Bacteria | 4958 | Open in IMG/M |
| 3300021476|Ga0187846_10179907 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 889 | Open in IMG/M |
| 3300021476|Ga0187846_10319423 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
| 3300021477|Ga0210398_10424808 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1084 | Open in IMG/M |
| 3300021478|Ga0210402_10012318 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 7357 | Open in IMG/M |
| 3300021478|Ga0210402_10501472 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1127 | Open in IMG/M |
| 3300021478|Ga0210402_10752369 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 899 | Open in IMG/M |
| 3300021479|Ga0210410_10000849 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 30362 | Open in IMG/M |
| 3300021479|Ga0210410_10041801 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3987 | Open in IMG/M |
| 3300021479|Ga0210410_10380985 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1264 | Open in IMG/M |
| 3300021559|Ga0210409_10115190 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2473 | Open in IMG/M |
| 3300021559|Ga0210409_11306320 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 601 | Open in IMG/M |
| 3300021560|Ga0126371_10002227 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 16648 | Open in IMG/M |
| 3300021560|Ga0126371_10017112 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 6648 | Open in IMG/M |
| 3300021560|Ga0126371_10017962 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 6498 | Open in IMG/M |
| 3300021560|Ga0126371_10070103 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3408 | Open in IMG/M |
| 3300021560|Ga0126371_10088578 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3056 | Open in IMG/M |
| 3300021560|Ga0126371_10162618 | All Organisms → cellular organisms → Bacteria | 2303 | Open in IMG/M |
| 3300021560|Ga0126371_10542550 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1312 | Open in IMG/M |
| 3300021560|Ga0126371_10696012 | All Organisms → cellular organisms → Bacteria | 1164 | Open in IMG/M |
| 3300021560|Ga0126371_10763409 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1114 | Open in IMG/M |
| 3300021560|Ga0126371_10786035 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1098 | Open in IMG/M |
| 3300021560|Ga0126371_11538322 | All Organisms → cellular organisms → Bacteria | 793 | Open in IMG/M |
| 3300021560|Ga0126371_12429388 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 634 | Open in IMG/M |
| 3300021560|Ga0126371_13572900 | Not Available | 525 | Open in IMG/M |
| 3300021858|Ga0213852_1055809 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 802 | Open in IMG/M |
| 3300021861|Ga0213853_10070251 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 722 | Open in IMG/M |
| 3300021861|Ga0213853_10200175 | Not Available | 763 | Open in IMG/M |
| 3300021861|Ga0213853_10391515 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 744 | Open in IMG/M |
| 3300022531|Ga0242660_1045883 | All Organisms → cellular organisms → Bacteria | 937 | Open in IMG/M |
| 3300022557|Ga0212123_10044488 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4192 | Open in IMG/M |
| 3300022557|Ga0212123_10073398 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2934 | Open in IMG/M |
| 3300022557|Ga0212123_10113299 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2178 | Open in IMG/M |
| 3300022557|Ga0212123_10257692 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1247 | Open in IMG/M |
| 3300022557|Ga0212123_10271602 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1203 | Open in IMG/M |
| 3300022717|Ga0242661_1139074 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 537 | Open in IMG/M |
| 3300022724|Ga0242665_10299324 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 562 | Open in IMG/M |
| 3300022734|Ga0224571_106975 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 758 | Open in IMG/M |
| 3300023255|Ga0224547_1024796 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 770 | Open in IMG/M |
| 3300024331|Ga0247668_1119805 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 534 | Open in IMG/M |
| 3300025494|Ga0207928_1001184 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4386 | Open in IMG/M |
| 3300025509|Ga0208848_1096608 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 598 | Open in IMG/M |
| 3300025509|Ga0208848_1121305 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 514 | Open in IMG/M |
| 3300025910|Ga0207684_10074030 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2893 | Open in IMG/M |
| 3300025928|Ga0207700_10128338 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2066 | Open in IMG/M |
| 3300025929|Ga0207664_10814281 | Not Available | 840 | Open in IMG/M |
| 3300025939|Ga0207665_11202927 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 604 | Open in IMG/M |
| 3300026291|Ga0209890_10017258 | All Organisms → cellular organisms → Bacteria | 2850 | Open in IMG/M |
| 3300026335|Ga0209804_1252454 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 655 | Open in IMG/M |
| 3300026490|Ga0257153_1060996 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 766 | Open in IMG/M |
| 3300026540|Ga0209376_1319402 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 599 | Open in IMG/M |
| 3300026555|Ga0179593_1182973 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2245 | Open in IMG/M |
| 3300026645|Ga0208572_10389 | Not Available | 524 | Open in IMG/M |
| 3300027497|Ga0208199_1001164 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 9447 | Open in IMG/M |
| 3300027502|Ga0209622_1069817 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 641 | Open in IMG/M |
| 3300027545|Ga0209008_1131898 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 552 | Open in IMG/M |
| 3300027568|Ga0208042_1147486 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 590 | Open in IMG/M |
| 3300027604|Ga0208324_1072217 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 983 | Open in IMG/M |
| 3300027604|Ga0208324_1083596 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 903 | Open in IMG/M |
| 3300027619|Ga0209330_1018114 | All Organisms → cellular organisms → Bacteria | 1579 | Open in IMG/M |
| 3300027625|Ga0208044_1138330 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 683 | Open in IMG/M |
| 3300027629|Ga0209422_1101764 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300027648|Ga0209420_1000077 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 62249 | Open in IMG/M |
| 3300027680|Ga0207826_1151856 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 632 | Open in IMG/M |
| 3300027698|Ga0209446_1023349 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1541 | Open in IMG/M |
| 3300027701|Ga0209447_10052197 | All Organisms → cellular organisms → Bacteria | 1126 | Open in IMG/M |
| 3300027767|Ga0209655_10278714 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300027783|Ga0209448_10183531 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 696 | Open in IMG/M |
| 3300027812|Ga0209656_10000003 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 236258 | Open in IMG/M |
| 3300027812|Ga0209656_10285197 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
| 3300027824|Ga0209040_10221011 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 969 | Open in IMG/M |
| 3300027825|Ga0209039_10027341 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2796 | Open in IMG/M |
| 3300027826|Ga0209060_10000025 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 511435 | Open in IMG/M |
| 3300027826|Ga0209060_10000547 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 65199 | Open in IMG/M |
| 3300027826|Ga0209060_10000667 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 53133 | Open in IMG/M |
| 3300027842|Ga0209580_10000595 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 18859 | Open in IMG/M |
| 3300027842|Ga0209580_10035589 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2278 | Open in IMG/M |
| 3300027842|Ga0209580_10128927 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1236 | Open in IMG/M |
| 3300027842|Ga0209580_10431161 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 657 | Open in IMG/M |
| 3300027842|Ga0209580_10531798 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 584 | Open in IMG/M |
| 3300027853|Ga0209274_10000358 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 29979 | Open in IMG/M |
| 3300027853|Ga0209274_10194815 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1030 | Open in IMG/M |
| 3300027854|Ga0209517_10002573 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 25313 | Open in IMG/M |
| 3300027854|Ga0209517_10016135 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 7430 | Open in IMG/M |
| 3300027854|Ga0209517_10116995 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1762 | Open in IMG/M |
| 3300027855|Ga0209693_10243186 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 882 | Open in IMG/M |
| 3300027857|Ga0209166_10000265 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 65996 | Open in IMG/M |
| 3300027857|Ga0209166_10001161 | All Organisms → cellular organisms → Bacteria | 22889 | Open in IMG/M |
| 3300027857|Ga0209166_10019187 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4288 | Open in IMG/M |
| 3300027857|Ga0209166_10589007 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 566 | Open in IMG/M |
| 3300027867|Ga0209167_10000056 | All Organisms → cellular organisms → Bacteria | 141446 | Open in IMG/M |
| 3300027867|Ga0209167_10000459 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 29846 | Open in IMG/M |
| 3300027867|Ga0209167_10082918 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1618 | Open in IMG/M |
| 3300027867|Ga0209167_10100118 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1482 | Open in IMG/M |
| 3300027867|Ga0209167_10591843 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 607 | Open in IMG/M |
| 3300027869|Ga0209579_10000003 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1168820 | Open in IMG/M |
| 3300027869|Ga0209579_10007777 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6875 | Open in IMG/M |
| 3300027869|Ga0209579_10012544 | All Organisms → cellular organisms → Bacteria | 5075 | Open in IMG/M |
| 3300027869|Ga0209579_10202566 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1063 | Open in IMG/M |
| 3300027874|Ga0209465_10055080 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1908 | Open in IMG/M |
| 3300027874|Ga0209465_10575404 | Not Available | 559 | Open in IMG/M |
| 3300027882|Ga0209590_10251602 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1127 | Open in IMG/M |
| 3300027884|Ga0209275_10045504 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2088 | Open in IMG/M |
| 3300027889|Ga0209380_10250028 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1041 | Open in IMG/M |
| 3300027895|Ga0209624_10208245 | All Organisms → cellular organisms → Bacteria | 1299 | Open in IMG/M |
| 3300027898|Ga0209067_10056225 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2009 | Open in IMG/M |
| 3300027898|Ga0209067_10307751 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 872 | Open in IMG/M |
| 3300027898|Ga0209067_10383333 | All Organisms → cellular organisms → Bacteria | 785 | Open in IMG/M |
| 3300027898|Ga0209067_10602493 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 631 | Open in IMG/M |
| 3300027898|Ga0209067_10829339 | Not Available | 541 | Open in IMG/M |
| 3300027905|Ga0209415_10229770 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1702 | Open in IMG/M |
| 3300027905|Ga0209415_10266764 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1518 | Open in IMG/M |
| 3300027905|Ga0209415_10289072 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1427 | Open in IMG/M |
| 3300027905|Ga0209415_10513887 | Not Available | 918 | Open in IMG/M |
| 3300027905|Ga0209415_10616892 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
| 3300027908|Ga0209006_10009958 | All Organisms → cellular organisms → Bacteria | 8586 | Open in IMG/M |
| 3300027908|Ga0209006_10021018 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5915 | Open in IMG/M |
| 3300027908|Ga0209006_10022259 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 5745 | Open in IMG/M |
| 3300027911|Ga0209698_10004355 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 15540 | Open in IMG/M |
| 3300027911|Ga0209698_10012448 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 8450 | Open in IMG/M |
| 3300027911|Ga0209698_10020212 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 6339 | Open in IMG/M |
| 3300027911|Ga0209698_10116535 | All Organisms → cellular organisms → Bacteria | 2219 | Open in IMG/M |
| 3300027911|Ga0209698_10117032 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2214 | Open in IMG/M |
| 3300027911|Ga0209698_10325703 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1212 | Open in IMG/M |
| 3300027986|Ga0209168_10000135 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 81124 | Open in IMG/M |
| 3300027986|Ga0209168_10000779 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 28232 | Open in IMG/M |
| 3300027986|Ga0209168_10001696 | All Organisms → cellular organisms → Bacteria | 16851 | Open in IMG/M |
| 3300027986|Ga0209168_10004427 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 9315 | Open in IMG/M |
| 3300027986|Ga0209168_10023304 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3473 | Open in IMG/M |
| 3300028036|Ga0265355_1003475 | All Organisms → cellular organisms → Bacteria | 1156 | Open in IMG/M |
| 3300028047|Ga0209526_10433861 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 867 | Open in IMG/M |
| 3300028047|Ga0209526_10832181 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 568 | Open in IMG/M |
| 3300028666|Ga0265336_10035690 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1533 | Open in IMG/M |
| 3300028800|Ga0265338_10002933 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 24744 | Open in IMG/M |
| 3300028800|Ga0265338_10027479 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 5708 | Open in IMG/M |
| 3300028800|Ga0265338_10033560 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4977 | Open in IMG/M |
| 3300028800|Ga0265338_10205271 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1483 | Open in IMG/M |
| 3300028800|Ga0265338_10972004 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300028863|Ga0302218_10163522 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 707 | Open in IMG/M |
| 3300028906|Ga0308309_10137640 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1948 | Open in IMG/M |
| 3300028906|Ga0308309_10141784 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1922 | Open in IMG/M |
| 3300028906|Ga0308309_10156973 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1837 | Open in IMG/M |
| 3300028906|Ga0308309_11534871 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300029636|Ga0222749_10598430 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 602 | Open in IMG/M |
| 3300029999|Ga0311339_11025478 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 771 | Open in IMG/M |
| 3300030053|Ga0302177_10008112 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 7100 | Open in IMG/M |
| 3300030494|Ga0310037_10306786 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 675 | Open in IMG/M |
| 3300030617|Ga0311356_11437506 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 626 | Open in IMG/M |
| 3300030659|Ga0316363_10018092 | All Organisms → cellular organisms → Bacteria | 3906 | Open in IMG/M |
| 3300030847|Ga0075405_11834416 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 548 | Open in IMG/M |
| 3300030848|Ga0075388_11650257 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 745 | Open in IMG/M |
| 3300030878|Ga0265770_1072436 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 660 | Open in IMG/M |
| 3300030916|Ga0075386_11566752 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 535 | Open in IMG/M |
| 3300030916|Ga0075386_11921462 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 674 | Open in IMG/M |
| 3300030991|Ga0073994_12036756 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 603 | Open in IMG/M |
| 3300031057|Ga0170834_105605733 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1435 | Open in IMG/M |
| 3300031231|Ga0170824_106878591 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 928 | Open in IMG/M |
| 3300031231|Ga0170824_107826928 | Not Available | 532 | Open in IMG/M |
| 3300031231|Ga0170824_112069924 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 649 | Open in IMG/M |
| 3300031231|Ga0170824_118531637 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 639 | Open in IMG/M |
| 3300031231|Ga0170824_125478478 | All Organisms → cellular organisms → Bacteria | 767 | Open in IMG/M |
| 3300031236|Ga0302324_100001558 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 55302 | Open in IMG/M |
| 3300031236|Ga0302324_100002708 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 40429 | Open in IMG/M |
| 3300031446|Ga0170820_11741189 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1153 | Open in IMG/M |
| 3300031446|Ga0170820_13319920 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 698 | Open in IMG/M |
| 3300031469|Ga0170819_15931707 | Not Available | 590 | Open in IMG/M |
| 3300031474|Ga0170818_108571498 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 887 | Open in IMG/M |
| 3300031708|Ga0310686_103707094 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300031708|Ga0310686_109338108 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 776 | Open in IMG/M |
| 3300031708|Ga0310686_113936595 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2258 | Open in IMG/M |
| 3300031711|Ga0265314_10260982 | All Organisms → cellular organisms → Bacteria | 989 | Open in IMG/M |
| 3300031715|Ga0307476_10000010 | All Organisms → cellular organisms → Bacteria | 373557 | Open in IMG/M |
| 3300031715|Ga0307476_10037067 | All Organisms → cellular organisms → Bacteria | 3271 | Open in IMG/M |
| 3300031715|Ga0307476_10207842 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1422 | Open in IMG/M |
| 3300031715|Ga0307476_11172384 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 563 | Open in IMG/M |
| 3300031716|Ga0310813_10193045 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1665 | Open in IMG/M |
| 3300031716|Ga0310813_11812472 | Not Available | 573 | Open in IMG/M |
| 3300031718|Ga0307474_10301144 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1235 | Open in IMG/M |
| 3300031720|Ga0307469_10560948 | All Organisms → cellular organisms → Bacteria | 1013 | Open in IMG/M |
| 3300031823|Ga0307478_10100010 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2244 | Open in IMG/M |
| 3300031823|Ga0307478_10622686 | All Organisms → cellular organisms → Bacteria | 903 | Open in IMG/M |
| 3300031823|Ga0307478_10779760 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 800 | Open in IMG/M |
| 3300031941|Ga0310912_10757652 | Not Available | 751 | Open in IMG/M |
| 3300031947|Ga0310909_11350903 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300031954|Ga0306926_10743843 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1186 | Open in IMG/M |
| 3300031962|Ga0307479_10009696 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 8925 | Open in IMG/M |
| 3300031962|Ga0307479_10737797 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 963 | Open in IMG/M |
| 3300031962|Ga0307479_11848010 | Not Available | 555 | Open in IMG/M |
| 3300031962|Ga0307479_12103537 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 512 | Open in IMG/M |
| 3300032160|Ga0311301_10006635 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 39580 | Open in IMG/M |
| 3300032160|Ga0311301_10020412 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 18725 | Open in IMG/M |
| 3300032160|Ga0311301_10023544 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 16918 | Open in IMG/M |
| 3300032160|Ga0311301_10292658 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2620 | Open in IMG/M |
| 3300032160|Ga0311301_11387735 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 878 | Open in IMG/M |
| 3300032160|Ga0311301_12127632 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300032174|Ga0307470_10021014 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2938 | Open in IMG/M |
| 3300032174|Ga0307470_10323810 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1056 | Open in IMG/M |
| 3300032174|Ga0307470_10346555 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1028 | Open in IMG/M |
| 3300032174|Ga0307470_11059277 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 649 | Open in IMG/M |
| 3300032174|Ga0307470_11227868 | Not Available | 610 | Open in IMG/M |
| 3300032180|Ga0307471_100596474 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1263 | Open in IMG/M |
| 3300032180|Ga0307471_103725601 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 539 | Open in IMG/M |
| 3300032205|Ga0307472_100768942 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 876 | Open in IMG/M |
| 3300032261|Ga0306920_100425567 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1974 | Open in IMG/M |
| 3300032770|Ga0335085_10000478 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 113006 | Open in IMG/M |
| 3300032770|Ga0335085_10000637 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 93351 | Open in IMG/M |
| 3300032770|Ga0335085_10001308 | All Organisms → cellular organisms → Bacteria | 54605 | Open in IMG/M |
| 3300032770|Ga0335085_10196705 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2472 | Open in IMG/M |
| 3300032770|Ga0335085_10476644 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1430 | Open in IMG/M |
| 3300032770|Ga0335085_10561044 | All Organisms → cellular organisms → Bacteria | 1292 | Open in IMG/M |
| 3300032770|Ga0335085_10887861 | Not Available | 973 | Open in IMG/M |
| 3300032770|Ga0335085_12472521 | Not Available | 516 | Open in IMG/M |
| 3300032782|Ga0335082_10001702 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 23476 | Open in IMG/M |
| 3300032782|Ga0335082_10002049 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 21672 | Open in IMG/M |
| 3300032782|Ga0335082_10003851 | All Organisms → cellular organisms → Bacteria | 16333 | Open in IMG/M |
| 3300032782|Ga0335082_10187547 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1974 | Open in IMG/M |
| 3300032782|Ga0335082_10845473 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 777 | Open in IMG/M |
| 3300032783|Ga0335079_10000004 | All Organisms → cellular organisms → Bacteria | 599871 | Open in IMG/M |
| 3300032783|Ga0335079_10012327 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 9757 | Open in IMG/M |
| 3300032783|Ga0335079_10034776 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 5787 | Open in IMG/M |
| 3300032783|Ga0335079_10052965 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4644 | Open in IMG/M |
| 3300032783|Ga0335079_10063540 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4205 | Open in IMG/M |
| 3300032783|Ga0335079_10157141 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2547 | Open in IMG/M |
| 3300032783|Ga0335079_10194158 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2255 | Open in IMG/M |
| 3300032783|Ga0335079_10195366 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2247 | Open in IMG/M |
| 3300032783|Ga0335079_10660788 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1096 | Open in IMG/M |
| 3300032783|Ga0335079_11339858 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 713 | Open in IMG/M |
| 3300032783|Ga0335079_11961740 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300032805|Ga0335078_10000001 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1101837 | Open in IMG/M |
| 3300032805|Ga0335078_10002603 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 27221 | Open in IMG/M |
| 3300032805|Ga0335078_10019346 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 10125 | Open in IMG/M |
| 3300032805|Ga0335078_10264545 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2336 | Open in IMG/M |
| 3300032805|Ga0335078_10358702 | All Organisms → cellular organisms → Bacteria | 1932 | Open in IMG/M |
| 3300032805|Ga0335078_10440584 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1695 | Open in IMG/M |
| 3300032805|Ga0335078_10556659 | All Organisms → cellular organisms → Bacteria | 1458 | Open in IMG/M |
| 3300032805|Ga0335078_11215050 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 869 | Open in IMG/M |
| 3300032805|Ga0335078_11370728 | All Organisms → cellular organisms → Bacteria | 801 | Open in IMG/M |
| 3300032805|Ga0335078_12250034 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 573 | Open in IMG/M |
| 3300032805|Ga0335078_12256505 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 572 | Open in IMG/M |
| 3300032828|Ga0335080_10000134 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 64268 | Open in IMG/M |
| 3300032828|Ga0335080_10021987 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 6902 | Open in IMG/M |
| 3300032828|Ga0335080_10118630 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2936 | Open in IMG/M |
| 3300032828|Ga0335080_10279575 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1818 | Open in IMG/M |
| 3300032828|Ga0335080_10531939 | All Organisms → cellular organisms → Bacteria | 1244 | Open in IMG/M |
| 3300032828|Ga0335080_10595804 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1163 | Open in IMG/M |
| 3300032828|Ga0335080_11969858 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 566 | Open in IMG/M |
| 3300032829|Ga0335070_10007351 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 12923 | Open in IMG/M |
| 3300032829|Ga0335070_10021041 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 7529 | Open in IMG/M |
| 3300032829|Ga0335070_10049750 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4622 | Open in IMG/M |
| 3300032892|Ga0335081_10292668 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2163 | Open in IMG/M |
| 3300032893|Ga0335069_10147233 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2920 | Open in IMG/M |
| 3300032893|Ga0335069_11690295 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 675 | Open in IMG/M |
| 3300032895|Ga0335074_10000025 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 301978 | Open in IMG/M |
| 3300032895|Ga0335074_10016661 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 10351 | Open in IMG/M |
| 3300032895|Ga0335074_10022049 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 8980 | Open in IMG/M |
| 3300032895|Ga0335074_10042429 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 6314 | Open in IMG/M |
| 3300032895|Ga0335074_10241563 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2138 | Open in IMG/M |
| 3300032898|Ga0335072_10242306 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2083 | Open in IMG/M |
| 3300032898|Ga0335072_10292378 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1833 | Open in IMG/M |
| 3300032954|Ga0335083_10002393 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 24781 | Open in IMG/M |
| 3300032954|Ga0335083_10181949 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1945 | Open in IMG/M |
| 3300032954|Ga0335083_10660179 | All Organisms → cellular organisms → Bacteria | 854 | Open in IMG/M |
| 3300032955|Ga0335076_10007831 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 10770 | Open in IMG/M |
| 3300032955|Ga0335076_10019441 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 6816 | Open in IMG/M |
| 3300032955|Ga0335076_10330807 | All Organisms → cellular organisms → Bacteria | 1410 | Open in IMG/M |
| 3300032955|Ga0335076_11757915 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300033158|Ga0335077_10635402 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1109 | Open in IMG/M |
| 3300033402|Ga0326728_10192841 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2075 | Open in IMG/M |
| 3300033402|Ga0326728_10233884 | All Organisms → cellular organisms → Bacteria | 1781 | Open in IMG/M |
| 3300033402|Ga0326728_10452446 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1067 | Open in IMG/M |
| 3300033547|Ga0316212_1012752 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1195 | Open in IMG/M |
| 3300033807|Ga0314866_062650 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 625 | Open in IMG/M |
| 3300033888|Ga0334792_012407 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3290 | Open in IMG/M |
| 3300033977|Ga0314861_0100380 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1479 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 12.96% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 9.28% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 9.28% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 8.84% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.48% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 5.45% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 4.27% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.98% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.24% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.24% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.09% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.95% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.65% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.91% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.77% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.47% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.47% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.47% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.33% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.18% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.62% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.03% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.88% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.88% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.74% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.59% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.59% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.59% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.59% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.44% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.44% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.44% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.44% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.29% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.29% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.29% |
| Termite Gut | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut | 0.29% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.29% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.15% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.15% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.15% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.15% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.15% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.15% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.15% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.15% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.15% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.15% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.15% |
| Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Roots | 0.15% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.15% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.15% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459012 | Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO1O1 lysis Rhizosphere grass | Environmental | Open in IMG/M |
| 2199352024 | Bare-fallow DEEP SOIL | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
| 3300000579 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A01 | Environmental | Open in IMG/M |
| 3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001084 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 | Environmental | Open in IMG/M |
| 3300001166 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O2 | Environmental | Open in IMG/M |
| 3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
| 3300001546 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300003218 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 | Environmental | Open in IMG/M |
| 3300003219 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005532 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 | Environmental | Open in IMG/M |
| 3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300005952 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 | Environmental | Open in IMG/M |
| 3300005993 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 | Environmental | Open in IMG/M |
| 3300005994 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 | Environmental | Open in IMG/M |
| 3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300007982 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
| 3300009623 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 | Environmental | Open in IMG/M |
| 3300009624 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 | Environmental | Open in IMG/M |
| 3300009628 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10 | Environmental | Open in IMG/M |
| 3300009640 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40 | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Host-Associated | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300014052 | Permafrost microbial communities from Nunavut, Canada - A23_35cm_12M | Environmental | Open in IMG/M |
| 3300014156 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaG | Environmental | Open in IMG/M |
| 3300014158 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaG | Environmental | Open in IMG/M |
| 3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
| 3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
| 3300014168 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaG | Environmental | Open in IMG/M |
| 3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300014498 | Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300016750 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
| 3300017925 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40 | Environmental | Open in IMG/M |
| 3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
| 3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019278 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019786 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
| 3300020021 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300021858 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022531 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300022717 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022734 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU3 | Host-Associated | Open in IMG/M |
| 3300023255 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P2 10-14 | Environmental | Open in IMG/M |
| 3300024331 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK09 | Environmental | Open in IMG/M |
| 3300025494 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025509 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026291 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 (SPAdes) | Environmental | Open in IMG/M |
| 3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
| 3300026490 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-A | Environmental | Open in IMG/M |
| 3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300026645 | Grasslands soil microbial communities from Chapel Hill, North Carolina, USA that are Nitrogen fertilized -Nitrogen NN342 (SPAdes) | Environmental | Open in IMG/M |
| 3300027497 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027502 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027568 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027604 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027619 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027625 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027629 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027648 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027680 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 80 (SPAdes) | Environmental | Open in IMG/M |
| 3300027698 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027701 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027767 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027825 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028036 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 | Host-Associated | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Host-Associated | Open in IMG/M |
| 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
| 3300028863 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_1 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030053 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300030494 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2) | Environmental | Open in IMG/M |
| 3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
| 3300030847 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA10 SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030848 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA8 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030916 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA12 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030991 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Host-Associated | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
| 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Host-Associated | Open in IMG/M |
| 3300033807 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_100_10 | Environmental | Open in IMG/M |
| 3300033888 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-3-X1 | Environmental | Open in IMG/M |
| 3300033977 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - SJ75 | Environmental | Open in IMG/M |
| 3300034130 | Peat soil microbial communities from wetlands in Alaska, United States - Collapse_03_16 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| N56_06463120 | 2170459012 | Grass Soil | MNGVKFLFAAYIATWVIHGIYLGSLVRRFSRLRQQLKELRKGK |
| deeps_01300060 | 2199352024 | Soil | MNAVKYMVAAYIATWVIHGVYIGTLVSRFNRLRQQMRELTKEK |
| INPhiseqgaiiFebDRAFT_1014713992 | 3300000364 | Soil | MNGVKFLFAAYVATWVIHVFYLGTLARRFKRLRQELRELGKGK* |
| JGI12270J11330_100245743 | 3300000567 | Peatlands Soil | MNSIRFLYAAYTATWVIHAVYLGSLVRRFSRLRREMKELGKGK* |
| JGI12270J11330_100250565 | 3300000567 | Peatlands Soil | MNAIKFLFAAYIVTWLIHAAYLGSLVRRFSRLRQQLKELGKK* |
| JGI12270J11330_100470993 | 3300000567 | Peatlands Soil | MNALKFLFAAYIATWVIHAFYLGTLVRRFGRLRRELQELGKEK* |
| JGI12270J11330_102181221 | 3300000567 | Peatlands Soil | MNAIKFLYAAYITTWLIHSIYLGTLVTRFRRLRQQLKELGK* |
| AP72_2010_repI_A01DRAFT_10001124 | 3300000579 | Forest Soil | MNAVRFLFTAYVATWVIHLFYIGTLVRRFSKLRQQLRELGKGK* |
| JGI1027J11758_128145261 | 3300000789 | Soil | MNGVKFLFAAYVATWVIHVFYLGTLARRFKRLRRELRELGKEK* |
| JGI1027J11758_128155052 | 3300000789 | Soil | MNSVKFLYAAYIATWVIHLFYLGTLVRRFSRLRQQLR |
| JGI12648J13191_10114952 | 3300001084 | Forest Soil | MNAVKFLVAAYIATWLIHGVYLGSLVRRFGRLRQQLNEVKKK* |
| JGI12694J13545_10145172 | 3300001166 | Forest Soil | MNAVKFLVAAYIATWLIHGVYLXSLVRRFGRLRQQLKEXKKKXXRXXDLMWG |
| JGI12269J14319_100312855 | 3300001356 | Peatlands Soil | MNAIKFLFAAYIATWVIHGAYLASLVRRFSRLRRQLKELGKK* |
| JGI12269J14319_102531512 | 3300001356 | Peatlands Soil | MNAIKFLFAAYIVTWLIHGIYLGSLVRRFSRLRQQLKELGKGK* |
| JGI12659J15293_100112082 | 3300001546 | Forest Soil | MNAVKFLVAAYIATWLIHGVYLGSLVRRFGRLRQQLKEVKKK* |
| JGI12635J15846_101305432 | 3300001593 | Forest Soil | MNAIKFLFAAYIATWVIHGVYLGSLIRRYSRLRQQLKELGKEK* |
| JGI12635J15846_101397943 | 3300001593 | Forest Soil | MNALKFLFAAYIATWVIHGVYLGSLVRRFRRLRQQLEELGKEK* |
| JGIcombinedJ26739_1001183344 | 3300002245 | Forest Soil | MNAVKFLVAAYIATWLIHGVYLGSLVRRFGRLRQQLKEVKKGK* |
| JGI26339J46600_100734992 | 3300003218 | Bog Forest Soil | MNALKFLFAAYIATWLIHAFYLGTLVRRFSRLRGQLKELGKGK* |
| JGI26341J46601_100127993 | 3300003219 | Bog Forest Soil | MNGIRFLFAAYIATWVIHGVYLGSLVRRFSRLRQELKEVGKEK* |
| JGIcombinedJ51221_100392562 | 3300003505 | Forest Soil | MNAVKFLCAAYIATWAIHLFYIGTLVRRFSRLRQQLRELGKGK* |
| JGIcombinedJ51221_101719102 | 3300003505 | Forest Soil | MNAIKFLFAAYIATWVIHGVYLGSLIRRYSRLRQQLKELGKPK* |
| JGIcombinedJ51221_104658262 | 3300003505 | Forest Soil | MNAIKFLFAAYIATWVIHGAYLASLVRRFGKLRRELKEVGKE |
| Ga0062385_100381882 | 3300004080 | Bog Forest Soil | MNAIKFLFAAYIATWVIHAFYIGTLVRRFSRLRQEMKELGKK* |
| Ga0062385_102087482 | 3300004080 | Bog Forest Soil | MNATIKFLFAAYIATWVIHSFYIGTLVRRFKRLRQELSELRRKK* |
| Ga0062384_1002143242 | 3300004082 | Bog Forest Soil | GAMNATIKFLFAAYIATWVIHSFYIGTLVRRFKRLRQELSELRRKK* |
| Ga0062387_1001164833 | 3300004091 | Bog Forest Soil | MNAVKFLFAAYIAVWVIHSFYIGTLVRRFSLLRQQLKELGKGN* |
| Ga0062387_1017412842 | 3300004091 | Bog Forest Soil | MNAIKFLFAAYIATWVIHGAYLASLVRRFSKLRQQLKELGKK* |
| Ga0062389_1005558392 | 3300004092 | Bog Forest Soil | MHALKFLYAAYIATWTIHLFYLSSLVRRFSRLRREMKELEKGR* |
| Ga0062386_1002040523 | 3300004152 | Bog Forest Soil | MNAVKFLIAAYIATWVIHGVYIGSLVQRFSRLRRESKELGKK* |
| Ga0062386_1008633892 | 3300004152 | Bog Forest Soil | MNGIKFLFAAYIATWVIHGVYLGSLVRRFSRLRQQLKEVGKK* |
| Ga0062386_1009561701 | 3300004152 | Bog Forest Soil | PEPAMNALKFLFAAYIATWVIHAFYLGTLVRRFGRLRRELQELGKEK* |
| Ga0063356_1018420562 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MRFLYAAYVVTWVIHIGYLLSLTARFRRLQRDMAELERSKS* |
| Ga0066395_100721571 | 3300004633 | Tropical Forest Soil | MNAVRFLFAAYVATWVIHLFYIGTLVRRFGKLRQQLRELGGGK* |
| Ga0066395_101108331 | 3300004633 | Tropical Forest Soil | MNATKFLIAAYVATWLIHGGYILSLVRRFRKLRQQVKELGKQK* |
| Ga0066395_101579092 | 3300004633 | Tropical Forest Soil | MNAVKFLFAAYIATWVIHGVYLGSLVRRFSHLRQQLKDLGKK* |
| Ga0066395_104629311 | 3300004633 | Tropical Forest Soil | MNAVKFLFAAYIATWVIHLFYISTIARRFSKLRQQLKELGKGK* |
| Ga0062388_1007632182 | 3300004635 | Bog Forest Soil | MNAIKFLFAAYLATWLIHGIYIAMMSRRFNRLKRELKELERDK* |
| Ga0066690_105281252 | 3300005177 | Soil | MNAVKFLFAAYVATWAIHLFYIGTLVRRFNRLRQQLRELGKGK* |
| Ga0066684_106800582 | 3300005179 | Soil | MNAVKFLFAAYVATWAIHLFYIGTLVRRFSRLRQQLRELGKGK* |
| Ga0066685_109148632 | 3300005180 | Soil | MNGVKYLFAAYIATWVIHGVYLGSLVRRFSRLRQQLKELGKK* |
| Ga0066388_1021481922 | 3300005332 | Tropical Forest Soil | MNAVKFLVAAYVATWVIHIFYLGTIARRFSKLRQQLRDLGKAGK* |
| Ga0066388_1075206222 | 3300005332 | Tropical Forest Soil | MNTVKFLFAAYIATWVIHGLYIGSLVRRFSHLRQQLKEFGKK* |
| Ga0070709_1000046918 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MNAVRFLFGAYIATWVIHLFYIGTLVSRFSKLRQQLRELGKGK* |
| Ga0070709_101021552 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MNAVKFLFAAYIATWVIHAFYLGTLVRRFSQLRQQLKELGKK* |
| Ga0070709_104278462 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MNAVKFLFAAYIATWAIHLFYIGTLIRRFSRLRQQLRELGKGK* |
| Ga0070709_108918151 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MNAIKFLFAAYIATWVIHVGYITYLVRSFKKLRHELKEITKGKPE* |
| Ga0070714_1001818254 | 3300005435 | Agricultural Soil | MKYLFAAYIATWAIHGIYLGSLVQRFKRLRQQWKELGKK* |
| Ga0070714_1008042252 | 3300005435 | Agricultural Soil | MNAVKFLFAAYIATWVIHGAYLGSLVRRFSHLRQQLKGLGKK* |
| Ga0070714_1011012081 | 3300005435 | Agricultural Soil | MNGIKFLFAAYIATWFIHGAYLTHLVRSFKRLRDELREMEKK* |
| Ga0070713_1000100803 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MNAIKFLFAAYIATWVIHGVYMGSLVRRFSRLRQQSKELEKGK* |
| Ga0070713_1006960882 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MNSIKYLYAAYAATWIIHAFYLGTLVRRYSRLRQQLKELGKK* |
| Ga0070713_1007119092 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MNAVKFLFAAYIATWAIHLLYISTIARRFSKLRQQLKELSKGK* |
| Ga0070713_1011829872 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MNAIKFLFAAYIATWVIHASYIGTLVLRFRRLRQELKELG |
| Ga0070708_1001263401 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MNAVKFLFAAYVATWVIHGAYLGSLVRRFGRLRQQLKELGKGQ* |
| Ga0070706_1000874465 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MNAIKFLFAAYIATWVIHGVYLGSLVRRFSRLRQQMKELSKSK* |
| Ga0070707_1004040262 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MNAVKFLFAAYVATWVIHGAYLGSLVRRFGRLRQQLKELGKGK* |
| Ga0070741_100691655 | 3300005529 | Surface Soil | MSGVKFLFAAYIATWLIHGAYLTHLVRSFKRLRRELKELRDGQS* |
| Ga0070739_102148822 | 3300005532 | Surface Soil | MNAIKFLIAAYVATWVIHIFYIGTIARRFSNLRQQLRELGKGE* |
| Ga0070734_1000001189 | 3300005533 | Surface Soil | VNAIKFLVAAYIATWAIHFFYMGTLVTRFRRLQKQRKELGKE* |
| Ga0070734_10000180109 | 3300005533 | Surface Soil | MNSVKFLFAAYIATWLIHGFYLGTIVQRFRRLRSQLQQMGKK* |
| Ga0070734_1000072527 | 3300005533 | Surface Soil | MNAVKFLFAAYIATWVIHGLYLGSLVRRFSRLRQQVKELGKK* |
| Ga0070734_101776472 | 3300005533 | Surface Soil | MNSVKFLFAAYIATWVIHGVYLGSVVRRFSQLRKQLKELGKGK* |
| Ga0070734_102408482 | 3300005533 | Surface Soil | MNAIKFLIAAYIATWLIHGVYIGTLVRRFGRLRQQMKELEKGK* |
| Ga0070734_104082692 | 3300005533 | Surface Soil | SATESEFPMNAIKFLFAAYIVTWVIHSVYIGSLVRRFGRLRQQLKELGKGK* |
| Ga0070735_1000063927 | 3300005534 | Surface Soil | MNSVKFLFAAYIATWVIHGVYLGSLVRRFSHLRKQLKELGKGK* |
| Ga0070735_1000180214 | 3300005534 | Surface Soil | MNAVKFLIAAYIATWVIHGTYLATLVSRFRGLKRQMKELGKK* |
| Ga0070735_1000248411 | 3300005534 | Surface Soil | MNSVKFLFAAYIATWVIHGVYLGSVVRRFSQLRKQLKELGKEK* |
| Ga0070735_100076334 | 3300005534 | Surface Soil | MYAAYIATWTIHVFYLGTLVRRFSKLRREMKDLGKGK* |
| Ga0070735_100255195 | 3300005534 | Surface Soil | MNAIKFLFAAYIATWVIHGSYIGTLVLRFRRLRQELQELGKGK* |
| Ga0070735_100884643 | 3300005534 | Surface Soil | MNAIKFLFAAYLATWVIHGAYLASLVRRFSRLRRELKEVQKEK* |
| Ga0070735_105422221 | 3300005534 | Surface Soil | MSGVKFLFAAYIATWLIHGAYLTHLVRSFKRLRRELKELRQRQS* |
| Ga0070730_1000089520 | 3300005537 | Surface Soil | MNAIKFLFAAYIATWLIHGFYIGTLMRRFSRARRQFSELEKGK* |
| Ga0070730_100289903 | 3300005537 | Surface Soil | MNAIKFLFAAYIATWVIHASYIGTLVLRFRRLRQELQQLGKGK* |
| Ga0070730_108335092 | 3300005537 | Surface Soil | MKNAGFLFAAYIATWVIHGSYLATLVRRFGRLRRQMKELEKEK* |
| Ga0070731_10000084158 | 3300005538 | Surface Soil | MNSIRFMYAAYIATWTIHVFYLGTLVRRFSKLRREMKDLGKGK* |
| Ga0070731_100108447 | 3300005538 | Surface Soil | MNALKFLVAAYIATWVIHGFYIGSLVVRFRSLRQQMKDVGKGK* |
| Ga0070731_1001235710 | 3300005538 | Surface Soil | MNAIKFLFAAYIATWLIHGIYLGTLVRRFSRLRQQLKELQKK* |
| Ga0070731_100173222 | 3300005538 | Surface Soil | MNAVKFLIAAYIATWVIHGAYMASLVRRFGRFRRELKDVGKKQDG* |
| Ga0070731_100313183 | 3300005538 | Surface Soil | MKNAGFLFAAYSATWIIHGSYLASLVRRFGRLRQQLKELEKGK* |
| Ga0070733_1000008628 | 3300005541 | Surface Soil | MKALKFLYAAYIVTWLIHALYLGSLVRRFSRLRQQLKEMGK* |
| Ga0070733_1000021715 | 3300005541 | Surface Soil | MHALKFLYAAYIATWTIHLFYLSTLVRRFSRLRREMKELGKGN* |
| Ga0070733_100123891 | 3300005541 | Surface Soil | MNAVKFMVAAYVATWVIHAGYIATLVSRYRKLRQQLKELGKGK* |
| Ga0070733_100920783 | 3300005541 | Surface Soil | MNALKFLFAAYIATWVIHCFYIGTLVTRFRKLRQQLKELGKGK* |
| Ga0070733_101569593 | 3300005541 | Surface Soil | MKNAGFLFAAYIATWLIHGSYLASLVRRFARLRQQLRDLEKEK* |
| Ga0070733_102449712 | 3300005541 | Surface Soil | MNAVKFLFAAYIATWVIHGIYLGSLVRRFSHLRTQLKEVRKGK* |
| Ga0070733_102499582 | 3300005541 | Surface Soil | MNSLKFLYAAYIATWTIHVFYIGTLVRRFSRLRREMKELGKGK* |
| Ga0070733_104012072 | 3300005541 | Surface Soil | MNAVKFLIAAYVATWVIHGAYIGSLVRRFGRLRRELKDVGKRK* |
| Ga0070732_100038587 | 3300005542 | Surface Soil | MNAVKFLFAAYIATWAIHLFYISTLVRRFSRLRQQLRELGKGK* |
| Ga0070732_100785331 | 3300005542 | Surface Soil | MNAVKFLFAAYIATWAIHLFYISTLVRRFSRLRQQLRELGK* |
| Ga0070732_101076272 | 3300005542 | Surface Soil | MNAVKFLFAAYIATWAIHLFYIGTLMRRFSRLRQQLRELGKGK* |
| Ga0070732_101553082 | 3300005542 | Surface Soil | MNAIKFLFAAYIATWVIHAFYLGTLVRRFSNLRRQLKELGKGK* |
| Ga0070732_102375192 | 3300005542 | Surface Soil | MNSIKFLFAAYIATWVIHSFYLATLVRRFKHLRQQLKDLGKGK* |
| Ga0070732_103632512 | 3300005542 | Surface Soil | MNAMKFLIAAYVATWVIHGFYIGTLVARFKGLREQMKELRK* |
| Ga0066692_104722161 | 3300005555 | Soil | MNAVKFLFTAYVATWAIHLFYITTLVRRFSRLRQQLRELGKGK* |
| Ga0066702_102141982 | 3300005575 | Soil | MNAIKFLIAAYVATWVIHGVYLASLVRRFSRLRQQSRELEKK* |
| Ga0070761_100168072 | 3300005591 | Soil | MNAVKFLIAAYIATWLIHGVYIGTLVRRFSRLRRELRDIERQK* |
| Ga0070761_100211883 | 3300005591 | Soil | MNSIKFLFAAYIATWVIHGVYLGSLATRFRRLRRQLKEAGKQR* |
| Ga0070761_100368963 | 3300005591 | Soil | MNAIKFLIAAYIATWLIHGVYIGSLVQRFIRLRRELKELAKGK* |
| Ga0070762_101648131 | 3300005602 | Soil | MNAIKFLFAAYIATWVIHGVYLASLVRRFGRLRRELRDVGKGISHRRG* |
| Ga0070762_106203231 | 3300005602 | Soil | MNAIKFLFAAYIATWVIHGVYLGSLVRRFGRLRRELGDVGKGISHRRG* |
| Ga0070762_108320621 | 3300005602 | Soil | MNAVKFLFAAYIATWVIHGVYLGTLVRRFSKLRQQLKDVGRKG* |
| Ga0070762_111372071 | 3300005602 | Soil | FPMNAVKFLFAAYIATWAIHLFYIGTLVRRFSRLRQQLRELGKGK* |
| Ga0070763_100410764 | 3300005610 | Soil | MNAVKFLIAAYLATWLIHGIYIGTLVRRFSRLRRESEDIGKQK* |
| Ga0066903_1000545632 | 3300005764 | Tropical Forest Soil | MNAVKFLFAAYIATWVIHLFYISTIVRRFSRLRQQLRELGKGK* |
| Ga0066903_1001205652 | 3300005764 | Tropical Forest Soil | MNGVKFLFAAYIATWVIHFFYISTIARRFGKLRQQLKELGKGK* |
| Ga0066903_1025863702 | 3300005764 | Tropical Forest Soil | MNTVKFLFAAYIATWVIHGLYIGSLVRRFSHLRQQLKDIRKK* |
| Ga0066903_1064604932 | 3300005764 | Tropical Forest Soil | MNAVKFLFAAYMATWVIHAFYLGTLVRRFSRLKQQLKEWGKK* |
| Ga0070766_100017112 | 3300005921 | Soil | MNAIKFLFAAYIATWVIHGVYLGSLIRRYSRLRQQLKELGKQK* |
| Ga0070766_102279462 | 3300005921 | Soil | MNAVKFLIAAYVATWVIHGTYIGSLVRRFGRLRRELKDVGKGK* |
| Ga0080026_100031053 | 3300005952 | Permafrost Soil | MNAIKFLFAAYIATWVIHGVYLGSLIRRYGRLRQQLKELGKEK* |
| Ga0080027_102868702 | 3300005993 | Prmafrost Soil | FLIAAYIATWAIHGVYLTTLVRRLGKAKRELKELGKKED* |
| Ga0066789_100693152 | 3300005994 | Soil | MNAVKFLFAAYIATWVIHGVYLGSLVRRFSRLRQQLKELGKGK* |
| Ga0066789_105111582 | 3300005994 | Soil | MNAIKFLFAAYIATWVIHGVYLGSLVRRFGRLRQQLKELGKK* |
| Ga0066790_100086124 | 3300005995 | Soil | MNAVRFLFAAYIATWVIHGVYLGSLVRRFSRLRRQLKELGKK* |
| Ga0070717_101949504 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MNAIKFLFAAYIATWVIHGLYMGSLVRRFSRLRQQSKELEKGK* |
| Ga0070717_108175762 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MNAVKFLFAAYAATWAIHLFYIGTLVRRFSRLRQQLRELGKGK* |
| Ga0075028_1001096962 | 3300006050 | Watersheds | MNAVKFLVAAYIATWVIHGVYIGTLFSRFSKLKREKKELGRG* |
| Ga0075029_1000341043 | 3300006052 | Watersheds | MNTVRFLFAAYVATWVIHLFYLGTLVRRFSRLRQQLRELGKGK* |
| Ga0075029_1000990772 | 3300006052 | Watersheds | MNGVKFLIAAYIATWVIHGVYIGSLFRRFGRLRTQLKELGKK* |
| Ga0075029_1001361503 | 3300006052 | Watersheds | MNGIKFLFAAYIATWLIHGFYLATLVRRFSRLREQLRELGKK* |
| Ga0075029_1001711142 | 3300006052 | Watersheds | MNAIKFLFAAYIAVWVIHVFYLGTLVRRFSRLRQQMKELGKK* |
| Ga0075029_1001980272 | 3300006052 | Watersheds | MNAVKFLFAAYVATWVIHLFYLGTLVRRFSQLRQQLRELGKGK* |
| Ga0075029_1006725451 | 3300006052 | Watersheds | MNAIKFLFAAYIATWVIHAFYIGTLVRRFSSLRQQLKELGKGK* |
| Ga0075029_1007020922 | 3300006052 | Watersheds | QNQSSAQQECGMSAVKFLFAAYIATWVIHLFYIGTVVRRFSRLRQQLRELSKGK* |
| Ga0075029_1011050802 | 3300006052 | Watersheds | MNAVKFLFAAYAATWVIHLFYISTLVRRFSRLRQQLRELGKGK* |
| Ga0075029_1012733982 | 3300006052 | Watersheds | MNAIKFLFAAYIATWVIHAFYIGTLVRRFSRLRQQWKELGKGK* |
| Ga0075017_1000016265 | 3300006059 | Watersheds | MNSIKYLFAAYIATWLIHAVYLGSLVRRFSRLRQQLKELGKGK* |
| Ga0075017_1001057384 | 3300006059 | Watersheds | MNAVKFLFAAYVATWAIHLFYIGTLVRRFSRLRQQLREVGKGK* |
| Ga0075019_106475542 | 3300006086 | Watersheds | MNPVKFLAAAYIATWVIHSFYLATLVRRFRRLHGQLKELGKE* |
| Ga0075019_109512252 | 3300006086 | Watersheds | MNAVKFLFAAYVATWVIHLFYLGTLVRRFSQLRQQLRELGKG |
| Ga0075030_1000038032 | 3300006162 | Watersheds | MNAIKFLFAAYIATWVIHAFYLGTLVRRFSRLRRQLKELGKGK* |
| Ga0075030_1001201192 | 3300006162 | Watersheds | MNAVKFLFAAYIATWVIHVFYVGTLVRRFSRLRQQLKELGKEK* |
| Ga0075030_1001896103 | 3300006162 | Watersheds | MNAVKFLFAAYIAVWVIHAFYIGTLVRRFSSMRQQLKELGKGK* |
| Ga0070715_106000291 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | FLFAAYIATWLIHGAYLTHLVRSFKRLRDELREMGKK* |
| Ga0070716_1012153662 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MKYLFAAYIATWLIHGAYLGSLVRRFGRLREQWKELGKK* |
| Ga0070765_1000741353 | 3300006176 | Soil | MNAIKFLFAAYIATWLIHAFYLGTLVRRFQRLRQQKKELDRSPHS* |
| Ga0070765_1001467382 | 3300006176 | Soil | MNAVKFLFAAYIATWLIHALYLGTLVSRFSRLRQQLKELGNGKKREF* |
| Ga0070765_1002355623 | 3300006176 | Soil | MNAVRFLFAAYIATWVIHGVYLGTLVRRFSKLRQQLKDVGRKG* |
| Ga0075021_107473222 | 3300006354 | Watersheds | MNAVKFLVAAYIATWVIHGVYIGTLVSRFSTLKREKKEVGKDQ* |
| Ga0079222_117701132 | 3300006755 | Agricultural Soil | MNAIKFLFAAYIATWVIHVSYIGTLVLRFRRLRQQLKELGQAKSTFR* |
| Ga0079221_111276442 | 3300006804 | Agricultural Soil | MNTVKFLFAAYIATWVIHGLYIGSLVRRFSHLRQQLKDIGKK* |
| Ga0073928_100438685 | 3300006893 | Iron-Sulfur Acid Spring | MNAIKFLFAAYIATWVIHGVYLGSLVRRFRRLRQQLKEVGKGK* |
| Ga0073928_100641593 | 3300006893 | Iron-Sulfur Acid Spring | MNAVKFLVAAYIATWLIHGVYLGSLVRRFRRLRQQLKDVKKGN* |
| Ga0102924_100131424 | 3300007982 | Iron-Sulfur Acid Spring | MNGIKFLFAAYIATWVIHGVYLGSLVQRFSRLRRELKELGKGK* |
| Ga0102924_10729423 | 3300007982 | Iron-Sulfur Acid Spring | MNAIKFLFAAYIATWVIHASYIGTLVLRFRRLRQELQELEKGK* |
| Ga0102924_14111631 | 3300007982 | Iron-Sulfur Acid Spring | MNAIEFLFAAYIATWVIHSFYIGTLVLRFRRLRQELKELGKGNSPSVSDIHG* |
| Ga0099828_104019382 | 3300009089 | Vadose Zone Soil | MNAVKFLFAAYIATWVIHGIYLVSLVRRFGRLRQQLKEFGKK* |
| Ga0116222_11943271 | 3300009521 | Peatlands Soil | MNGIKFLFAAYIATWVIHGVYLGSLVRRFGKLRRELKEVGKGK* |
| Ga0116218_10182315 | 3300009522 | Peatlands Soil | MNAIKFLFAAYIVTWVIHGVYLGSLVRRFSRLRRQLKEVGKK* |
| Ga0116220_102981251 | 3300009525 | Peatlands Soil | MNAVKFLFAAYIITWVIHSFYLGSLVRRFSRLREQLKELQKK* |
| Ga0116133_10392252 | 3300009623 | Peatland | MNAIKFLFAAYIVTWLIHGAYLGSLVRRFSRLRREMKEMGKK* |
| Ga0116133_11748212 | 3300009623 | Peatland | MNAVKFLIAAYIATWAIHGVYIATLVRRFNRLRRESKELRKAK* |
| Ga0116105_11873132 | 3300009624 | Peatland | FAAYIATWLIHGVYLGTLVRRFSKLRQQLKDVGRRG* |
| Ga0116125_10006458 | 3300009628 | Peatland | MNAVKFLIAAYIATWAIHGVYIATLIQRFNRLRRESKELRKAK* |
| Ga0116125_11978801 | 3300009628 | Peatland | MTAVKFLFAAYIATWLIHGVYLGTLVRRFSKLRQQLKDVGRRG* |
| Ga0116125_12258632 | 3300009628 | Peatland | MNAVKFLIAAYVATWAIHGVYIATLIQRFNRLRRESKELRKAK* |
| Ga0116126_10269293 | 3300009640 | Peatland | MNALKFLFAAYIATWVIHAFYLGTLVRRFGRLHRQLQELGKEK* |
| Ga0116216_109404742 | 3300009698 | Peatlands Soil | MNAVKFLFAAYIAVWVIHSFYIGTLVRRFSSLRQQLKELGKGN* |
| Ga0126374_100526592 | 3300009792 | Tropical Forest Soil | MNGVKFLFAAYIATWVIHFFYISTIARRFGKLRRQLKELGKDK* |
| Ga0116219_100977204 | 3300009824 | Peatlands Soil | MNAIKFLFAAYIATWVIHGAYLASLVRRFGRLRQQLKEVGKGK* |
| Ga0123355_100039638 | 3300009826 | Termite Gut | MNAVKFLFAAYITTWVIHSFYLGTLVRRFARLRQQWKELGKGK* |
| Ga0123355_1001659910 | 3300009826 | Termite Gut | MNAVKFLFAAYIVTWAIHAFYLSTLVRRFARLRRELKELGKGKEK* |
| Ga0126380_100779653 | 3300010043 | Tropical Forest Soil | MNTVKFLIAAYIATWAIHLFYIGTIARRFSKLRQQLKEIGRGK* |
| Ga0126380_119385942 | 3300010043 | Tropical Forest Soil | MNAVKFLFAAYTATWVIHVFYMATIARRFSRLRRELRDLGKGGN* |
| Ga0126373_100553094 | 3300010048 | Tropical Forest Soil | VNAVKFLFAAYVATWVIHLFYISTIARRFSKLRQQLKELGKGK* |
| Ga0126373_102128333 | 3300010048 | Tropical Forest Soil | MNAIKFLIAAYLATWVIHGAYIGTLVSRFSKLRQRMRDLETRK* |
| Ga0126373_102184172 | 3300010048 | Tropical Forest Soil | MKAVRFLFAAYTATWLIHGLYVGSLVRRFSHLRQQLKELGKK* |
| Ga0126373_103353922 | 3300010048 | Tropical Forest Soil | MNAIKFLVAAYIATWVIHGIYLGSLVRRFSHLRQQLKDLEKK* |
| Ga0126373_105760851 | 3300010048 | Tropical Forest Soil | MNAIKFLLAAYVATWVIHGAYLGTLVRRFARLRRELRELGKSK* |
| Ga0126373_129325782 | 3300010048 | Tropical Forest Soil | MNTVKFLFAAYIATWVIHLFYIGTIARRFSKLRQQLTEISKDK* |
| Ga0126373_129810462 | 3300010048 | Tropical Forest Soil | MNAIKFLFAAYIATWVIHGLYIGSLVRRFSHLRQQLKEFGKK* |
| Ga0074046_102926072 | 3300010339 | Bog Forest Soil | MNALKFLFAAYIATWVIHAFYLGTLVRRFGRLRQQLRELGKGK* |
| Ga0074045_100311444 | 3300010341 | Bog Forest Soil | MNSIKFLFAAYIATWVIHALYLGTLVRRFSRLRQDLKELGKGPDAGRG* |
| Ga0074045_108720592 | 3300010341 | Bog Forest Soil | MNSIKFLFAAYIAAWAIHAFYIGTLIRRFQRLRQQKNELDEGGK* |
| Ga0074044_101194132 | 3300010343 | Bog Forest Soil | MNAIKFLFAAYIATWVIHGLYLGSLVRRFSRLRRELKEVGRK* |
| Ga0126370_100275724 | 3300010358 | Tropical Forest Soil | MNATKFLIAAYAATWLIHGGYILSLVRRFRKLRQQVKELGKQK* |
| Ga0126370_106320932 | 3300010358 | Tropical Forest Soil | MNGIKFLFAAYIATWLIHLLYIGSLVRRFSRLRQQLKELGKRGS* |
| Ga0126370_119524912 | 3300010358 | Tropical Forest Soil | FLFAAYIATWVIHGVYLGTLVRRFSHLRQQLKDLGKK* |
| Ga0126376_105866382 | 3300010359 | Tropical Forest Soil | MNGVKFLFAAYIATWVIHFFYISTIARRFGKLRQQLKELGKDK* |
| Ga0126376_112519972 | 3300010359 | Tropical Forest Soil | MNAVKFLFAAYIATWVIHGVYFGSLVRRFSHLRQQLKDLGKK* |
| Ga0126378_108514412 | 3300010361 | Tropical Forest Soil | MNAIKFLVAAYIATWVIHGIYLVSLVRRFSHLRQQLKDLEKK* |
| Ga0126378_111854212 | 3300010361 | Tropical Forest Soil | MNTIKFLFAAYIATWVIHGRYLGSLVRRFRHLRQQLKELGKK* |
| Ga0126378_115362122 | 3300010361 | Tropical Forest Soil | MNATRFLIAAYVATWLIHGGYILSLVRRFRKLRQEMKELGKQK* |
| Ga0126378_117366772 | 3300010361 | Tropical Forest Soil | MNAIKFLFAAYIATWVIHSFYLGTLVRRFARLRRELRELGKGT* |
| Ga0126378_119552212 | 3300010361 | Tropical Forest Soil | VNAVKFLFAAYIATWVIHLFYISTIARRFSKLRQQLKDLGKGK* |
| Ga0126378_122236472 | 3300010361 | Tropical Forest Soil | MNAIKFLIAAYLATWVIHGAYIGTLLSRFSKLGQRMRDLENRK* |
| Ga0126378_130016281 | 3300010361 | Tropical Forest Soil | MNAIKFLVAAYVATWLIHGVYLGTLVRRFGLLRQQLKELREGK* |
| Ga0126379_105237231 | 3300010366 | Tropical Forest Soil | MNATRFLIAAYVATWLIHGGYILSLVRRFRKLRQQVKELGKQK* |
| Ga0126379_113783432 | 3300010366 | Tropical Forest Soil | MNAVKFLFAAYIATWVIHGVYLGTLVRRFSHLRQQLKDLGKK* |
| Ga0126381_1004165423 | 3300010376 | Tropical Forest Soil | MNTVKFLFAAYIATWVIHGLYLGSLVRRFSHLREQLKDLGKK* |
| Ga0126381_1021025052 | 3300010376 | Tropical Forest Soil | MNAIKFLIAAYLATWLIHGAYIGTLVSRFSKLRERMRDLENRK* |
| Ga0126381_1030008772 | 3300010376 | Tropical Forest Soil | MNAVKFLFAAYIATWVIHAFYLGTLVRRFSKLRDQLKELGKGK* |
| Ga0136449_1003970042 | 3300010379 | Peatlands Soil | MNAIKFLFAAYLATWVIHGVYLGSLVRRFSRLRQQLKELGKGK* |
| Ga0136449_1009017862 | 3300010379 | Peatlands Soil | MNVHALKFLYAAYIATWTIHAFYIGTLVRRFSRLRREMKELGNGK* |
| Ga0136449_1009446522 | 3300010379 | Peatlands Soil | MNAIKFLFAAYIATWAIHGVYLGSLVRRFGKLRRELKEVGKK* |
| Ga0136449_1012345072 | 3300010379 | Peatlands Soil | MNTIKFLFAAYIATWVIHGVYLASLVRRFGRLRQQLKEVGKGK* |
| Ga0136449_1016038821 | 3300010379 | Peatlands Soil | SESEPAMNAIKFLFAAYIVTWLIHAAYLGSLVRRFSRLRQQLKELGKK* |
| Ga0126383_101452892 | 3300010398 | Tropical Forest Soil | MNAVKFLFAAYIATWVIHGVYLGSLVRRFSHLRQQLKDLGKKK* |
| Ga0126383_132714511 | 3300010398 | Tropical Forest Soil | MNAVKFLFAAYMATWVIHAFYLGTLVRRFSRLKQQLKEW |
| Ga0150983_116843261 | 3300011120 | Forest Soil | AVKFLVAAYIATWLIHGVYLGSLVRRFSRLRQQLKDLKKGN* |
| Ga0150983_148806862 | 3300011120 | Forest Soil | MNAVKFLFAAYIATWAIHLFYIGTLVRRFSRLRQQLRELGKGK* |
| Ga0137378_100809403 | 3300012210 | Vadose Zone Soil | MNGIKYLFAAYIATWVIHGVYLGSLVRRFGRLRQQWKELGKK* |
| Ga0137378_110737162 | 3300012210 | Vadose Zone Soil | MNGIKYLFAAYIATWVIHGFYLGALVRRFGRLRQQAKELGKK* |
| Ga0137377_102807453 | 3300012211 | Vadose Zone Soil | MNAIKFRFAAYIATWVIHGVYLGSLVRRFSRLRQQLRELGKK* |
| Ga0137372_104989921 | 3300012350 | Vadose Zone Soil | AGSEFIMNGIKYLFAAYIATWVIHGFYLGALVRRFGRLRQQAKELGKK* |
| Ga0137366_101569602 | 3300012354 | Vadose Zone Soil | MNAVKFLFAAYIATWLIHLFYLGSLVRRFSRLRQQLKELGKGKQ* |
| Ga0150984_1159886462 | 3300012469 | Avena Fatua Rhizosphere | MNGVKFLFAAYIATWAIHVFYLGTLVRRFSRLRQQLRELGKGK* |
| Ga0137398_106500572 | 3300012683 | Vadose Zone Soil | MNAIKFLYAAYVATWLIHTFYLGSLVRRHKRLRERMKELGRARK* |
| Ga0137419_116180632 | 3300012925 | Vadose Zone Soil | MNSIKFMYAAYAATWVIHVFYLGTVVRRYRRMRQELRELGKEGK* |
| Ga0137404_121062272 | 3300012929 | Vadose Zone Soil | MNSLKFLYAAYIATWTIHLFYIGTLVRRFSRLRREMKELGKGK* |
| Ga0137407_116565861 | 3300012930 | Vadose Zone Soil | MNSIKFMYAAYAATWLIHLFYLGTVVRRYRRMRQELRELGKEGK* |
| Ga0126369_103387473 | 3300012971 | Tropical Forest Soil | MNAVRFLFAAYVATWVIHLFYIGTLVRRFGKLRQQLRELGRDK* |
| Ga0126369_115488992 | 3300012971 | Tropical Forest Soil | MNGIKFLFAAYIATWLIHLLYIGSLVRRFSRLRQQFKELGKRGS* |
| Ga0164309_104686412 | 3300012984 | Soil | MNGVKFLFAAYVATWIIHVFYLGTLVSRYSRLRKQLKEVGKGK* |
| Ga0120109_11176481 | 3300014052 | Permafrost | MNAIKFLFAAYIATWVIHGVYLGSLVRRFSRLRQQRKELGKGK* |
| Ga0181518_101984262 | 3300014156 | Bog | LFAAYLATWVIHAIYLGTLVRRFSRLRQQLKELGKGK* |
| Ga0181521_100249633 | 3300014158 | Bog | MNSLKFLFAAYLATWVIHAIYLGTLVRRFSRLRQQLKELGKGK* |
| Ga0181532_100024448 | 3300014164 | Bog | MNAIKFLFAAYIATWVIHGVYLGSLVRRFSHLRQQLKEVGKK* |
| Ga0181523_1000168311 | 3300014165 | Bog | MNAIKFLFAAYIATWVIHGVYLGSLVRRFSQLRRELKEVGKK* |
| Ga0181534_100073192 | 3300014168 | Bog | MNAVKFLIAAYIATWAIHGVYIATLVRRFSRLRRESKELGKGK* |
| Ga0181537_106520491 | 3300014201 | Bog | MNAVAFLFAAYIATWLIHAIYLGTLVRRFSKLREQLKELQKGK* |
| Ga0182018_100135282 | 3300014489 | Palsa | MNAVKFLVAAYIATWLIHGVYLGSLVRRFSRLRKQLKEVKKGK* |
| Ga0182019_100306104 | 3300014498 | Fen | MNSIKFLYAAYIATWAIHAFYIGTLVRRFSRLRREMKELGKGK* |
| Ga0182024_100166475 | 3300014501 | Permafrost | MNAIKFLFAAYIATWVIHGVYLGSLVRRFSKLRQQMKEVKKGSRG* |
| Ga0182024_100175637 | 3300014501 | Permafrost | MNAIKFLFAAYIATWVIHGVYLASLARRFSRLRQQLKELGKGK* |
| Ga0182024_100544907 | 3300014501 | Permafrost | MNGIKFLFAAYIATWVIHGVYLGSLVRRFSRLRQQLKELGKK* |
| Ga0182024_111869002 | 3300014501 | Permafrost | MNAVKFLVAAYIATWLIHGVYLGSLVRRFSRLRQQLKEVKKGK* |
| Ga0182030_107350722 | 3300014838 | Bog | MNGIKFLFAAYIATWVIHGAYLGSLVRRFSRLREQLKEVGKK* |
| Ga0132258_108648021 | 3300015371 | Arabidopsis Rhizosphere | TQQEYPMNGVKFLFAAYVATWVIHVFYLGTLVRRFSRLRQQLKELGKGK* |
| Ga0132258_126598852 | 3300015371 | Arabidopsis Rhizosphere | MNAVKFLFAAYIATWVIHALYIGSLVRRFSRLRQQLKELGKRES* |
| Ga0182041_117870612 | 3300016294 | Soil | MNGIKFLFAAYIATWFIHGAYLTHLVRSFKRLREELKEMSKK |
| Ga0182037_104048573 | 3300016404 | Soil | MNAVKFLFAAYIATWVIHLFYISTIARRFSKLRQQLK |
| Ga0182037_111240752 | 3300016404 | Soil | MNAIKFLFAAYLATWVIHVFYLGTIARRFSKLRQQLKDLGKAGK |
| Ga0182038_102033781 | 3300016445 | Soil | VNALKFLFAAYIATWVIHLFYISTIARRFSKLRQQLKELGKGK |
| Ga0181505_101490132 | 3300016750 | Peatland | MNAIKFLFAAYIATWVIHGVYLGSLVRRFSHLRQQLKEVGKK |
| Ga0181505_108047672 | 3300016750 | Peatland | MNAIKFLFAAYIATWVIHGVYLGSLVRRFSQLRRELKEVGKK |
| Ga0181505_111908062 | 3300016750 | Peatland | MNAIKFLFAAYIVTWVIHGAYLGSLVRRFSRLRRELADTHKDSR |
| Ga0187802_100061384 | 3300017822 | Freshwater Sediment | MNSIKFLFAAYIATWVIHGSYLGTLVRRFSHLKKELDQLDQDRKSAHR |
| Ga0187802_100632961 | 3300017822 | Freshwater Sediment | MKNAGFLFAAYIATWLIHGSYLVSLVRRFGRVRQQFKELGKGK |
| Ga0187802_100942712 | 3300017822 | Freshwater Sediment | MNSIKFLFAAYIATWVIHAFYLGTLVRRFSRLRQQLKELGRGRG |
| Ga0187818_100190844 | 3300017823 | Freshwater Sediment | MNALKFLFAAYIATWVIHAFYLGTLVRRFSRLRQQLKELGKGK |
| Ga0187818_100528042 | 3300017823 | Freshwater Sediment | MNAIKFLYAAYVATWVIHAFYLGTLVRRFSRLRRELKGLGRGK |
| Ga0187818_100693842 | 3300017823 | Freshwater Sediment | MNSIKFLFAAYIATWVIHAFYLGTLVRRFSRLRQQLKELGKGRG |
| Ga0187818_100739551 | 3300017823 | Freshwater Sediment | TIKFLFAAYIATWVIHAFYLGSLVRRFSRLRQQLKELGKGK |
| Ga0187818_103639112 | 3300017823 | Freshwater Sediment | MNAIKFLFAAYIATWVIHGVYLGSLVRRFSRLRQQLKEVGKK |
| Ga0187820_11575711 | 3300017924 | Freshwater Sediment | MNSIRYMYAAYIATWTIHVFYLGTLVRRFSRLRREMKELGKGK |
| Ga0187820_13097011 | 3300017924 | Freshwater Sediment | MNAIKFLFAAYIATWLIHGIYLGTLVGRFSRLRQELKELQKK |
| Ga0187856_10170075 | 3300017925 | Peatland | MNALKFLFAAYIATWVIHAFYLGTLVRRFGRLHRQLQELGKEK |
| Ga0187806_10833912 | 3300017928 | Freshwater Sediment | MNSIKFLFAAYIATWVIHAFYLGTLVRRFSRLRQQLQELGRGRGHS |
| Ga0187814_102687192 | 3300017932 | Freshwater Sediment | HSFLFGAYIATWLIHVFYLGTLARRFSRLRQQLRELGKGK |
| Ga0187801_100331912 | 3300017933 | Freshwater Sediment | MNSIKFLFAAYIATWVIHAFYLGTLVRRFSRLRQQLKELGKAK |
| Ga0187801_103741311 | 3300017933 | Freshwater Sediment | MNAIKFLIAAYVATWLIHGFYIASLVRRFAKLQQQMKEL |
| Ga0187803_100025954 | 3300017934 | Freshwater Sediment | MNTIKFLFAAYIATWVIHAFYLGSLVRRFSRLRQQLKELGKGK |
| Ga0187803_101848242 | 3300017934 | Freshwater Sediment | MNAIKFLFAAYIATWVIHGVYLGSLVRRFGRLRQQLKELGKK |
| Ga0187821_101967962 | 3300017936 | Freshwater Sediment | MKYLFAAYIATWAIHGIYLGSLVQRFKRLRQQWKELGKK |
| Ga0187819_100927953 | 3300017943 | Freshwater Sediment | MNAIKFLFAAYIATWVIHGVCLGSLVRRFGRLRQQLKELGKK |
| Ga0187819_105249411 | 3300017943 | Freshwater Sediment | VNAIKFLFAAYIATWMIHGVYLATLVRRFSHLRRELKEVGKK |
| Ga0187819_107220201 | 3300017943 | Freshwater Sediment | MKAITFLFAAYIATWVIHSFYLGTLVRRFAQLRRELKELGKGK |
| Ga0187879_102934972 | 3300017946 | Peatland | MNAVKFLFAAYIATWVIHGVYLGTLVRRFSKLRQQLKDVGRKG |
| Ga0187847_100874422 | 3300017948 | Peatland | MNAVKFLIAAYIATWAIHGVYIATLVRRFNRLRRESKELRKAK |
| Ga0187847_104639292 | 3300017948 | Peatland | MNAIKFLFAAYIVTWLIHGAYLGSLVRRFSRLRREMKEMGKK |
| Ga0187817_110348101 | 3300017955 | Freshwater Sediment | VNAIKFLYAAYIATWLIHSLYLGTLVSRFRRLRQQLKELGKEK |
| Ga0187779_102470512 | 3300017959 | Tropical Peatland | MNALKFLFAAYIATWVIHCFYIGTLVRRFGKLRQQLKELGKQK |
| Ga0187779_106134182 | 3300017959 | Tropical Peatland | MNALKFLIAAYAATWLIHGCYIASLVRRFRKLQQQLKELGKQN |
| Ga0187779_107401561 | 3300017959 | Tropical Peatland | EPPMNAIKFLYAAYIATWLIHSLYLGTLVTRFRRLREQLKELGKGK |
| Ga0187779_108518642 | 3300017959 | Tropical Peatland | MNPIKFLIAAYAATWLIHGCYIASLVRRFRKLQQQLKELGKEN |
| Ga0187779_108752482 | 3300017959 | Tropical Peatland | MNSIKFLFAAYIATWVIHIFYLGTLVRRFGRLRQELKELAKK |
| Ga0187778_100510721 | 3300017961 | Tropical Peatland | PTEPGCAMNAVKFLFAAYIATWLIHAVYIGTIVRRFSRLRQQLKELGKGK |
| Ga0187778_102108192 | 3300017961 | Tropical Peatland | MNALRFLFAAYILTWVIHAFYLGTLVRRFNKLREQLKELGKK |
| Ga0187778_102213242 | 3300017961 | Tropical Peatland | MNAIKFLFAAYIATWVIHALYLGTLVRRFGRLRRQLKELGKGK |
| Ga0187778_110285821 | 3300017961 | Tropical Peatland | MNALKFLFAAYIATWAIHAFYLGTLVRRFSRLRRELKELGKDGK |
| Ga0187783_100152133 | 3300017970 | Tropical Peatland | MNAIKFLIAAYAATWLIHGCYIASLVRRVRRLQQQMKELGKEN |
| Ga0187783_100997233 | 3300017970 | Tropical Peatland | MNALKFLIAAYAATWLIHGCYILSLVRRFRRLEQQLKELGKEN |
| Ga0187783_106976511 | 3300017970 | Tropical Peatland | MNAMKFLIAAYVATWLIHGCYIASLVRRFRKLHEQMKEWGKEN |
| Ga0187783_111527791 | 3300017970 | Tropical Peatland | MNANAIKFLFAAYIATWLIHAIYIGTIVRRFSRLREQLKELGKGK |
| Ga0187781_100026446 | 3300017972 | Tropical Peatland | MNAIKFLFAAYIATWLIHAFYLGTLVRRFGRLRRELKELHKP |
| Ga0187781_1000589410 | 3300017972 | Tropical Peatland | MNALAFLFAAYIATWVIHAFYLGTLVRRFSKLRQQMKELGKGK |
| Ga0187781_100087845 | 3300017972 | Tropical Peatland | MNAIKFLIAAYAATWLIHGGYILSLVRRFRKLEQQMKELGKENSNRRPA |
| Ga0187781_100561214 | 3300017972 | Tropical Peatland | GRSFLFAAYIATWLIHGFYLDTLVRRFSRLRQQMKALPKKVNV |
| Ga0187781_100686753 | 3300017972 | Tropical Peatland | MNAIKFLFAAYILTWVIHVFYLGTIVRRFSRLREELRELGKK |
| Ga0187781_105176832 | 3300017972 | Tropical Peatland | MNALKFLFAAYIATWAIHAFYLSTLVRRFRRLRKELKDLGKDK |
| Ga0187781_107829432 | 3300017972 | Tropical Peatland | LKFLFAAYIATWAIHAIYLGTLLRRFSRLRRELKELGKDGK |
| Ga0187781_110459151 | 3300017972 | Tropical Peatland | PSSQSERTMNALKFLYAAFIATWVIHAFYLGTLVRRFRRLRQQLKELGKK |
| Ga0187781_111301291 | 3300017972 | Tropical Peatland | MNALRFLIAAYAVTWLIHGCYILSLVRRFRKLQQQLKE |
| Ga0187781_111870171 | 3300017972 | Tropical Peatland | MNPIKFLFAAYIATWLIHAVYIGTIVRRFSRLREQLKELGKGK |
| Ga0187780_100480013 | 3300017973 | Tropical Peatland | MNALKFLFAAYIATWAIHAFYLGTLVRRFSRLRRELKELGKDK |
| Ga0187780_114201241 | 3300017973 | Tropical Peatland | MNGIKFLFAAYIATWVIHGAYLGSLVRRFSRLRQELKQL |
| Ga0187782_100592673 | 3300017975 | Tropical Peatland | MNAIKFLFAAYIATWAIHAFYLSTLVRRFRRLRKELKDLGKDK |
| Ga0187782_101081592 | 3300017975 | Tropical Peatland | MNALKFLFAAYIATWAIHAFYLGTVLRRFSRLRRELKDLGKDEK |
| Ga0187782_101106093 | 3300017975 | Tropical Peatland | MNAIKFLYAAYIATWTIHCVYLATLVRRSARLKEQLKELGKK |
| Ga0187782_102191813 | 3300017975 | Tropical Peatland | MNAIKFLFAAYIATWVIHGAYLGSLVRRFHRLRRELQDVAKHD |
| Ga0187782_102218333 | 3300017975 | Tropical Peatland | MNALKFLIAAYAATWLIHGCYILSLVRRFRKFEQQLKELGKQS |
| Ga0187782_103486762 | 3300017975 | Tropical Peatland | MNGLKFLFAAYIATWAIHAIYLGTLLRRFSRLRRELKELGKDGK |
| Ga0187782_106039301 | 3300017975 | Tropical Peatland | MNALKFLYAAFIATWVIHAFYLGTLVRRFRRLRQQLKELGKK |
| Ga0187782_113760492 | 3300017975 | Tropical Peatland | MNAIKFLYAAYVATWLIHAFYLGTLVRRFGRLRRELKELGKNGK |
| Ga0187816_101910421 | 3300017995 | Freshwater Sediment | DRAEPAMNAIKFLFAAYIATWVIHGVYLGSLVRRFGRLRQQLKELGKK |
| Ga0187816_105264752 | 3300017995 | Freshwater Sediment | KFLYAAYLATWVIHAFYLGTLVRRFSRLRRELKGLGRGK |
| Ga0187804_102185212 | 3300018006 | Freshwater Sediment | MNAIKFLIAAYVATWLIHGFYIASLVRRFAKLQQQMKELGKEKEK |
| Ga0187804_104356421 | 3300018006 | Freshwater Sediment | KFLFAAYIATWVIHAFYLGTLVRRFSRLRQQLKELGKGK |
| Ga0187804_104811332 | 3300018006 | Freshwater Sediment | MNAIKFLFAAYIATWVIHGVYLGSLVRRFSRLRRELKEVGKK |
| Ga0187805_100216955 | 3300018007 | Freshwater Sediment | MNSVKFLFAAYIATWVIHGVYLGSVVQRFSQLRKQLKELGKGK |
| Ga0187863_100934241 | 3300018034 | Peatland | MNAVKFLIAAYIATWAIHGVYIATLIQRFNRLRRESKELRKAK |
| Ga0187863_101050712 | 3300018034 | Peatland | MNAVKFLFAAYIATWVIHGVYLGTLVRRFSKLRQQLKEVGRKG |
| Ga0187890_105002282 | 3300018044 | Peatland | MNAIKFLFAAYIVTWLIHGAYLGSLVRRFSRLRREMK |
| Ga0187766_105940711 | 3300018058 | Tropical Peatland | MNAVKFLFAAYIATWVIHLFYIGTIARRFSKLRQQLKELSKAK |
| Ga0187784_101901692 | 3300018062 | Tropical Peatland | MNALKFPYAAFIATWVIHAFYLGTLVRRFRRLRQQLKELGKK |
| Ga0187784_102036682 | 3300018062 | Tropical Peatland | MNALKFLIAAYAITWLIHGCYIASLVRRFRKLQRQLKELGKQN |
| Ga0187784_109769232 | 3300018062 | Tropical Peatland | MNAIKFLFAAYIATWVIHGAYLGSLVRRFSRLRRELLEAHRDDRDLR |
| Ga0187784_112536411 | 3300018062 | Tropical Peatland | RTVNSIKFLFAAYIATWVIHGTYLVTLVRRFGRLKKEIAELHPDHSKPQNR |
| Ga0187772_100017465 | 3300018085 | Tropical Peatland | MNAIKFLFAAYIATWLIHAFYLGTLVRRFSRLRRELKEIGKK |
| Ga0187772_100290065 | 3300018085 | Tropical Peatland | MNTIKYLFAAYIATWLIHASYLGTLVRRFSRLRRELRELGKGK |
| Ga0187772_100556643 | 3300018085 | Tropical Peatland | MNAIKFLFAAYILTWVIHAFYLGSLVRRFRRLREELKGLAKQ |
| Ga0187772_100877831 | 3300018085 | Tropical Peatland | MNALKFLFAAYILTWLIHACYLGTLVRRFRRLRQQLRELGKE |
| Ga0187772_100936173 | 3300018085 | Tropical Peatland | MSALKFLFAAYIATWAIHAFYLGTLVRRFSRLRRELKELGKDGK |
| Ga0187772_103619352 | 3300018085 | Tropical Peatland | MNTIKYLFAAYIATWLIHVVYIGTIVRRFSRLRRELRELGKGM |
| Ga0187772_104760672 | 3300018085 | Tropical Peatland | MNALKFLFAAYIATWVIHAFYLGTLLRRFSRLRRELKEPGKDGK |
| Ga0187772_107757382 | 3300018085 | Tropical Peatland | MNALKFLFAAYILTWVIHAFYLGTLVRRFSKLREQLKELGKK |
| Ga0187769_100251933 | 3300018086 | Tropical Peatland | MNALAFLFAAYIATWVIHAFYLGTLVRRFSKLRQQMKELGKVK |
| Ga0187769_100486472 | 3300018086 | Tropical Peatland | MNALKFLFAAYIATWVIHAFYLGTLVRRFSRLRQQVKELGKGK |
| Ga0187769_102037601 | 3300018086 | Tropical Peatland | TEFSMNALKFLFAAYIATWAIHAFYLGTLLRRFSRLRRELKELSKDGK |
| Ga0187769_105314552 | 3300018086 | Tropical Peatland | MNAIKFLFAAYIATWLIHAVYIWTIVRRFNRLRQQLRELGKEE |
| Ga0187771_100165674 | 3300018088 | Tropical Peatland | MSAIKFLYAAYVATWVIHAGYLGSLVGRFRRLRQQLKELGKK |
| Ga0187771_100573131 | 3300018088 | Tropical Peatland | MNAIKFLFAAYIATWVIHAFYLGTLVRRFSRLRQQLKELGRK |
| Ga0187771_101161352 | 3300018088 | Tropical Peatland | MNAIKFLFAAYIATWVIHAFYLGTLLRRFSRLRRELKELGRGK |
| Ga0187771_103741533 | 3300018088 | Tropical Peatland | MNAIKFLFAAYIATWAIHALYLGTLVRRFSRLRQELKELGKDKEA |
| Ga0187771_113992012 | 3300018088 | Tropical Peatland | MNAIKFLFAAYIATWIIHSFYIGTLMRRFSKLRQQMKELGKGK |
| Ga0187771_114196892 | 3300018088 | Tropical Peatland | MNALRFLFAAYILTWVIHAFYLGTLVRRFSKLREQLKELGRK |
| Ga0187770_109082071 | 3300018090 | Tropical Peatland | AQPAARSEDRMNALKFLFAAYIATWLIHAFYLGTLVSRFRRLRQQEKELGKGK |
| Ga0187770_109724051 | 3300018090 | Tropical Peatland | MNALKFLFAAYFATWAIHAFYLGTLVRRFSRLRQQLKELGRK |
| Ga0187770_113152912 | 3300018090 | Tropical Peatland | MNAIKFLYAAYIATWAIHAFYLGTLARRFKRLRRQLKELEKE |
| Ga0187770_114848042 | 3300018090 | Tropical Peatland | MNAIKFLFAAYIATWLIHAFYLGTLLRRFSRLRRELKEIGKK |
| Ga0066655_113900842 | 3300018431 | Grasslands Soil | MNAIKFLVAAYVATWVIHGVYLASLVRRFSLLRQQSRELEKK |
| Ga0066662_118331612 | 3300018468 | Grasslands Soil | MNAIKFLIAAYVATWLIHGFYIASLVRRFSRLRQQLRDMGKAK |
| Ga0187800_10492231 | 3300019278 | Peatland | MNAIKFLYAAYIATWVIHAFYLGTLVRRFRRLHQQLKELHKQ |
| Ga0182025_12336632 | 3300019786 | Permafrost | MNAVKFLVAAYIATWLIHGVYLGSLVRRFSRLRKQLKEVKKGK |
| Ga0193751_10149806 | 3300019888 | Soil | MNAIEFLFAAYIATWVIHGVYLGSLVRRFGRLRQQLRDVQT |
| Ga0193726_10683102 | 3300020021 | Soil | MNAVKFLFAAYVATWVIHGVYLGSLVRRFSRLRQQAKELGKR |
| Ga0210407_100331803 | 3300020579 | Soil | MNAVKFLFAAYIATWAIHLFYIGTLVRRFSRLRQQLRELGKGK |
| Ga0210407_101588172 | 3300020579 | Soil | MNAIKFLFAAYIATWVIHGVYLGSLIRRYSRLRQQWKELGKQK |
| Ga0210407_102980442 | 3300020579 | Soil | MNAIKFLFAAYIATWVIHGAYLASLVRRFGKLRRELKEVGKEK |
| Ga0210403_100311324 | 3300020580 | Soil | MNAVKFLIAAYVATWVIHGVYLISLVRRSGRLQRELKDVGKK |
| Ga0210403_101988342 | 3300020580 | Soil | MNAIKFLFAAYLATWVIHGAYLASLVRRFSRLRRELKEVQKEK |
| Ga0210403_105206252 | 3300020580 | Soil | MNAIKFLFAAYIATWVIHGVYLASLVRRFGRLRRELRDVGKGISHRRG |
| Ga0210403_105469092 | 3300020580 | Soil | MNAIKFLFAAYIATWVIHGVYLGSLIRRYSRLRQQLKELGKQK |
| Ga0210403_106514211 | 3300020580 | Soil | MNAVKFLVAAYVATWVIHGVYLGSLARRFGRLRREEKEVGKGK |
| Ga0210403_109405952 | 3300020580 | Soil | MNAVKFLIAAYVATWVIHGAYIGSLVRRFGRLRRELKDVGKGK |
| Ga0210399_100005956 | 3300020581 | Soil | MNAIKFLFAAYIATWVIHGAYLASLVRRFSRLRRELKEVQKGK |
| Ga0210399_100943031 | 3300020581 | Soil | MNAIKFLFAAYTATWVIHGAYLGSLVRRFGKLRRELKE |
| Ga0210399_101200681 | 3300020581 | Soil | MNAVKFLFAAYIATWVIHGVYLGTLVRRFSHLRRQLKELGKGK |
| Ga0210399_102504863 | 3300020581 | Soil | MNAIKFLFAAYIATWVIHGAYLASLVRRFGKLRRELK |
| Ga0210399_104136212 | 3300020581 | Soil | MNAVKFLFAAYIATWAIHLFYISTLIRRFSRLRQQLRELGKGK |
| Ga0210399_105345421 | 3300020581 | Soil | MNAVKFLVAAYLATWLIHGFYLGSLVRRFRRLRQQLKDVKKGN |
| Ga0210395_1000000614 | 3300020582 | Soil | MNAVKFLIAAYVATWVIHGVYIGSLVQRFSRLRRESKELSKGK |
| Ga0210395_100017108 | 3300020582 | Soil | MNAIKFLFAAYIATWVIHGVYLGSLVRRFGRLRRELKEVGKGK |
| Ga0210395_100754333 | 3300020582 | Soil | MNAVKFLCAAYIATWAIHLFYIGTLVRRFSRLRQQLRELGKGK |
| Ga0210395_101273942 | 3300020582 | Soil | MNAVKFLIAAYVATWVIHGIYMASLVRRFGRVRRELKDVGKK |
| Ga0210395_108556542 | 3300020582 | Soil | AAYIATWVIHGVYLGSLVRRFGRLRRELGDVGKGISHRRG |
| Ga0210401_100969224 | 3300020583 | Soil | MNAIKFLFAAYIATWVIHGVYLGSLIRRYSRLRQQLKELGKPK |
| Ga0210401_107231561 | 3300020583 | Soil | MNAVKFLFAAYVATWAIHLFYIGTLVRRFSRLRQQLRELGKGK |
| Ga0210401_109010642 | 3300020583 | Soil | MNGIKFLFAAYIAVWVIHAFYLGTLVRRFSSLRQQLKELGKEGR |
| Ga0210404_101761122 | 3300021088 | Soil | MNAIKFLFAAYIATWVIHGAYLASLVRRFSRLRRELRELGKGK |
| Ga0210404_103088051 | 3300021088 | Soil | FPMNAVKFLFAAYIATWAIHLFYIGTLVRRFSRLRQQLRELGKGK |
| Ga0210404_105286802 | 3300021088 | Soil | MNAIKFLFAAYIATWVIHGVYLASLVRRFSRLRRELKEMGKGK |
| Ga0210404_108340901 | 3300021088 | Soil | MNAVRFLFAAYIATWVIHGVYLGTLVRRFSKLRQQLNDVGRKA |
| Ga0210406_1000033413 | 3300021168 | Soil | MNAVKFLVAAYIATWLIHGVYLGSLVRRFSRLRQQLKDLKKGN |
| Ga0210406_100193424 | 3300021168 | Soil | MNSIKFMYAAYAATWAIHLFYLGTVVRRYRRLRQQLKELGKTE |
| Ga0210406_104958031 | 3300021168 | Soil | VEQGYPMNAVKFLFAAYIATWAIHLFYIGTLIRRFSRLRQQLRELGKGK |
| Ga0210400_1000097310 | 3300021170 | Soil | MNAVKFLIAAYVATWVIHGVYLGSLVRRFRRLRREEREVGKGK |
| Ga0210400_100204463 | 3300021170 | Soil | MNAIKFLFAAYIATWVIHGVYLGSLVRRFGRLRRELRDVEKK |
| Ga0210405_102273282 | 3300021171 | Soil | VKFLVAAYIATWLIHGVYLGSLVRRFSRLRQQLKDLKKGN |
| Ga0210408_100540642 | 3300021178 | Soil | MNAIKFLYPAYIATWLIHAFYLGTLVSRFRRLRQELKELGK |
| Ga0210396_100988752 | 3300021180 | Soil | MNSLKFLYAAYIATWTIHVFYIGTLVRRFSRLRREMKELGKGK |
| Ga0210396_100993844 | 3300021180 | Soil | MNAVKFLFAAYLATWAIHLFYIGTLVRRFSRLRQQLRELGKGK |
| Ga0210396_101517084 | 3300021180 | Soil | MNAIKFLFAAYIATWVIHGVYLVTLVRRFSRLRQQLKELGKK |
| Ga0210388_100187033 | 3300021181 | Soil | MNALKFLYAAYIATWTIHVFYLGTLVQRYRRLRREMNELAKTK |
| Ga0210388_104396113 | 3300021181 | Soil | MNAIKFLFAAYIATWVIHGVYLASLVRRFGRLRRELRDVGKG |
| Ga0210388_106937072 | 3300021181 | Soil | MNAVKFLVAAYLATWLIHGVYLGSLVRRFRRLRQQLKDVKKGN |
| Ga0210388_109367672 | 3300021181 | Soil | QPTTRSEFAMNAVKFLIAAYVATWVIHGVYIGTLVGRFRRLRREEKEMRKAK |
| Ga0210393_100646104 | 3300021401 | Soil | MNSTKFLFAAYVATWVIHGFYLGTLARRYKRLRQEMKELGQNPLRKNQ |
| Ga0210393_102744352 | 3300021401 | Soil | MNAVKFLVAAYLATWLIHGVYLGSLVRRFSRLRQQLKDLKKGN |
| Ga0210393_110883302 | 3300021401 | Soil | MNAVKFLAAAYIATWVIHSFYLTTLVRRFTRLRQQLKELGKGK |
| Ga0210385_100160202 | 3300021402 | Soil | MNAIKFLFAAYLATWVIHGVYLGSLVRRFSRLRQQLKELGKGK |
| Ga0210385_100441392 | 3300021402 | Soil | MKAIKFLFAAYIATWVIHGVYLGSLVRRFGRLRRELKDVGK |
| Ga0210385_102506123 | 3300021402 | Soil | MNAIKFLFAAYIATWVIHGVYLGSLVRRFGRLRRELRDVGKGISHRRG |
| Ga0210385_102685712 | 3300021402 | Soil | MNSIKFLFAAYIATWLIHSFYIGTLVRRFQRLRQQKRELDGNPHS |
| Ga0210385_113922601 | 3300021402 | Soil | MNSIKFLFAAYIATWVIHGVYLGILATRFRRLRRQLKEAGKQR |
| Ga0210397_102263462 | 3300021403 | Soil | MNAIKFLFAAYIATWVIHGVYLGSLVRRFSRLRQQLKELGKGK |
| Ga0210397_102899522 | 3300021403 | Soil | MNAVKFLIAAYIATWVIHGFYLVTLTARFGRAKKELKELGKVK |
| Ga0210389_100659494 | 3300021404 | Soil | MNAVKFLFAAYIATWAIHLFYIGTLVRRFGRLRQQLRELGKGK |
| Ga0210389_108066861 | 3300021404 | Soil | MNAVRFLFAAYIATWVIHGVYLGTLVRRFSKLRQQLKDVGRKA |
| Ga0210387_100739263 | 3300021405 | Soil | MNSIKFLFAAYIATWVIHGVYLGSLATRFRRLRRQLKEAGKQR |
| Ga0210387_101417332 | 3300021405 | Soil | MNAIRFLFAAYIATWVIHGVYLGSLIRRYRRLRQQLKELGKQK |
| Ga0210386_110498461 | 3300021406 | Soil | MSAVKFLFAAYIATWVIHGFYLGTLGSRFSRLRRELKELGKGK |
| Ga0210383_117055082 | 3300021407 | Soil | MNAVKFLIAAYVATWVIHGVYIGTLVGRFRRLRREEKEMRKAK |
| Ga0210394_1000000510 | 3300021420 | Soil | MNAIKFLFAAYIATWVIHGAYLASLVRRFGKLRQQLREVGKK |
| Ga0210394_102216972 | 3300021420 | Soil | MNAVKFLVAAYIATWLIHGVYLGSLVRRFSRLRQQLKDVKKGN |
| Ga0210394_109634571 | 3300021420 | Soil | MNAVKFLFAAYIATWVIHGVYLGTLVRRFSHLRRQLKELGK |
| Ga0210391_100388012 | 3300021433 | Soil | MNAIKFLFAAYIATWVIHGVYLGSLVRRFGRLRRELKEVGKRK |
| Ga0210391_106280281 | 3300021433 | Soil | RKFLIAAYIATWLIHGVYLGSQVRRFSRLRQQLKDLKKGN |
| Ga0210390_102204083 | 3300021474 | Soil | MNAVKFLFAAYIATWVIHGVYLGTLGSRFSRLRRELKELGKGK |
| Ga0210390_103445911 | 3300021474 | Soil | IKFLFAAYIATWVIHGVYLGSLVRRFGRLRRELRDVEKK |
| Ga0210392_106376442 | 3300021475 | Soil | MNAVKFLIAAYIATWVIHGIYMASLVGRFGRLRREVKDVGKK |
| Ga0210392_112112502 | 3300021475 | Soil | MNAIKFLFAAYIATWVIHGVYLGSLVRRFSRLRQQLK |
| Ga0187846_100087792 | 3300021476 | Biofilm | VNAVRFLYAAYIATWVIHAFYLGSLVRRYNRLRRELKELDKDGT |
| Ga0187846_101799071 | 3300021476 | Biofilm | MNTVKFLFAAYIATWVIHLFYIGTIARRFSKLRQQLKELGKGR |
| Ga0187846_103194232 | 3300021476 | Biofilm | MNPIKFLFGAYIATWLIHAFYLGTLVRRFSRLRQQMKELGKSR |
| Ga0210398_104248081 | 3300021477 | Soil | IKFLIAAYIATWLIHGVYIGSLVQRFSRLRRELKELAKGK |
| Ga0210402_100123187 | 3300021478 | Soil | MNAIKFLFAAYIATWVIHGAYLASLVRRFGRLRRELKEVGKGK |
| Ga0210402_105014722 | 3300021478 | Soil | MNAIKFLFAAYIATWVIHGAYLASLVRRFTRLRRELKEMGKGE |
| Ga0210402_107523692 | 3300021478 | Soil | MNAVKFLFAAYIATWVIHGVYLGTLVRRFSHLRRQLKEL |
| Ga0210410_1000084917 | 3300021479 | Soil | MNSIKFMYAAYAATWLIHLFYLGTVVLRYRRLRQQLKELGKTE |
| Ga0210410_100418012 | 3300021479 | Soil | MNSLKFLYAAYVATWTIHVFYIGTLVRRFSRLRREMKELGKGK |
| Ga0210410_103809853 | 3300021479 | Soil | MNAIKFLFAAYIATWVIHGAYLASLVRRFSRLRRE |
| Ga0210409_101151901 | 3300021559 | Soil | MNAIKFLFAAYIATWVIHGAYLASLVRRFSRLRRELKEMGKGK |
| Ga0210409_113063202 | 3300021559 | Soil | MNASKFLYAAYIATWVIHASYLGTLVRRFRRLRQQLKELGK |
| Ga0126371_100022273 | 3300021560 | Tropical Forest Soil | MNAIKFLVAAYIATWVIHGIYLGSLVRRFSHLRQQLKDLEKK |
| Ga0126371_100171124 | 3300021560 | Tropical Forest Soil | MNAVKFLFAAYIATWVIHLFYISTIARRFSKLRQQLKELGKGK |
| Ga0126371_100179628 | 3300021560 | Tropical Forest Soil | MNAIKFLIAAYLATWVIHGAYIGTLVSRFSKLRQRMRDLETRK |
| Ga0126371_100701034 | 3300021560 | Tropical Forest Soil | MNAVKFLFAAYIATWVIHGVYLGSLVRRFSHLRQQLKDLGKK |
| Ga0126371_100885784 | 3300021560 | Tropical Forest Soil | MNAIKFLFAAYIATWVIHSFYLGTLVRRFARLRRELRELGKGT |
| Ga0126371_101626182 | 3300021560 | Tropical Forest Soil | MNAIKFLFAAYIATWVIHAFYLGTLVRRFSKLRDQMKELGKGR |
| Ga0126371_105425502 | 3300021560 | Tropical Forest Soil | MNGVKFLFAAYIATWVIHFFYISTIARRFGKLRRQLKELGKDK |
| Ga0126371_106960121 | 3300021560 | Tropical Forest Soil | IKFLLAAYVATWVIHGAYLATLVRRFARLRRELRELGKSK |
| Ga0126371_107634091 | 3300021560 | Tropical Forest Soil | MNAIKFLVAAYVATWLIHGVYLGTLVRRFGRLRRQLKELR |
| Ga0126371_107860352 | 3300021560 | Tropical Forest Soil | MNATKFLIAAYVATWLIHGGYILSLVRRFRKLRQQVKELGKQK |
| Ga0126371_115383222 | 3300021560 | Tropical Forest Soil | AAYVATWLIHGVYLGTLVRRFGLLRQQLKELREGK |
| Ga0126371_124293882 | 3300021560 | Tropical Forest Soil | MNALKFLFAAYMATWVIHLFYIGTIVRRFSKLRQQLRELGKGK |
| Ga0126371_135729002 | 3300021560 | Tropical Forest Soil | QCLARGQSAAQQECPMNSIKFLFAAYIATWVIHFFYMGTIARRFNTLRQQLKNLGKDK |
| Ga0213852_10558091 | 3300021858 | Watersheds | MNAIKFLFAAYIATWVIHAFYIGTLVRRFSSLRQQLKELGKGK |
| Ga0213853_100702512 | 3300021861 | Watersheds | MNAVKFLFAAYLATWVIHAFYPGTLVRRFSRLRQQLKELGKGK |
| Ga0213853_102001751 | 3300021861 | Watersheds | MNAIKFLFAAYIATWVIHAFYLGTLVRRFSRLRRQLKELGKGK |
| Ga0213853_103915152 | 3300021861 | Watersheds | MNAIKFLFAAYIAVWVIHVFYLGTLVRRFSRLRQQMKELGKK |
| Ga0242660_10458832 | 3300022531 | Soil | MNAIKFLFAAYIATWVIHGVYLGSLVRRFSRLRQQRKELGKGK |
| Ga0212123_100444885 | 3300022557 | Iron-Sulfur Acid Spring | MNGIKFLFAAYIATWVIHGVYLGSLVQRFSRLRRELKELGKGK |
| Ga0212123_100733984 | 3300022557 | Iron-Sulfur Acid Spring | MNAIKFLFAAYIATWVIHGVYLGSLIRRYSRLRQQLKELGKEK |
| Ga0212123_101132992 | 3300022557 | Iron-Sulfur Acid Spring | MNAIKFLFAAYIATWVIHGVYLGSLVRRFRRLRQQLKEVGKGK |
| Ga0212123_102576922 | 3300022557 | Iron-Sulfur Acid Spring | MNAIKFLFAAYIATWVIHASYIGTLVLRFRRLRQELQELEKGK |
| Ga0212123_102716022 | 3300022557 | Iron-Sulfur Acid Spring | MNAVKFLVAAYIATWLIHGVYLGSLVRRFRRLRQQLKDVKKGN |
| Ga0242661_11390742 | 3300022717 | Soil | MNAVKFLVAAYIATWLIHGVYLGSLVRRFSRLRQQLKDPKKGN |
| Ga0242665_102993241 | 3300022724 | Soil | MNAVKFLFAAYVATWAIHLFYIGTLVRRFSRLRQQLREL |
| Ga0224571_1069752 | 3300022734 | Rhizosphere | MNAVKFLIAAYVATWLIHGVYLGTLVRRFGRLRRELKDIGKQK |
| Ga0224547_10247961 | 3300023255 | Soil | MNAIKFLFAAYIATWVIHGVYLGSLVRRFSKLRQQMKEVKKGSRG |
| Ga0247668_11198051 | 3300024331 | Soil | EMNAVKFLFAAYIATWVIHAFYLGTLVRRFSQLRQQLKELGKK |
| Ga0207928_10011841 | 3300025494 | Arctic Peat Soil | MNAVKFLFAAYIATWVIHGVYLASLVRRFGRLRQQLKELGKGK |
| Ga0208848_10966082 | 3300025509 | Arctic Peat Soil | AQSELTMNAVKFLFAAYIATWVIHGVYLASLVRRFGRLRQQLKELGKGK |
| Ga0208848_11213052 | 3300025509 | Arctic Peat Soil | MNAIKFLFAAYIVTWVIHGVYLGSLVRRFSRLRQQLKELGKGK |
| Ga0207684_100740301 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MNAIKFLFAAYIATWVIHGVYLGSLVRRFSRLRQQMKELSKSK |
| Ga0207700_101283384 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MNAIKFLFAAYIATWVIHGVYMGSLVRRFSRLRQQSKELEKGK |
| Ga0207664_108142812 | 3300025929 | Agricultural Soil | SPSKQERAMNGIKFLFAAYIATWFIHGAYLTHLVRSFKRLRDELREMEKK |
| Ga0207665_112029272 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MNGIKFLFAAYIATWLIHGAYLTHLVRSFKRLRDELREMGKK |
| Ga0209890_100172582 | 3300026291 | Soil | MNAVRFLFAAYIATWVIHGVYLGSLVRRFSRLRRQLKELGKK |
| Ga0209804_12524542 | 3300026335 | Soil | MNAVKFLFAAYVATWAIHLFYIGTLVRRFNRLRQQLRELGKGK |
| Ga0257153_10609962 | 3300026490 | Soil | MNAVKFLFAAYIATWVIHGFYLGSLVRRFGRLRQQLKELGKEQ |
| Ga0209376_13194022 | 3300026540 | Soil | MNGVKYLFAAYIATWVIHGVYLGSLVRRFSRLRQQLKELGKK |
| Ga0179593_11829731 | 3300026555 | Vadose Zone Soil | MNAVKFLIAAYIATWVIHGVYMMSLVRRFGRLSRELKDVGKGK |
| Ga0208572_103891 | 3300026645 | Soil | MNAVKFLFAAYIATWAIHLLYISTIARRFSKLRQQLKELSKGK |
| Ga0208199_10011642 | 3300027497 | Peatlands Soil | MNAIKFLYAAYIATWLIHSLYLGTLVTRFRRLRQQLKELGK |
| Ga0209622_10698172 | 3300027502 | Forest Soil | MNGVKFLFAAYVATWVIHVFYLGTLARRFSRLRRELRELGKGK |
| Ga0209008_11318981 | 3300027545 | Forest Soil | MNAVKFLVAAYIATWLIHGVYLGSLVRRFGRLRQQLKEVKKGK |
| Ga0208042_11474861 | 3300027568 | Peatlands Soil | MNAVKFLFAAYIITWVIHSFYLGSLVRRFSRLREQLKELQKK |
| Ga0208324_10722171 | 3300027604 | Peatlands Soil | MNAIKFLFAAYIATWVIHGAYLASLVRRFGRLRQQLKEVGKGK |
| Ga0208324_10835962 | 3300027604 | Peatlands Soil | MNSIRFLYAAYTATWVIHAVYLGSLVRRFSRLRREMKELGKGK |
| Ga0209330_10181142 | 3300027619 | Forest Soil | MNAVKFLVAAYIATWLIHGVYLGSLVRRFGRLRQQLKEVKKK |
| Ga0208044_11383302 | 3300027625 | Peatlands Soil | MNAIKFLFAAYIVTWLIHAAYLGSLVRRFSRLRQQLKELGKK |
| Ga0209422_11017642 | 3300027629 | Forest Soil | MNAIKFLFAAYIATWVIHGVYLGSLIRRYSRLRQQMKELGKEK |
| Ga0209420_100007723 | 3300027648 | Forest Soil | MNAVKFLVAAYIATWLIHGVYLGSLVRRFGRLRQQLNEVKKK |
| Ga0207826_11518562 | 3300027680 | Tropical Forest Soil | MNAVKFLFAAYIATWVIHLFYIGTIARRFSKLRQQLKELGKGK |
| Ga0209446_10233491 | 3300027698 | Bog Forest Soil | MNAIKFLFAAYIATWVIHAFYIGTLVRRFSRLRQEMKELGKK |
| Ga0209447_100521971 | 3300027701 | Bog Forest Soil | MNATIKFLFAAYIATWVIHSFYIGTLVRRFKRLRQELSELRRKK |
| Ga0209655_102787141 | 3300027767 | Bog Forest Soil | ATIKFLFAAYIATWVIHSFYIGTLVRRFKRLRQELSELRRKK |
| Ga0209448_101835312 | 3300027783 | Bog Forest Soil | MNAVKFLFAAYIAVWVIHSFYIGTLVRRFSLLRQQLKELGKGN |
| Ga0209656_10000003181 | 3300027812 | Bog Forest Soil | MNGIRFLFAAYIATWVIHGVYLGSLVRRFSRLRQELKEVGKEK |
| Ga0209656_102851972 | 3300027812 | Bog Forest Soil | MNGIKFLFAAYIATWVIHGVYLGSLVRRFSRLRQQLKEVGKK |
| Ga0209040_102210112 | 3300027824 | Bog Forest Soil | MNAIKFLFAAYIATWTIHIVYIGSLVRRFKKMRQQLKEVGKGN |
| Ga0209039_100273413 | 3300027825 | Bog Forest Soil | MNALKFLFAAYIATWLIHAFYLGTLVRRFSRLRGQLKELGKGK |
| Ga0209060_10000025296 | 3300027826 | Surface Soil | VNAIKFLVAAYIATWAIHFFYMGTLVTRFRRLQKQRKELGKE |
| Ga0209060_1000054750 | 3300027826 | Surface Soil | MNSVKFLFAAYIATWLIHGFYLGTIVQRFRRLRSQLQQMGKK |
| Ga0209060_1000066725 | 3300027826 | Surface Soil | MNAVKFLFAAYIATWVIHGLYLGSLVRRFSRLRQQVKELGKK |
| Ga0209580_1000059513 | 3300027842 | Surface Soil | MNAVKFLFAAYIATWAIHLFYISTLVRRFSRLRQQLRELGKGK |
| Ga0209580_100355891 | 3300027842 | Surface Soil | MNAVKFLFAAYIATWAIHLFYISTLVRRFSRLRQQLRELGK |
| Ga0209580_101289272 | 3300027842 | Surface Soil | MNAIKFLFAAYIATWVIHAFYLGTLVRRFSNLRRQLKELGKGK |
| Ga0209580_104311611 | 3300027842 | Surface Soil | MNAMKFLIAAYVATWVIHGFYIGTLVARFKGLREQMKELRK |
| Ga0209580_105317981 | 3300027842 | Surface Soil | MNAVKFLFAAYIATWAIHLFYIGTLMRRFSRLRQQLRELGKGK |
| Ga0209274_100003588 | 3300027853 | Soil | MNAVKFLIAAYIATWLIHGVYIGTLVRRFSRLRRELRDIERQK |
| Ga0209274_101948151 | 3300027853 | Soil | KFLIAAYIATWLIHGVYIGSLVQRFIRLRRELKELAKGK |
| Ga0209517_1000257310 | 3300027854 | Peatlands Soil | MNGIKFLFAAYIATWVIHGVYLGSLVRRFGKLRRELKEVGKGK |
| Ga0209517_1001613511 | 3300027854 | Peatlands Soil | MNALKFLFAAYIATWAIHAFYLGTLVRRFSRLRQQLSELGKRK |
| Ga0209517_101169952 | 3300027854 | Peatlands Soil | MNAIKFLYAAYITTWLIHSIYLGTLVTRFRRLRQQLKELGK |
| Ga0209693_102431862 | 3300027855 | Soil | MNAVKFLIAAYLATWLIHGIYIGTLVRRFSRLRRESEDIGKQK |
| Ga0209166_1000026511 | 3300027857 | Surface Soil | MNAIKFLFAAYIATWLIHGFYIGTLMRRFSRARRQFSELEKGK |
| Ga0209166_100011617 | 3300027857 | Surface Soil | MNAVKFLFAAYIATWVIHCFYIGTLVTRFRRLRQQLKELGKGK |
| Ga0209166_100191873 | 3300027857 | Surface Soil | MNAIKFLFAAYIATWVIHASYIGTLVLRFRRLRQELQQLGKGK |
| Ga0209166_105890071 | 3300027857 | Surface Soil | MKNAGFLFAAYIATWVIHGSYLATLVRRFGRLRRQMKELEKEK |
| Ga0209167_1000005644 | 3300027867 | Surface Soil | MKALKFLYAAYIVTWLIHALYLGSLVRRFSRLRQQLKEMGK |
| Ga0209167_1000045918 | 3300027867 | Surface Soil | MHALKFLYAAYIATWTIHLFYLSTLVRRFSRLRREMKELGKGN |
| Ga0209167_100829183 | 3300027867 | Surface Soil | MNALKFLFAAYIATWVIHCFYIGTLVTRFRKLRQQLKELGKGK |
| Ga0209167_101001181 | 3300027867 | Surface Soil | MNAVKFMVAAYVATWVIHAGYIATLVSRYRKLRQQLKELGKGK |
| Ga0209167_105918431 | 3300027867 | Surface Soil | MNALKFLFAAYLATWLIHGIYLGTLVRRFSRLRAELKDLGREK |
| Ga0209579_10000003339 | 3300027869 | Surface Soil | MNSIRFMYAAYIATWTIHVFYLGTLVRRFSKLRREMKDLGKGK |
| Ga0209579_100077779 | 3300027869 | Surface Soil | MNAIKFLFAAYIATWLIHGIYLGTLVRRFSRLRQQLKELQKK |
| Ga0209579_100125444 | 3300027869 | Surface Soil | MNAVKFLIAAYIATWVIHGAYMASLVRRFGRFRRELKDVGKKQDG |
| Ga0209579_102025661 | 3300027869 | Surface Soil | MKNAGFLFAAYSATWIIHGSYLASLVRRFGRLRQQLKELEK |
| Ga0209465_100550803 | 3300027874 | Tropical Forest Soil | MNAVRFLFAAYVATWVIHLFYIGTLVRRFGKLRQQHLK |
| Ga0209465_105754042 | 3300027874 | Tropical Forest Soil | MNAVKFLFAAYIATWVIHLFYISTIVRRFSRLRQQLRELGKGK |
| Ga0209590_102516022 | 3300027882 | Vadose Zone Soil | MNAVKFLFAAYIATWVIHGIYLVSLVRRFGRLRQQLKEFGKK |
| Ga0209275_100455044 | 3300027884 | Soil | MNSIKFLFAAYIATWVIHGVYLGSLATRFRRLRRQLKEAG |
| Ga0209380_102500282 | 3300027889 | Soil | MNAVKFLIAAYVATWVIHGTYIGSLVRRFGRLRRELKDVGKGK |
| Ga0209624_102082452 | 3300027895 | Forest Soil | MNAIKFLVAAYIATWVIHGVYLGSLVRRFSRLRRELKELKKGSRG |
| Ga0209067_100562254 | 3300027898 | Watersheds | MNGIKFLFAAYIATWLIHGFYLATLVRRFSRLREQLRELGKK |
| Ga0209067_103077511 | 3300027898 | Watersheds | MNAIKFLFAAYIATWVIHAFYLGTLVRRFSKLRQQLKELGKGK |
| Ga0209067_103833332 | 3300027898 | Watersheds | LFAAYVATWVIHLFYLGTLVRRFSRLRQQLRELGKGK |
| Ga0209067_106024932 | 3300027898 | Watersheds | MNSVKFLFPAYIATWVIHSFYLATLVRRFRRLHGQLKELGKE |
| Ga0209067_108293392 | 3300027898 | Watersheds | MNAVKFLFAAYAATWVIHLFYIGTLVRRFSRLRQQLRELGKGK |
| Ga0209415_102297702 | 3300027905 | Peatlands Soil | MNAIKFLFAAYIVTWLIHGIYLGSLVRRFSRLRQQLKELGKGK |
| Ga0209415_102667643 | 3300027905 | Peatlands Soil | MNAIKFLFAAYIATWVIHGVYLGSLVRRFGKLRRELKEVGKGK |
| Ga0209415_102890722 | 3300027905 | Peatlands Soil | MNVHALKFLYAAYIATWTIHAFYIGTLVRRFSRLRREMKELGNGK |
| Ga0209415_105138872 | 3300027905 | Peatlands Soil | MNAIKFLFAAYIATWVIHGAYLASLVRRFSRLRRQLKELGKK |
| Ga0209415_106168921 | 3300027905 | Peatlands Soil | QSPAESEPAMNAIKFLFAAYIATWAIHGVYLGSLVRRFGKLRRELKEVGKK |
| Ga0209006_1000995812 | 3300027908 | Forest Soil | MNSVKFLFAAYIATWVIHGFYLGTLARRYKRLRQEMKELGQNQLGLGKEQ |
| Ga0209006_100210184 | 3300027908 | Forest Soil | MNAIKFLYAAYIVTWLIHVLYIGTIVHRFSRLRREMKEFKRK |
| Ga0209006_100222594 | 3300027908 | Forest Soil | MNALKFLFAAYIATWVIHIFYLGTLVRRFKRLRQQMKDLDRGE |
| Ga0209698_1000435514 | 3300027911 | Watersheds | MNAVKFLFAAYVATWVIHLFYLGTLVRRFSQLRQQLRELGKGK |
| Ga0209698_100124483 | 3300027911 | Watersheds | MNPVKFLAAAYIATWVIHSFYLATLVRRFRRLHGQLKELGKE |
| Ga0209698_100202124 | 3300027911 | Watersheds | MNTVRFLFAAYVATWVIHLFYLGTLVRRFSRLRQQLRELGKGK |
| Ga0209698_101165353 | 3300027911 | Watersheds | MNAVKFLFAAYIATWVIHVFYVGTLVRRFSRLRQQLKELGKEK |
| Ga0209698_101170323 | 3300027911 | Watersheds | MNAIKFLFAAYIITWLIHAAYLATLVRRFSRLRQQLKELGKQ |
| Ga0209698_103257031 | 3300027911 | Watersheds | AMNAVKFLFAAYIATWVIHAFYLGTLVRRFSRLRQQLKELGKGK |
| Ga0209168_1000013552 | 3300027986 | Surface Soil | MNSVKFLFAAYIATWVIHGVYLGSLVRRFSHLRKQLKELGKGK |
| Ga0209168_1000077912 | 3300027986 | Surface Soil | MNSVKFLFAAYIATWVIHGVYLGSVVRRFSQLRKQLKELGKEK |
| Ga0209168_1000169615 | 3300027986 | Surface Soil | MNAVKFLIAAYIATWVIHGTYLATLVSRFRGLKRQMKELGKK |
| Ga0209168_100044273 | 3300027986 | Surface Soil | MYAAYIATWTIHVFYLGTLVRRFSKLRREMKDLGKGK |
| Ga0209168_100233043 | 3300027986 | Surface Soil | MNAIKFLFAAYIATWVIHGSYIGTLVLRFRRLRQELQELGKGK |
| Ga0265355_10034752 | 3300028036 | Rhizosphere | MNAIKFLYAAYIVTWLIHVLYIGTIVRRFSRLRREMKEFKRK |
| Ga0209526_104338612 | 3300028047 | Forest Soil | MNAVKFLVAAYIATWVIHGVYMASLVRRFGRLRRELKDVKA |
| Ga0209526_108321811 | 3300028047 | Forest Soil | MNAIKFLFAAYIATWVIHGVYLGSLVRRFARLRQQLKELGKQK |
| Ga0265336_100356902 | 3300028666 | Rhizosphere | MNAIKFLFAAYIATWVIHGFYLGSLVRRFSRLRQQVKDLGKK |
| Ga0265338_1000293313 | 3300028800 | Rhizosphere | MNAVKFLYAAYIATWVIHVFYIGTLVRRFSRLRREMKDLGKK |
| Ga0265338_100274797 | 3300028800 | Rhizosphere | MNAVKFLFAAYVATWVIHGVYLGSLVRRFSRLRQQAKELGKK |
| Ga0265338_100335608 | 3300028800 | Rhizosphere | MNAIKFLFAAYVATWVIHGVYLGSLVRRFGRLRQQLKELGKK |
| Ga0265338_102052711 | 3300028800 | Rhizosphere | MNGIKFLFAAYIATWLIHGAYLTHLVRSFKRLRSELKEVGKKQG |
| Ga0265338_109720041 | 3300028800 | Rhizosphere | EPEMNATKYLAAAYIVTWVIHGFYISTLVSRFARLRREMKDLKKH |
| Ga0302218_101635221 | 3300028863 | Palsa | MNAIKFLYAAYIVTWLIHALYLGSLVRRYKSLRQQLKELGKSGGRTKPIS |
| Ga0308309_101376403 | 3300028906 | Soil | MNAVRFLFAAYIATWVIHGVYLGTLVRRFSKLRQQLKDVGRKG |
| Ga0308309_101417842 | 3300028906 | Soil | MNAIKFLFAAYIATWLIHAFYLGTLVRRFQRLRQQKKELDRSPHS |
| Ga0308309_101569731 | 3300028906 | Soil | MNAVKFLFAAYIATWLIHALYLGTLVSRFSRLRQQLKELGNGKKREF |
| Ga0308309_115348712 | 3300028906 | Soil | SSMNSTKFLFAAYVATWVIHGFYLGTLARRYKRLRQEMKELGQNPLRKNQ |
| Ga0222749_105984302 | 3300029636 | Soil | MNSLKFLYAAYIATWTIHVFYIGTLVRRFSRLRREMKE |
| Ga0311339_110254782 | 3300029999 | Palsa | MKYLYAAYLATWVIHAVYLGSLVRRSSRLRQQLKDLAKAR |
| Ga0302177_100081122 | 3300030053 | Palsa | MNAVKFLIAAYVATWLIHGIYIGTLVRRFSRLRRESKDIGKQK |
| Ga0310037_103067862 | 3300030494 | Peatlands Soil | MNGIKFLFAAYIAIWVIHGVYLGSLVRRFGKLRRELKEVGKGK |
| Ga0311356_114375061 | 3300030617 | Palsa | MNAVKFLVAAYVATWAIHGLYVGTLVRRFSRLRRELQETKA |
| Ga0316363_100180923 | 3300030659 | Peatlands Soil | MNALKFLFAAYIATWVIHAFYLGTLVRRFGRLRRELQELGKEK |
| Ga0075405_118344162 | 3300030847 | Soil | MNALKFLFAAYIATWAIHGIYLATLVRRFTRLRRELNDLGKK |
| Ga0075388_116502571 | 3300030848 | Soil | MNAVKFLFAAYIATWVIHGAYLASLVRRFGRLRQQLKELGKK |
| Ga0265770_10724361 | 3300030878 | Soil | MNAVKFLIAAYVATWLIHGIYIGTLVRRFGRLRRESKELGEK |
| Ga0075386_115667521 | 3300030916 | Soil | MNAVKFLFAAYVATWVIHGVYLGSLVRRFGRMRRELKELGKE |
| Ga0075386_119214621 | 3300030916 | Soil | MNAVKFLFAAYVATWVIHGVYVGSLMRRFGRLRQQLKELGKGK |
| Ga0073994_120367562 | 3300030991 | Soil | MNGIKFLFAAYLATWVIHGIYLGSLVRRFSRLRQQSKELGKEN |
| Ga0170834_1056057332 | 3300031057 | Forest Soil | MNSIKFLIAAYIATWVIHGVYLGSLVRRFSRLRQQLKELGKGK |
| Ga0170824_1068785912 | 3300031231 | Forest Soil | MNAVKFLFAAYIATWVIHAFYLGTLVSRFKRLRQQMKELNKAGK |
| Ga0170824_1078269282 | 3300031231 | Forest Soil | MNGVKFLIAAYVATWVIHGIYLGSLVRRYVRLRKDVEELGRKS |
| Ga0170824_1120699241 | 3300031231 | Forest Soil | MNSLKFLHAAYLATWLIHLAYIATLVRRFSRLKKEMKDLGKK |
| Ga0170824_1185316371 | 3300031231 | Forest Soil | MNGIKFLFAAYIATWVIHGVYLGSLVRRFSRVNREFKELGKGK |
| Ga0170824_1254784782 | 3300031231 | Forest Soil | MNAVKFLIAAYIATWVIHGVYLGSLVWRFGRLRQQLKELGKGK |
| Ga0302324_10000155834 | 3300031236 | Palsa | MNGVKFLFAAYIATWLIHAIYLGTLVRRFGKLRQQLKELQKGK |
| Ga0302324_10000270829 | 3300031236 | Palsa | MTTTTNALKFLYAAYIATWAIHAFYISTLVRRFSRLRRELKESGKPAL |
| Ga0170820_117411892 | 3300031446 | Forest Soil | MNAVKFLFAAYIATWVIHGVYLGSLVRRFSRLRQQAKELGKK |
| Ga0170820_133199202 | 3300031446 | Forest Soil | MNALKFLYAAYIATWLIHSVYIGTLVSRFRKLRQELLDLKNRQRP |
| Ga0170819_159317072 | 3300031469 | Forest Soil | MNAVKFLFAAYIATWVIHGVYLGSLVWRFGRLRQQLKELGKGK |
| Ga0170818_1085714982 | 3300031474 | Forest Soil | MNAVKFLFAAYVATWVIHGVYVGSLVRRFGRLRQQLKELGKGK |
| Ga0310686_1037070942 | 3300031708 | Soil | MNSIKFLFAAYIATWVIHGVYLGSLATRFRRLRQQLKEVGKQR |
| Ga0310686_1093381082 | 3300031708 | Soil | MNAVKFLVAAYIATWLIHGVYLGSLVRRFSRLRQQLKD |
| Ga0310686_1139365954 | 3300031708 | Soil | SEFAMNAVKFLVAAYIATWLIHGVYLGSLVRRFSRLRQQLKDVKKGN |
| Ga0265314_102609821 | 3300031711 | Rhizosphere | RAEFAMNAIKFLFAAYVATWVIHGVYLGSLVRRFGRLRQQLKELGKK |
| Ga0307476_10000010291 | 3300031715 | Hardwood Forest Soil | MNGIKFLFAAYIAVWVIHAFYLGTLVRRFSSLRQQLRELGKGK |
| Ga0307476_100370673 | 3300031715 | Hardwood Forest Soil | MNSIKFLFAAYIATWVIHSFYLATLVRRFKHLRQQLKDLGKGK |
| Ga0307476_102078422 | 3300031715 | Hardwood Forest Soil | MKNAGFLFAAYIATWVIHGSYLVSLVRRFGRLRQQFKELGKGK |
| Ga0307476_111723842 | 3300031715 | Hardwood Forest Soil | MKNAGFLFAAYIATWVIHGSYLGSLVRRFRRVRQQSKELGKGK |
| Ga0310813_101930452 | 3300031716 | Soil | MNAIKFLFAAYIATWVIHASYIGTLLLRFRRLRQELQELGKGK |
| Ga0310813_118124722 | 3300031716 | Soil | MNGIKFLFAAYIATWVIHGAYLTHLVRSFKRLRDELREMKK |
| Ga0307474_103011442 | 3300031718 | Hardwood Forest Soil | MNAVKFLFAAYLATWVIHGVYLGSLVRRFGRLRRQLKEVGKEK |
| Ga0307469_105609481 | 3300031720 | Hardwood Forest Soil | MNAVKFLFAAYVATWVIHVFYLGTLARRFKRLRHELRELGKGK |
| Ga0307478_101000101 | 3300031823 | Hardwood Forest Soil | MKNAGFLFAAYIATWVIHGSYLVSLVRRFGRVRQQFKELGK |
| Ga0307478_106226862 | 3300031823 | Hardwood Forest Soil | MNAIKFLYAAYIATWLIHAFYLGTLVRRFRRLREELKGLGKEN |
| Ga0307478_107797602 | 3300031823 | Hardwood Forest Soil | MNAVKFLFAAYIATWAIHLFYIGTLVRRFSRLRQQLRELG |
| Ga0310912_107576522 | 3300031941 | Soil | EFTVGQEFSMNAVKFLFAAYIATWVIHAFYLGTLVRRFGRVRQQLRELGKGK |
| Ga0310909_113509031 | 3300031947 | Soil | EPECEMNAIKFLFAAYLATWVIHVFYLGTIARRFSKLRQQLRDLGKAGK |
| Ga0306926_107438432 | 3300031954 | Soil | MNAVKFLFAAYIATWVLHLFYIGTIARRFSKLRQQLRELGKGK |
| Ga0307479_100096966 | 3300031962 | Hardwood Forest Soil | MNGTKFLFAAYIAVWVIHAFYLGTLVRRFSSLRRQLKELGKGK |
| Ga0307479_107377972 | 3300031962 | Hardwood Forest Soil | MNAIKFLVAAYIATWVIHGVYLASVVRRFGRLRQQLKEMGKGKDL |
| Ga0307479_118480101 | 3300031962 | Hardwood Forest Soil | EFPMNAVKFLFAAYVATWAIHLFYIGTLVRRFNRLRQQLRELGKGT |
| Ga0307479_121035372 | 3300031962 | Hardwood Forest Soil | MNSVKFLFAAYVATWAIHLFYISTLIRRFSRLRQQLRELGKGK |
| Ga0311301_1000663521 | 3300032160 | Peatlands Soil | MNAIKFLFAAYIVTWVIHGVYLGSLVRRFSRLRRQLKEVGKK |
| Ga0311301_100204121 | 3300032160 | Peatlands Soil | MNAIKFLFAAYIVTWLIHAAYLGSLVRRFSRLRQQ |
| Ga0311301_100235441 | 3300032160 | Peatlands Soil | MNAVKFLFAAYIITWVIHSFYLGSLVRRFSRLREQLKE |
| Ga0311301_102926584 | 3300032160 | Peatlands Soil | MNAVKFLFAAYIAVWVIHSFYIGTLVRRFSSLRQQLKELGKGN |
| Ga0311301_113877351 | 3300032160 | Peatlands Soil | MNAIKFLYAAYIATWLIHSFYLGTLVSRFRRLRQQLKELSKGK |
| Ga0311301_121276321 | 3300032160 | Peatlands Soil | ESEPAMNAIKFLFAAYIATWAIHGVYLGSLVRRFGKLRRELKEVGKK |
| Ga0307470_100210142 | 3300032174 | Hardwood Forest Soil | MNGVKFLFAAYVATWVIHVFYLGTLARSFSRLRRELRELGKGK |
| Ga0307470_103238102 | 3300032174 | Hardwood Forest Soil | MNAVKFLYAAYIATWVIHGVYLGSLVRRFGRLRQEMKDVRKK |
| Ga0307470_103465552 | 3300032174 | Hardwood Forest Soil | MNGIKYLFAAYIATWVIHGFYLGSLVRRFGRLRQEMKDVRKK |
| Ga0307470_110592771 | 3300032174 | Hardwood Forest Soil | MKNAGFLFAAYIATWVIHGSYLVSLVRRFGRLRQQLKELGKGK |
| Ga0307470_112278682 | 3300032174 | Hardwood Forest Soil | AGFLFAAYIATWVIHGSYLVSLVRRFGRLRQQLKELGKGK |
| Ga0307471_1005964741 | 3300032180 | Hardwood Forest Soil | KFLFAAYVATWVIHVFYLGTLARRFKRLRQELHELGKGK |
| Ga0307471_1037256012 | 3300032180 | Hardwood Forest Soil | MNGIKYLFAAYIATWVIHGFYLGSLVRRFGRLRQEMKEVGKK |
| Ga0307472_1007689422 | 3300032205 | Hardwood Forest Soil | MNAVKFLFAAYVATWVIHVFYLGTLARRFKRLRQELHELGKGK |
| Ga0306920_1004255673 | 3300032261 | Soil | MNAVKFLFAAYIATWVIHAFYLGTLVRRFGRVRQQLRELGKGK |
| Ga0335085_1000047876 | 3300032770 | Soil | MNAVKFLFAAYVATWVIHIFYISTIVRRLSRLRQQLKELSRGK |
| Ga0335085_1000063741 | 3300032770 | Soil | MNGIKFLFAAYIATWLIHGGYLLHLVRSFKRLRGELRGMGKK |
| Ga0335085_1000130821 | 3300032770 | Soil | MNAVKYLFAAYIATWVIHALYIGSLVRRFSRLRQQLKELGKRER |
| Ga0335085_101967052 | 3300032770 | Soil | MNGIKFLFAAYIATWAIHGGYLLHLVRGFKRLRGELKEVGKAKQQ |
| Ga0335085_104766442 | 3300032770 | Soil | MNGIKFLFAAYIATWVIHGAYLTHLVRGFKKLRDELRDMGKK |
| Ga0335085_105610442 | 3300032770 | Soil | MNALKFLFAAYIATWVIHCFYIGTLVARFRKLRQQLKELGKGK |
| Ga0335085_108878612 | 3300032770 | Soil | MNAIKFLFAAYIATWLIHGGYLLHLVRSFKRLRGELREMGKK |
| Ga0335085_124725212 | 3300032770 | Soil | LFAAYIATWVIHSLYIGSLVRRFSRLRQQLKELGKRGS |
| Ga0335082_100017023 | 3300032782 | Soil | MNAVKFLFAAYVATWVIHIFYISTIVRRFSRLRQQLKELSRGK |
| Ga0335082_1000204910 | 3300032782 | Soil | MNAIKFMFAAYIATWVIHAFYLGTLVRRFSRLRQQLRDLGKGK |
| Ga0335082_100038512 | 3300032782 | Soil | MNGVKFLFAAYIATWVIHSLYIGSLVRRFSRLRQQLKELGKRGS |
| Ga0335082_101875473 | 3300032782 | Soil | MNAVKFLFAAYVATWLIHIFYISTIARRFSRLRQQLRELGKEK |
| Ga0335082_108454732 | 3300032782 | Soil | MNAVKFLFAAYIATWVIHALYIGSLVRRFNRLRQQLKELGKRES |
| Ga0335079_10000004447 | 3300032783 | Soil | MNAVKFLFAAYIATWLIHGFYMGTLVSRFRRLRREIDELHKSAPTPHP |
| Ga0335079_100123277 | 3300032783 | Soil | MNAIKFLFAAYILTWVIHSFYLSTLVRRFARLRRQLKELSKGKN |
| Ga0335079_100347763 | 3300032783 | Soil | MNALKFLFAAYIATWVIHAFYLGTIVHRFKKLHQQLKDLGKK |
| Ga0335079_100529653 | 3300032783 | Soil | MNSVKFLIAAYIATWVIHGTYLATLVSRFRGLKRQRKELGNK |
| Ga0335079_100635404 | 3300032783 | Soil | MNAVKFLFAAYIATWVIHLFYIGTLVRRFARLKQQLRDLGKDWSQD |
| Ga0335079_101571413 | 3300032783 | Soil | MNAIKFLFAAYIATWLIHAIYIGTIVRRFSRLRQQLKELGKGK |
| Ga0335079_101941584 | 3300032783 | Soil | MNSIKYLYAAYVATWVIHVFYIGTLVRRFSRLRREMKELGKGE |
| Ga0335079_101953662 | 3300032783 | Soil | MNAIEFLIAAYVATWLIHGVYLGTLAMRFSKLRQQLRELSKGK |
| Ga0335079_106607882 | 3300032783 | Soil | MSGVKFLFAAYIATWVIHVFYLSTIIRRFRKLRQQMRELRKGK |
| Ga0335079_113398582 | 3300032783 | Soil | MNAVKFLFAAYIATWIIHAFYIGTLVRRFSRVKQQMKELERDPSHSSQSRA |
| Ga0335079_119617402 | 3300032783 | Soil | MNAIKFLIAAYVATWLIHGAYLGTLLRRFSLLRQQLRELGKGK |
| Ga0335078_10000001529 | 3300032805 | Soil | VNSIKYLFAAYIATWVIHSFYLGTIVRRFSRLRRELKELGKK |
| Ga0335078_1000260313 | 3300032805 | Soil | MNAIKYLFAAYIATWVIHAAYLGSLVRRFSELRRQMKELGKGK |
| Ga0335078_100193465 | 3300032805 | Soil | MNSIKYLYAAYVATWVIHVFYIGTLVRRFSRLRREMKELGKWK |
| Ga0335078_102645454 | 3300032805 | Soil | MNALKFLFAAYIATWVIHAFYLGTIVRRFKKVHQQLKDLGKK |
| Ga0335078_103587024 | 3300032805 | Soil | MNAVKFLFAAYIATWVIHLFYIGTLLRRFSRLKQQLRDLGRDPSHSS |
| Ga0335078_104405843 | 3300032805 | Soil | MNSIKFLFAAYIATWVIHSFYLGTLVRRFRRVRRQLSELGKKSNR |
| Ga0335078_105566593 | 3300032805 | Soil | MNGIKFLFAAYIATWLIHFFYIGTLVRRFSKLRQELKQLGKGK |
| Ga0335078_112150501 | 3300032805 | Soil | MNAIKFLFAAYVATWVIHSFYLGTLVRRFARLRRELKELGKGK |
| Ga0335078_113707282 | 3300032805 | Soil | MNAVKFLIAAYIATWAIHSFYVGTLVTRFRHLQRELKEMGKEE |
| Ga0335078_122500341 | 3300032805 | Soil | MNAIKFLFAAYIATWVIHAFYLGTLVRRFSRLRQQLKELGKGK |
| Ga0335078_122565052 | 3300032805 | Soil | MNSLKFLFAAYIATWLIHSFYIGTLVQRFRRLHQQMKELGKEK |
| Ga0335080_100001341 | 3300032828 | Soil | MNATNFLIAAYVATWVILGVYLVSVVLRFGKLRQQLRELGKK |
| Ga0335080_100219873 | 3300032828 | Soil | MNAVKFLFAAYIATWVIHVSYLGTLVSRYRRLRQQLKELGKEK |
| Ga0335080_101186305 | 3300032828 | Soil | MNSIKYLYAAYVATWVIHVFYIGTLVRRFSRLRREMKELGKGK |
| Ga0335080_102795752 | 3300032828 | Soil | MNAVKFMFAAYIATWLIHGIYLGTVVRRFKKLQSQLKDLGKK |
| Ga0335080_105319393 | 3300032828 | Soil | SVKFLVAAYIATWAIHSFYLGTLVSRFRRIRRQMKELKKGN |
| Ga0335080_105958042 | 3300032828 | Soil | MNAIRFLFAAYIATWLIHALYLGTLVRRFRRLRQQLRELGKGK |
| Ga0335080_119698582 | 3300032828 | Soil | MNAIKFLFAAYILTWVIHSFYLGTLVRRFARLRRQ |
| Ga0335070_100073518 | 3300032829 | Soil | MNAIKFLIAAYIATWLVHGVYLGSLLQRFSKLRQQLRELGKGK |
| Ga0335070_100210415 | 3300032829 | Soil | MNAVKFLAAAYIATWLIHGVYLGTLVRRFSRLRQQLRELGKGK |
| Ga0335070_100497503 | 3300032829 | Soil | MNAIKFMIAAYVATWLIHGIYLGTLVRRFSRFRQQLRDLRKGN |
| Ga0335081_102926682 | 3300032892 | Soil | MNAVKFLIAAYIATWVIHGTYLVTLLSRFRGLKRQMKELGKDRG |
| Ga0335069_101472334 | 3300032893 | Soil | MNAVKFMFAAYIATWLIHGIYLGTVVNRFKKLQSQLKELGKK |
| Ga0335069_116902952 | 3300032893 | Soil | MNGIKFLFAAYIATWLIHGGYLVHLVRSFKRLRSELREMGKK |
| Ga0335074_10000025127 | 3300032895 | Soil | MNAIKFLFAAYIATWVIHGVYVGTLVRRFGRLRRELKELGKGK |
| Ga0335074_100166613 | 3300032895 | Soil | MNSSVKFLIAAYIATWVIHAFYIGTLVSRFRKLRGQMRELGKRK |
| Ga0335074_100220494 | 3300032895 | Soil | MNPIKFLFAAYIATWIIHGTYLGTLVRRFGRLKKDLDELSKNHKPGN |
| Ga0335074_100424294 | 3300032895 | Soil | MNSIKFLFAAYIATWVIHGTYLGTLVRRFGRLKKELGDLHTKDKASTV |
| Ga0335074_102415635 | 3300032895 | Soil | MNSIKFLFAAYIATWIIHGTYLGTLVRRFSRLKKELDELGESHRSANQ |
| Ga0335072_102423063 | 3300032898 | Soil | MNAIKFLFAAYIATWLIHAVYIGTLLARFKRLRGELKDLGKQQK |
| Ga0335072_102923782 | 3300032898 | Soil | VNSIKFLFAAYIATWVIHGTYLATIVRRFGRLKKELEDLDKTRKVARPR |
| Ga0335083_1000239317 | 3300032954 | Soil | MNAVKFLIAAYVATWVIHGVYLGSLIRRFGRLRQQAKELGKGK |
| Ga0335083_101819493 | 3300032954 | Soil | MNALKFLFAAYIATWVIHCFYIGTLLTRFRKLRQQLKELGKGK |
| Ga0335083_106601792 | 3300032954 | Soil | MNAVKFLIAAYVATWLIHGFYLATLVRRFGKAKRELKELGKGK |
| Ga0335076_100078312 | 3300032955 | Soil | MNAIKFLFAAYIATWLIHGIYLGTLIRRFNRVRDQLKELSRDK |
| Ga0335076_100194419 | 3300032955 | Soil | MNAVKFMFAAYIATWLIHGIYLGTVVHRFKKLQSQLKDLGKK |
| Ga0335076_103308072 | 3300032955 | Soil | MNAVKFLFAAYIATWVIHLFYIGTLVRRFSKLRRELKDLRK |
| Ga0335076_117579151 | 3300032955 | Soil | ELPMNALKFLFAAYIATWVIHAFYLGTIVRRFKKVHQQLKDLGKK |
| Ga0335077_106354022 | 3300033158 | Soil | MNAIKFLFAAYILTWVIHSFYLGTLVRRFARLRRQLKELSKGKN |
| Ga0326728_101928412 | 3300033402 | Peat Soil | MNGIKFLFAAYIATWVIHGAYLGSLVRRFSRLREQLKEVGKK |
| Ga0326728_102338843 | 3300033402 | Peat Soil | MNALKFLFAAYIATWLIHAAYLGSLVRRFGRLRQQLKELGKGK |
| Ga0326728_104524461 | 3300033402 | Peat Soil | MNALKFLFAAYIATWVIHAFYLGTLVRRFRRLRRELQDLDSGKRL |
| Ga0316212_10127522 | 3300033547 | Roots | MNAIKFLFAAYIATWLIHGVYLVSLVRRFGRLRRELKDVGKK |
| Ga0314866_062650_1_132 | 3300033807 | Peatland | MNAVKFLFAAYIATWLIHGFYMGTLVSRFRRLRREINELHKSDP |
| Ga0334792_012407_2915_3043 | 3300033888 | Soil | MNGIKFLFAAYIATWVIHGVYLGSLVRRFSRLRQQLKELGKK |
| Ga0314861_0100380_1344_1478 | 3300033977 | Peatland | MNAIKFLYAAFIATWVIHAFYLGTLVRRFGRLRRELKELGKEQSD |
| Ga0370494_013354_390_518 | 3300034130 | Untreated Peat Soil | MNATKYLAAAYIVTWVIHGFYISTLVSRFARLRREMKDLKKH |
| ⦗Top⦘ |