


| Basic Information | |
|---|---|
| Family ID | F000441 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 1136 |
| Average Sequence Length | 47 residues |
| Representative Sequence | MKMSDVYINDQLNKAQKLLWGGSETENIEAHNIISKLIKDRIEQVEG |
| Number of Associated Samples | 403 |
| Number of Associated Scaffolds | 1136 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 79.26 % |
| % of genes near scaffold ends (potentially truncated) | 26.23 % |
| % of genes from short scaffolds (< 2000 bps) | 74.74 % |
| Associated GOLD sequencing projects | 343 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.74 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (56.514 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (18.134 % of family members) |
| Environment Ontology (ENVO) | Unclassified (51.408 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (60.035 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.67% β-sheet: 0.00% Coil/Unstructured: 49.33% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.74 |
| Powered by PDBe Molstar | |
| SCOP family | SCOP domain | Representative PDB | TM-score |
|---|---|---|---|
| a.118.19.1: C-terminal domain of Ku80 | d1q2za_ | 1q2z | 0.79 |
| a.25.1.1: Ferritin-like | d3bvfa1 | 3bvf | 0.76 |
| a.128.1.0: Terpenoid synthases | d7kjga_ | 7kjg | 0.76 |
| a.47.6.1: MukF C-terminal domain-like | d1t98a2 | 1t98 | 0.75 |
| e.26.1.3: Prismane protein-like | d3i01m_ | 3i01 | 0.74 |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 1136 Family Scaffolds |
|---|---|---|
| PF06067 | DUF932 | 2.38 |
| PF13640 | 2OG-FeII_Oxy_3 | 1.50 |
| PF04973 | NMN_transporter | 1.06 |
| PF14025 | DUF4241 | 0.70 |
| PF02467 | Whib | 0.53 |
| PF02675 | AdoMet_dc | 0.26 |
| PF13936 | HTH_38 | 0.26 |
| PF05257 | CHAP | 0.26 |
| PF00085 | Thioredoxin | 0.26 |
| PF11397 | GlcNAc | 0.26 |
| PF00578 | AhpC-TSA | 0.18 |
| PF01464 | SLT | 0.18 |
| PF04860 | Phage_portal | 0.18 |
| PF00082 | Peptidase_S8 | 0.18 |
| PF00685 | Sulfotransfer_1 | 0.18 |
| PF11999 | Ice_binding | 0.18 |
| PF01844 | HNH | 0.18 |
| PF05118 | Asp_Arg_Hydrox | 0.18 |
| PF00106 | adh_short | 0.09 |
| PF02511 | Thy1 | 0.09 |
| PF00534 | Glycos_transf_1 | 0.09 |
| PF09834 | DUF2061 | 0.09 |
| PF03029 | ATP_bind_1 | 0.09 |
| PF04820 | Trp_halogenase | 0.09 |
| PF00535 | Glycos_transf_2 | 0.09 |
| PF00041 | fn3 | 0.09 |
| PF09479 | Flg_new | 0.09 |
| PF13385 | Laminin_G_3 | 0.09 |
| PF14579 | HHH_6 | 0.09 |
| PF03567 | Sulfotransfer_2 | 0.09 |
| PF00565 | SNase | 0.09 |
| PF00436 | SSB | 0.09 |
| PF03796 | DnaB_C | 0.09 |
| PF01381 | HTH_3 | 0.09 |
| PF13384 | HTH_23 | 0.09 |
| PF00296 | Bac_luciferase | 0.09 |
| PF13884 | Peptidase_S74 | 0.09 |
| PF00166 | Cpn10 | 0.09 |
| PF00210 | Ferritin | 0.09 |
| PF02543 | Carbam_trans_N | 0.09 |
| PF02075 | RuvC | 0.09 |
| PF01583 | APS_kinase | 0.09 |
| PF03031 | NIF | 0.09 |
| COG ID | Name | Functional Category | % Frequency in 1136 Family Scaffolds |
|---|---|---|---|
| COG3201 | Nicotinamide riboside transporter PnuC | Coenzyme transport and metabolism [H] | 1.06 |
| COG1586 | S-adenosylmethionine decarboxylase | Amino acid transport and metabolism [E] | 0.26 |
| COG3555 | Aspartyl/asparaginyl beta-hydroxylase, cupin superfamily | Posttranslational modification, protein turnover, chaperones [O] | 0.18 |
| COG0234 | Co-chaperonin GroES (HSP10) | Posttranslational modification, protein turnover, chaperones [O] | 0.09 |
| COG0305 | Replicative DNA helicase | Replication, recombination and repair [L] | 0.09 |
| COG0529 | Adenylylsulfate kinase or related kinase | Inorganic ion transport and metabolism [P] | 0.09 |
| COG0629 | Single-stranded DNA-binding protein | Replication, recombination and repair [L] | 0.09 |
| COG0817 | Holliday junction resolvasome RuvABC endonuclease subunit RuvC | Replication, recombination and repair [L] | 0.09 |
| COG1066 | DNA repair protein RadA/Sms, contains AAA+ ATPase domain | Replication, recombination and repair [L] | 0.09 |
| COG1100 | GTPase SAR1 family domain | General function prediction only [R] | 0.09 |
| COG1351 | Thymidylate synthase ThyX, FAD-dependent family | Nucleotide transport and metabolism [F] | 0.09 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.09 |
| COG2192 | Predicted carbamoyl transferase, NodU family | General function prediction only [R] | 0.09 |
| COG2229 | Signal recognition particle receptor subunit beta, a GTPase | Intracellular trafficking, secretion, and vesicular transport [U] | 0.09 |
| COG2965 | Primosomal replication protein N | Replication, recombination and repair [L] | 0.09 |
| COG5190 | TFIIF-interacting CTD phosphatase, includes NLI-interacting factor | Transcription [K] | 0.09 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 56.51 % |
| All Organisms | root | All Organisms | 43.49 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2166559019|stn_contig08170 | Not Available | 514 | Open in IMG/M |
| 2166559019|stn_contig19483 | Not Available | 531 | Open in IMG/M |
| 2199352004|2199797285 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8202 | Open in IMG/M |
| 2199352004|2199908989 | All Organisms → Viruses → Predicted Viral | 2820 | Open in IMG/M |
| 3300000268|M3P_10060742 | Not Available | 1256 | Open in IMG/M |
| 3300000525|JGI1221J11331_1010078 | All Organisms → Viruses → Predicted Viral | 2567 | Open in IMG/M |
| 3300000736|JGI12547J11936_1011546 | All Organisms → Viruses → Predicted Viral | 2270 | Open in IMG/M |
| 3300000736|JGI12547J11936_1015058 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1932 | Open in IMG/M |
| 3300000736|JGI12547J11936_1015666 | Not Available | 1887 | Open in IMG/M |
| 3300000736|JGI12547J11936_1023019 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1466 | Open in IMG/M |
| 3300000736|JGI12547J11936_1051787 | Not Available | 830 | Open in IMG/M |
| 3300000756|JGI12421J11937_10042573 | All Organisms → Viruses → Predicted Viral | 1532 | Open in IMG/M |
| 3300000756|JGI12421J11937_10068531 | All Organisms → Viruses → Predicted Viral | 1072 | Open in IMG/M |
| 3300000756|JGI12421J11937_10114841 | Not Available | 712 | Open in IMG/M |
| 3300000756|JGI12421J11937_10139522 | Not Available | 611 | Open in IMG/M |
| 3300000756|JGI12421J11937_10175829 | Not Available | 513 | Open in IMG/M |
| 3300000882|FwDRAFT_10007858 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6991 | Open in IMG/M |
| 3300000882|FwDRAFT_10023811 | All Organisms → Viruses → Predicted Viral | 1657 | Open in IMG/M |
| 3300000929|NpDRAFT_10078824 | Not Available | 1111 | Open in IMG/M |
| 3300001255|B570J13889_100001 | Not Available | 72296 | Open in IMG/M |
| 3300001282|B570J14230_10041066 | Not Available | 1583 | Open in IMG/M |
| 3300001282|B570J14230_10065599 | All Organisms → Viruses → Predicted Viral | 1160 | Open in IMG/M |
| 3300002161|JGI24766J26685_10000155 | All Organisms → cellular organisms → Bacteria | 17524 | Open in IMG/M |
| 3300002161|JGI24766J26685_10021669 | Not Available | 1607 | Open in IMG/M |
| 3300002161|JGI24766J26685_10025913 | Not Available | 1431 | Open in IMG/M |
| 3300002201|metazooDRAFT_1261576 | Not Available | 633 | Open in IMG/M |
| 3300002272|B570J29579_102815 | Not Available | 878 | Open in IMG/M |
| 3300002273|B570J29588_106646 | Not Available | 664 | Open in IMG/M |
| 3300002304|B570J29606_1019844 | Not Available | 528 | Open in IMG/M |
| 3300002350|B570J29583_1000478 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3245 | Open in IMG/M |
| 3300002400|B570J29625_1001530 | Not Available | 1916 | Open in IMG/M |
| 3300002408|B570J29032_109394010 | Not Available | 733 | Open in IMG/M |
| 3300002408|B570J29032_109440860 | Not Available | 766 | Open in IMG/M |
| 3300002408|B570J29032_109646633 | Not Available | 987 | Open in IMG/M |
| 3300002471|metazooDRAFT_1475678 | Not Available | 770 | Open in IMG/M |
| 3300002835|B570J40625_100000179 | Not Available | 98877 | Open in IMG/M |
| 3300002835|B570J40625_100023803 | Not Available | 10112 | Open in IMG/M |
| 3300002835|B570J40625_100062516 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5068 | Open in IMG/M |
| 3300002835|B570J40625_100234665 | Not Available | 1935 | Open in IMG/M |
| 3300002835|B570J40625_100242054 | Not Available | 1892 | Open in IMG/M |
| 3300002835|B570J40625_100262739 | All Organisms → Viruses → Predicted Viral | 1786 | Open in IMG/M |
| 3300002835|B570J40625_100273369 | Not Available | 1738 | Open in IMG/M |
| 3300002835|B570J40625_100433321 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1263 | Open in IMG/M |
| 3300002835|B570J40625_100447938 | Not Available | 1234 | Open in IMG/M |
| 3300002835|B570J40625_100609077 | Not Available | 998 | Open in IMG/M |
| 3300002835|B570J40625_100704418 | Not Available | 903 | Open in IMG/M |
| 3300002835|B570J40625_101261582 | Not Available | 616 | Open in IMG/M |
| 3300002835|B570J40625_101740140 | Not Available | 506 | Open in IMG/M |
| 3300003277|JGI25908J49247_10017578 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2157 | Open in IMG/M |
| 3300003277|JGI25908J49247_10092295 | Not Available | 736 | Open in IMG/M |
| 3300003277|JGI25908J49247_10098301 | Not Available | 707 | Open in IMG/M |
| 3300003277|JGI25908J49247_10151822 | Not Available | 540 | Open in IMG/M |
| 3300003388|JGI25910J50241_10000169 | Not Available | 20246 | Open in IMG/M |
| 3300003388|JGI25910J50241_10172036 | Not Available | 555 | Open in IMG/M |
| 3300003413|JGI25922J50271_10001899 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6053 | Open in IMG/M |
| 3300003413|JGI25922J50271_10007941 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2924 | Open in IMG/M |
| 3300003413|JGI25922J50271_10009008 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2722 | Open in IMG/M |
| 3300003413|JGI25922J50271_10014590 | All Organisms → Viruses → Predicted Viral | 2058 | Open in IMG/M |
| 3300003413|JGI25922J50271_10036440 | Not Available | 1153 | Open in IMG/M |
| 3300003413|JGI25922J50271_10047299 | Not Available | 975 | Open in IMG/M |
| 3300003413|JGI25922J50271_10057176 | Not Available | 865 | Open in IMG/M |
| 3300003413|JGI25922J50271_10062714 | Not Available | 817 | Open in IMG/M |
| 3300003413|JGI25922J50271_10075013 | Not Available | 730 | Open in IMG/M |
| 3300003413|JGI25922J50271_10101672 | Not Available | 609 | Open in IMG/M |
| 3300003413|JGI25922J50271_10117484 | Not Available | 560 | Open in IMG/M |
| 3300003429|JGI25914J50564_10015854 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2325 | Open in IMG/M |
| 3300003429|JGI25914J50564_10053893 | All Organisms → Viruses → Predicted Viral | 1076 | Open in IMG/M |
| 3300003429|JGI25914J50564_10056754 | Not Available | 1041 | Open in IMG/M |
| 3300003430|JGI25921J50272_10000767 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 10531 | Open in IMG/M |
| 3300003430|JGI25921J50272_10006957 | All Organisms → Viruses → Predicted Viral | 3483 | Open in IMG/M |
| 3300003430|JGI25921J50272_10026872 | All Organisms → Viruses → Predicted Viral | 1471 | Open in IMG/M |
| 3300003430|JGI25921J50272_10032017 | All Organisms → Viruses → Predicted Viral | 1298 | Open in IMG/M |
| 3300003430|JGI25921J50272_10033603 | All Organisms → Viruses → Predicted Viral | 1254 | Open in IMG/M |
| 3300003430|JGI25921J50272_10037327 | Not Available | 1166 | Open in IMG/M |
| 3300003430|JGI25921J50272_10045617 | Not Available | 1014 | Open in IMG/M |
| 3300003430|JGI25921J50272_10047455 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 988 | Open in IMG/M |
| 3300003430|JGI25921J50272_10068276 | Not Available | 778 | Open in IMG/M |
| 3300003430|JGI25921J50272_10091469 | Not Available | 650 | Open in IMG/M |
| 3300003430|JGI25921J50272_10117666 | Not Available | 559 | Open in IMG/M |
| 3300003490|JGI25926J51410_1035132 | Not Available | 914 | Open in IMG/M |
| 3300003491|JGI25924J51412_1028687 | Not Available | 933 | Open in IMG/M |
| 3300003491|JGI25924J51412_1046871 | Not Available | 684 | Open in IMG/M |
| 3300003493|JGI25923J51411_1037709 | Not Available | 907 | Open in IMG/M |
| 3300003493|JGI25923J51411_1071269 | Not Available | 601 | Open in IMG/M |
| 3300003497|JGI25925J51416_10078286 | Not Available | 819 | Open in IMG/M |
| 3300003497|JGI25925J51416_10112539 | Not Available | 641 | Open in IMG/M |
| 3300003499|JGI25930J51415_1009297 | All Organisms → Viruses → Predicted Viral | 2003 | Open in IMG/M |
| 3300003499|JGI25930J51415_1010119 | All Organisms → Viruses → Predicted Viral | 1909 | Open in IMG/M |
| 3300003499|JGI25930J51415_1018409 | All Organisms → Viruses → Predicted Viral | 1331 | Open in IMG/M |
| 3300003499|JGI25930J51415_1064948 | Not Available | 614 | Open in IMG/M |
| 3300003986|Ga0063233_10215509 | Not Available | 591 | Open in IMG/M |
| 3300004054|Ga0063232_10062026 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1003 | Open in IMG/M |
| 3300004054|Ga0063232_10083442 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 882 | Open in IMG/M |
| 3300004054|Ga0063232_10275046 | Not Available | 511 | Open in IMG/M |
| 3300004096|Ga0066177_10130191 | Not Available | 989 | Open in IMG/M |
| 3300004096|Ga0066177_10250632 | Not Available | 740 | Open in IMG/M |
| 3300004096|Ga0066177_10312911 | Not Available | 668 | Open in IMG/M |
| 3300004096|Ga0066177_10541796 | Not Available | 518 | Open in IMG/M |
| 3300004124|Ga0066178_10063033 | Not Available | 962 | Open in IMG/M |
| 3300004125|Ga0066182_10165263 | Not Available | 552 | Open in IMG/M |
| 3300004126|Ga0066179_10217936 | Not Available | 538 | Open in IMG/M |
| 3300004240|Ga0007787_10626691 | Not Available | 538 | Open in IMG/M |
| 3300004772|Ga0007791_10078605 | Not Available | 1021 | Open in IMG/M |
| 3300004797|Ga0007764_11698727 | Not Available | 1107 | Open in IMG/M |
| 3300004836|Ga0007759_11435415 | Not Available | 732 | Open in IMG/M |
| 3300005069|Ga0071350_1009706 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2216 | Open in IMG/M |
| 3300005517|Ga0070374_10058938 | All Organisms → Viruses → Predicted Viral | 1998 | Open in IMG/M |
| 3300005517|Ga0070374_10079768 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1705 | Open in IMG/M |
| 3300005517|Ga0070374_10121976 | Not Available | 1356 | Open in IMG/M |
| 3300005517|Ga0070374_10130906 | Not Available | 1304 | Open in IMG/M |
| 3300005517|Ga0070374_10159870 | Not Available | 1167 | Open in IMG/M |
| 3300005517|Ga0070374_10189199 | Not Available | 1061 | Open in IMG/M |
| 3300005517|Ga0070374_10209964 | All Organisms → Viruses → Predicted Viral | 1000 | Open in IMG/M |
| 3300005517|Ga0070374_10234748 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 939 | Open in IMG/M |
| 3300005517|Ga0070374_10258236 | Not Available | 889 | Open in IMG/M |
| 3300005517|Ga0070374_10273973 | Not Available | 859 | Open in IMG/M |
| 3300005517|Ga0070374_10319252 | Not Available | 787 | Open in IMG/M |
| 3300005517|Ga0070374_10327473 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 775 | Open in IMG/M |
| 3300005517|Ga0070374_10479611 | Not Available | 621 | Open in IMG/M |
| 3300005517|Ga0070374_10539175 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 581 | Open in IMG/M |
| 3300005517|Ga0070374_10587901 | Not Available | 553 | Open in IMG/M |
| 3300005517|Ga0070374_10646692 | Not Available | 523 | Open in IMG/M |
| 3300005517|Ga0070374_10692899 | Not Available | 503 | Open in IMG/M |
| 3300005525|Ga0068877_10343903 | Not Available | 853 | Open in IMG/M |
| 3300005525|Ga0068877_10489214 | Not Available | 682 | Open in IMG/M |
| 3300005527|Ga0068876_10027787 | Not Available | 3534 | Open in IMG/M |
| 3300005527|Ga0068876_10094103 | Not Available | 1791 | Open in IMG/M |
| 3300005527|Ga0068876_10111039 | Not Available | 1630 | Open in IMG/M |
| 3300005527|Ga0068876_10181195 | All Organisms → Viruses → Predicted Viral | 1228 | Open in IMG/M |
| 3300005527|Ga0068876_10214305 | Not Available | 1113 | Open in IMG/M |
| 3300005527|Ga0068876_10278643 | Not Available | 953 | Open in IMG/M |
| 3300005527|Ga0068876_10327336 | Not Available | 865 | Open in IMG/M |
| 3300005527|Ga0068876_10406638 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 758 | Open in IMG/M |
| 3300005527|Ga0068876_10501658 | Not Available | 666 | Open in IMG/M |
| 3300005528|Ga0068872_10063164 | Not Available | 2284 | Open in IMG/M |
| 3300005528|Ga0068872_10102110 | All Organisms → Viruses → Predicted Viral | 1713 | Open in IMG/M |
| 3300005528|Ga0068872_10117019 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1577 | Open in IMG/M |
| 3300005528|Ga0068872_10146543 | Not Available | 1378 | Open in IMG/M |
| 3300005528|Ga0068872_10187933 | Not Available | 1185 | Open in IMG/M |
| 3300005528|Ga0068872_10590174 | Not Available | 589 | Open in IMG/M |
| 3300005580|Ga0049083_10014652 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2838 | Open in IMG/M |
| 3300005580|Ga0049083_10030201 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1934 | Open in IMG/M |
| 3300005580|Ga0049083_10032901 | All Organisms → Viruses → Predicted Viral | 1849 | Open in IMG/M |
| 3300005580|Ga0049083_10073099 | Not Available | 1200 | Open in IMG/M |
| 3300005580|Ga0049083_10219013 | Not Available | 644 | Open in IMG/M |
| 3300005581|Ga0049081_10223581 | Not Available | 668 | Open in IMG/M |
| 3300005581|Ga0049081_10261668 | Not Available | 604 | Open in IMG/M |
| 3300005581|Ga0049081_10326379 | Not Available | 524 | Open in IMG/M |
| 3300005582|Ga0049080_10019381 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2372 | Open in IMG/M |
| 3300005582|Ga0049080_10084654 | All Organisms → Viruses → Predicted Viral | 1083 | Open in IMG/M |
| 3300005582|Ga0049080_10204229 | Not Available | 652 | Open in IMG/M |
| 3300005582|Ga0049080_10285024 | Not Available | 534 | Open in IMG/M |
| 3300005583|Ga0049085_10014259 | All Organisms → Viruses → Predicted Viral | 3062 | Open in IMG/M |
| 3300005583|Ga0049085_10093720 | Not Available | 1041 | Open in IMG/M |
| 3300005583|Ga0049085_10119747 | Not Available | 900 | Open in IMG/M |
| 3300005583|Ga0049085_10195873 | Not Available | 672 | Open in IMG/M |
| 3300005584|Ga0049082_10022654 | Not Available | 2180 | Open in IMG/M |
| 3300005584|Ga0049082_10040302 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1636 | Open in IMG/M |
| 3300005584|Ga0049082_10042348 | Not Available | 1594 | Open in IMG/M |
| 3300005584|Ga0049082_10045635 | Not Available | 1534 | Open in IMG/M |
| 3300005585|Ga0049084_10128688 | Not Available | 893 | Open in IMG/M |
| 3300005662|Ga0078894_10100883 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2548 | Open in IMG/M |
| 3300005662|Ga0078894_10138009 | All Organisms → Viruses → Predicted Viral | 2181 | Open in IMG/M |
| 3300005662|Ga0078894_10181974 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1898 | Open in IMG/M |
| 3300005662|Ga0078894_10184039 | All Organisms → Viruses → Predicted Viral | 1887 | Open in IMG/M |
| 3300005662|Ga0078894_10211704 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1755 | Open in IMG/M |
| 3300005662|Ga0078894_10220553 | Not Available | 1718 | Open in IMG/M |
| 3300005662|Ga0078894_10247251 | Not Available | 1617 | Open in IMG/M |
| 3300005662|Ga0078894_10251920 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1601 | Open in IMG/M |
| 3300005662|Ga0078894_10275861 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1526 | Open in IMG/M |
| 3300005662|Ga0078894_10319641 | All Organisms → Viruses → Predicted Viral | 1407 | Open in IMG/M |
| 3300005662|Ga0078894_10323756 | All Organisms → Viruses → Predicted Viral | 1397 | Open in IMG/M |
| 3300005662|Ga0078894_10327554 | All Organisms → Viruses → Predicted Viral | 1388 | Open in IMG/M |
| 3300005662|Ga0078894_10398165 | All Organisms → Viruses → Predicted Viral | 1244 | Open in IMG/M |
| 3300005662|Ga0078894_10485568 | All Organisms → Viruses → Predicted Viral | 1110 | Open in IMG/M |
| 3300005662|Ga0078894_10499404 | All Organisms → Viruses → Predicted Viral | 1092 | Open in IMG/M |
| 3300005662|Ga0078894_10527297 | All Organisms → Viruses → Predicted Viral | 1058 | Open in IMG/M |
| 3300005662|Ga0078894_10656620 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 929 | Open in IMG/M |
| 3300005662|Ga0078894_10865324 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 786 | Open in IMG/M |
| 3300005662|Ga0078894_10928312 | Not Available | 753 | Open in IMG/M |
| 3300005662|Ga0078894_10975748 | Not Available | 731 | Open in IMG/M |
| 3300005662|Ga0078894_11007935 | Not Available | 716 | Open in IMG/M |
| 3300005662|Ga0078894_11201298 | Not Available | 642 | Open in IMG/M |
| 3300005662|Ga0078894_11216588 | Not Available | 637 | Open in IMG/M |
| 3300005662|Ga0078894_11277028 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 618 | Open in IMG/M |
| 3300005662|Ga0078894_11290870 | Not Available | 614 | Open in IMG/M |
| 3300005662|Ga0078894_11313845 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 608 | Open in IMG/M |
| 3300005662|Ga0078894_11430999 | Not Available | 576 | Open in IMG/M |
| 3300005662|Ga0078894_11527550 | Not Available | 553 | Open in IMG/M |
| 3300005662|Ga0078894_11558778 | Not Available | 546 | Open in IMG/M |
| 3300005662|Ga0078894_11563479 | Not Available | 545 | Open in IMG/M |
| 3300005662|Ga0078894_11576614 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 542 | Open in IMG/M |
| 3300005662|Ga0078894_11581912 | Not Available | 541 | Open in IMG/M |
| 3300005662|Ga0078894_11696366 | Not Available | 518 | Open in IMG/M |
| 3300005662|Ga0078894_11712323 | Not Available | 515 | Open in IMG/M |
| 3300005662|Ga0078894_11778024 | Not Available | 503 | Open in IMG/M |
| 3300005662|Ga0078894_11790203 | Not Available | 501 | Open in IMG/M |
| 3300005805|Ga0079957_1017146 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5179 | Open in IMG/M |
| 3300005805|Ga0079957_1040543 | All Organisms → Viruses → Predicted Viral | 2959 | Open in IMG/M |
| 3300005941|Ga0070743_10001151 | Not Available | 10113 | Open in IMG/M |
| 3300005941|Ga0070743_10050185 | Not Available | 1424 | Open in IMG/M |
| 3300005941|Ga0070743_10058135 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1315 | Open in IMG/M |
| 3300005941|Ga0070743_10078252 | All Organisms → Viruses → Predicted Viral | 1117 | Open in IMG/M |
| 3300005941|Ga0070743_10207145 | Not Available | 643 | Open in IMG/M |
| 3300005941|Ga0070743_10261976 | Not Available | 561 | Open in IMG/M |
| 3300005941|Ga0070743_10281240 | Not Available | 538 | Open in IMG/M |
| 3300006030|Ga0075470_10015825 | All Organisms → Viruses → Predicted Viral | 2332 | Open in IMG/M |
| 3300006030|Ga0075470_10021264 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2011 | Open in IMG/M |
| 3300006484|Ga0070744_10000083 | Not Available | 22610 | Open in IMG/M |
| 3300006484|Ga0070744_10000414 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 12243 | Open in IMG/M |
| 3300006484|Ga0070744_10010400 | All Organisms → Viruses → Predicted Viral | 2760 | Open in IMG/M |
| 3300006484|Ga0070744_10014570 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2331 | Open in IMG/M |
| 3300006484|Ga0070744_10026286 | All Organisms → Viruses → Predicted Viral | 1723 | Open in IMG/M |
| 3300006484|Ga0070744_10028763 | Not Available | 1646 | Open in IMG/M |
| 3300006484|Ga0070744_10032090 | All Organisms → Viruses → Predicted Viral | 1552 | Open in IMG/M |
| 3300006484|Ga0070744_10043606 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1318 | Open in IMG/M |
| 3300006484|Ga0070744_10053285 | Not Available | 1184 | Open in IMG/M |
| 3300006484|Ga0070744_10066514 | All Organisms → Viruses → Predicted Viral | 1048 | Open in IMG/M |
| 3300006484|Ga0070744_10076834 | Not Available | 969 | Open in IMG/M |
| 3300006484|Ga0070744_10083845 | Not Available | 924 | Open in IMG/M |
| 3300006484|Ga0070744_10093405 | Not Available | 870 | Open in IMG/M |
| 3300006484|Ga0070744_10100586 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 835 | Open in IMG/M |
| 3300006484|Ga0070744_10150049 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 669 | Open in IMG/M |
| 3300006484|Ga0070744_10183252 | Not Available | 598 | Open in IMG/M |
| 3300006484|Ga0070744_10185495 | Not Available | 593 | Open in IMG/M |
| 3300006484|Ga0070744_10214377 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 547 | Open in IMG/M |
| 3300006641|Ga0075471_10145216 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1257 | Open in IMG/M |
| 3300006641|Ga0075471_10257180 | Not Available | 896 | Open in IMG/M |
| 3300006805|Ga0075464_11048831 | Not Available | 513 | Open in IMG/M |
| 3300006875|Ga0075473_10391712 | Not Available | 561 | Open in IMG/M |
| 3300006917|Ga0075472_10460712 | Not Available | 631 | Open in IMG/M |
| 3300007162|Ga0079300_10000456 | Not Available | 15358 | Open in IMG/M |
| 3300007162|Ga0079300_10138596 | Not Available | 668 | Open in IMG/M |
| 3300007162|Ga0079300_10211482 | Not Available | 505 | Open in IMG/M |
| 3300007165|Ga0079302_1068395 | Not Available | 780 | Open in IMG/M |
| 3300007363|Ga0075458_10080372 | All Organisms → Viruses → Predicted Viral | 1018 | Open in IMG/M |
| 3300007543|Ga0102853_1020164 | All Organisms → Viruses → Predicted Viral | 1092 | Open in IMG/M |
| 3300007543|Ga0102853_1028398 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 938 | Open in IMG/M |
| 3300007543|Ga0102853_1067779 | Not Available | 641 | Open in IMG/M |
| 3300007544|Ga0102861_1014321 | All Organisms → Viruses → Predicted Viral | 1930 | Open in IMG/M |
| 3300007544|Ga0102861_1120115 | Not Available | 707 | Open in IMG/M |
| 3300007545|Ga0102873_1001802 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6869 | Open in IMG/M |
| 3300007545|Ga0102873_1016042 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2309 | Open in IMG/M |
| 3300007545|Ga0102873_1035280 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1537 | Open in IMG/M |
| 3300007545|Ga0102873_1202845 | Not Available | 596 | Open in IMG/M |
| 3300007546|Ga0102874_1104872 | Not Available | 892 | Open in IMG/M |
| 3300007547|Ga0102875_1149436 | Not Available | 734 | Open in IMG/M |
| 3300007547|Ga0102875_1271297 | Not Available | 516 | Open in IMG/M |
| 3300007548|Ga0102877_1063306 | All Organisms → Viruses → Predicted Viral | 1063 | Open in IMG/M |
| 3300007548|Ga0102877_1173951 | Not Available | 607 | Open in IMG/M |
| 3300007553|Ga0102819_1014562 | Not Available | 1347 | Open in IMG/M |
| 3300007554|Ga0102820_1131870 | Not Available | 602 | Open in IMG/M |
| 3300007555|Ga0102817_1033164 | Not Available | 1136 | Open in IMG/M |
| 3300007557|Ga0102821_1000167 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 27894 | Open in IMG/M |
| 3300007557|Ga0102821_1018170 | All Organisms → Viruses → Predicted Viral | 1907 | Open in IMG/M |
| 3300007557|Ga0102821_1063752 | Not Available | 949 | Open in IMG/M |
| 3300007559|Ga0102828_1001377 | All Organisms → Viruses → Predicted Viral | 4349 | Open in IMG/M |
| 3300007559|Ga0102828_1014581 | Not Available | 1650 | Open in IMG/M |
| 3300007559|Ga0102828_1018007 | Not Available | 1512 | Open in IMG/M |
| 3300007559|Ga0102828_1066205 | Not Available | 854 | Open in IMG/M |
| 3300007560|Ga0102913_1129701 | Not Available | 816 | Open in IMG/M |
| 3300007562|Ga0102915_1144424 | Not Available | 777 | Open in IMG/M |
| 3300007590|Ga0102917_1115458 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 945 | Open in IMG/M |
| 3300007593|Ga0102918_1076763 | Not Available | 980 | Open in IMG/M |
| 3300007597|Ga0102919_1061801 | Not Available | 1171 | Open in IMG/M |
| 3300007606|Ga0102923_1274674 | Not Available | 520 | Open in IMG/M |
| 3300007617|Ga0102897_1029256 | Not Available | 1755 | Open in IMG/M |
| 3300007617|Ga0102897_1219737 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 566 | Open in IMG/M |
| 3300007618|Ga0102896_1147231 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 753 | Open in IMG/M |
| 3300007618|Ga0102896_1223230 | Not Available | 589 | Open in IMG/M |
| 3300007620|Ga0102871_1044255 | Not Available | 1319 | Open in IMG/M |
| 3300007621|Ga0102872_1151847 | Not Available | 614 | Open in IMG/M |
| 3300007622|Ga0102863_1049584 | All Organisms → Viruses → Predicted Viral | 1223 | Open in IMG/M |
| 3300007622|Ga0102863_1071965 | Not Available | 1013 | Open in IMG/M |
| 3300007624|Ga0102878_1080078 | Not Available | 978 | Open in IMG/M |
| 3300007629|Ga0102895_1018355 | All Organisms → Viruses → Predicted Viral | 1739 | Open in IMG/M |
| 3300007634|Ga0102901_1003049 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5166 | Open in IMG/M |
| 3300007634|Ga0102901_1232456 | Not Available | 517 | Open in IMG/M |
| 3300007636|Ga0102856_1036391 | Not Available | 757 | Open in IMG/M |
| 3300007637|Ga0102906_1134602 | Not Available | 677 | Open in IMG/M |
| 3300007639|Ga0102865_1067123 | All Organisms → Viruses → Predicted Viral | 1068 | Open in IMG/M |
| 3300007639|Ga0102865_1093978 | Not Available | 896 | Open in IMG/M |
| 3300007639|Ga0102865_1184623 | Not Available | 623 | Open in IMG/M |
| 3300007642|Ga0102876_1087445 | Not Available | 850 | Open in IMG/M |
| 3300007642|Ga0102876_1089886 | Not Available | 836 | Open in IMG/M |
| 3300007642|Ga0102876_1183935 | Not Available | 555 | Open in IMG/M |
| 3300007644|Ga0102902_1061956 | Not Available | 1120 | Open in IMG/M |
| 3300007644|Ga0102902_1185577 | Not Available | 614 | Open in IMG/M |
| 3300007647|Ga0102855_1123041 | Not Available | 694 | Open in IMG/M |
| 3300007647|Ga0102855_1210036 | Not Available | 519 | Open in IMG/M |
| 3300007670|Ga0102862_1070941 | Not Available | 859 | Open in IMG/M |
| 3300007706|Ga0102899_1003263 | All Organisms → Viruses → Predicted Viral | 4034 | Open in IMG/M |
| 3300007706|Ga0102899_1011987 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2013 | Open in IMG/M |
| 3300007708|Ga0102859_1039822 | All Organisms → Viruses → Predicted Viral | 1282 | Open in IMG/M |
| 3300007708|Ga0102859_1104938 | Not Available | 815 | Open in IMG/M |
| 3300007708|Ga0102859_1184010 | Not Available | 618 | Open in IMG/M |
| 3300007716|Ga0102867_1048884 | All Organisms → Viruses → Predicted Viral | 1110 | Open in IMG/M |
| 3300007861|Ga0105736_1032478 | All Organisms → Viruses → Predicted Viral | 1000 | Open in IMG/M |
| 3300007864|Ga0105749_1057636 | Not Available | 796 | Open in IMG/M |
| 3300007864|Ga0105749_1174271 | Not Available | 517 | Open in IMG/M |
| 3300007972|Ga0105745_1017104 | All Organisms → Viruses → Predicted Viral | 1772 | Open in IMG/M |
| 3300007972|Ga0105745_1017463 | All Organisms → Viruses → Predicted Viral | 1759 | Open in IMG/M |
| 3300007972|Ga0105745_1051674 | Not Available | 1129 | Open in IMG/M |
| 3300007973|Ga0105746_1031900 | Not Available | 1609 | Open in IMG/M |
| 3300007973|Ga0105746_1130408 | Not Available | 840 | Open in IMG/M |
| 3300007973|Ga0105746_1146609 | Not Available | 794 | Open in IMG/M |
| 3300007973|Ga0105746_1186878 | Not Available | 706 | Open in IMG/M |
| 3300007973|Ga0105746_1271698 | Not Available | 586 | Open in IMG/M |
| 3300007973|Ga0105746_1330934 | Not Available | 530 | Open in IMG/M |
| 3300007974|Ga0105747_1131830 | Not Available | 798 | Open in IMG/M |
| 3300007974|Ga0105747_1350826 | Not Available | 505 | Open in IMG/M |
| 3300007992|Ga0105748_10192710 | Not Available | 845 | Open in IMG/M |
| 3300008021|Ga0102922_1296669 | Not Available | 506 | Open in IMG/M |
| 3300008052|Ga0102893_1045830 | Not Available | 1329 | Open in IMG/M |
| 3300008052|Ga0102893_1175919 | Not Available | 622 | Open in IMG/M |
| 3300008055|Ga0108970_10114424 | Not Available | 527 | Open in IMG/M |
| 3300008055|Ga0108970_10151516 | All Organisms → Viruses → Predicted Viral | 3979 | Open in IMG/M |
| 3300008055|Ga0108970_10171715 | Not Available | 502 | Open in IMG/M |
| 3300008055|Ga0108970_10220725 | Not Available | 1769 | Open in IMG/M |
| 3300008055|Ga0108970_10496259 | Not Available | 662 | Open in IMG/M |
| 3300008055|Ga0108970_10823234 | All Organisms → Viruses → Predicted Viral | 2144 | Open in IMG/M |
| 3300008055|Ga0108970_11083323 | All Organisms → Viruses → Predicted Viral | 1240 | Open in IMG/M |
| 3300008055|Ga0108970_11519539 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5097 | Open in IMG/M |
| 3300008055|Ga0108970_11818663 | Not Available | 759 | Open in IMG/M |
| 3300008107|Ga0114340_1003079 | All Organisms → cellular organisms → Bacteria | 13648 | Open in IMG/M |
| 3300008107|Ga0114340_1007677 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5543 | Open in IMG/M |
| 3300008107|Ga0114340_1008225 | Not Available | 14053 | Open in IMG/M |
| 3300008107|Ga0114340_1008349 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5277 | Open in IMG/M |
| 3300008107|Ga0114340_1012959 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4072 | Open in IMG/M |
| 3300008107|Ga0114340_1024573 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2806 | Open in IMG/M |
| 3300008107|Ga0114340_1026365 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4716 | Open in IMG/M |
| 3300008107|Ga0114340_1027869 | All Organisms → Viruses → Predicted Viral | 3097 | Open in IMG/M |
| 3300008107|Ga0114340_1028559 | All Organisms → Viruses → Predicted Viral | 2573 | Open in IMG/M |
| 3300008107|Ga0114340_1028645 | Not Available | 2568 | Open in IMG/M |
| 3300008107|Ga0114340_1047448 | Not Available | 1896 | Open in IMG/M |
| 3300008107|Ga0114340_1048198 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1875 | Open in IMG/M |
| 3300008107|Ga0114340_1055121 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1726 | Open in IMG/M |
| 3300008107|Ga0114340_1059168 | Not Available | 1650 | Open in IMG/M |
| 3300008107|Ga0114340_1076046 | All Organisms → Viruses → Predicted Viral | 1399 | Open in IMG/M |
| 3300008107|Ga0114340_1077599 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1379 | Open in IMG/M |
| 3300008107|Ga0114340_1080200 | Not Available | 1350 | Open in IMG/M |
| 3300008107|Ga0114340_1107345 | All Organisms → Viruses → Predicted Viral | 1104 | Open in IMG/M |
| 3300008107|Ga0114340_1111711 | All Organisms → Viruses → Predicted Viral | 1073 | Open in IMG/M |
| 3300008107|Ga0114340_1119993 | Not Available | 1019 | Open in IMG/M |
| 3300008107|Ga0114340_1127489 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1546 | Open in IMG/M |
| 3300008107|Ga0114340_1129073 | Not Available | 965 | Open in IMG/M |
| 3300008107|Ga0114340_1139527 | Not Available | 910 | Open in IMG/M |
| 3300008107|Ga0114340_1144987 | All Organisms → cellular organisms → Bacteria | 883 | Open in IMG/M |
| 3300008107|Ga0114340_1148470 | Not Available | 867 | Open in IMG/M |
| 3300008107|Ga0114340_1167467 | Not Available | 787 | Open in IMG/M |
| 3300008107|Ga0114340_1198916 | Not Available | 675 | Open in IMG/M |
| 3300008107|Ga0114340_1206935 | Not Available | 651 | Open in IMG/M |
| 3300008107|Ga0114340_1209669 | Not Available | 642 | Open in IMG/M |
| 3300008107|Ga0114340_1215667 | Not Available | 625 | Open in IMG/M |
| 3300008107|Ga0114340_1220831 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 610 | Open in IMG/M |
| 3300008107|Ga0114340_1254789 | Not Available | 534 | Open in IMG/M |
| 3300008107|Ga0114340_1256549 | Not Available | 530 | Open in IMG/M |
| 3300008108|Ga0114341_10080474 | Not Available | 2025 | Open in IMG/M |
| 3300008108|Ga0114341_10127268 | All Organisms → Viruses → Predicted Viral | 2062 | Open in IMG/M |
| 3300008108|Ga0114341_10163391 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1281 | Open in IMG/M |
| 3300008108|Ga0114341_10196682 | All Organisms → Viruses → Predicted Viral | 1130 | Open in IMG/M |
| 3300008108|Ga0114341_10219514 | Not Available | 1047 | Open in IMG/M |
| 3300008108|Ga0114341_10232446 | Not Available | 1006 | Open in IMG/M |
| 3300008108|Ga0114341_10294217 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 848 | Open in IMG/M |
| 3300008108|Ga0114341_10381537 | Not Available | 692 | Open in IMG/M |
| 3300008108|Ga0114341_10410345 | Not Available | 652 | Open in IMG/M |
| 3300008108|Ga0114341_10495145 | Not Available | 554 | Open in IMG/M |
| 3300008108|Ga0114341_10545269 | Not Available | 512 | Open in IMG/M |
| 3300008110|Ga0114343_1011330 | All Organisms → Viruses → Predicted Viral | 4314 | Open in IMG/M |
| 3300008110|Ga0114343_1033429 | All Organisms → Viruses → Predicted Viral | 2124 | Open in IMG/M |
| 3300008110|Ga0114343_1062071 | All Organisms → Viruses → Predicted Viral | 1401 | Open in IMG/M |
| 3300008110|Ga0114343_1064910 | All Organisms → Viruses → Predicted Viral | 1359 | Open in IMG/M |
| 3300008110|Ga0114343_1089724 | All Organisms → Viruses → Predicted Viral | 1086 | Open in IMG/M |
| 3300008110|Ga0114343_1141611 | Not Available | 779 | Open in IMG/M |
| 3300008110|Ga0114343_1170251 | Not Available | 669 | Open in IMG/M |
| 3300008110|Ga0114343_1185930 | Not Available | 619 | Open in IMG/M |
| 3300008110|Ga0114343_1207529 | Not Available | 559 | Open in IMG/M |
| 3300008110|Ga0114343_1216562 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 539 | Open in IMG/M |
| 3300008111|Ga0114344_1133077 | Not Available | 869 | Open in IMG/M |
| 3300008111|Ga0114344_1134118 | Not Available | 864 | Open in IMG/M |
| 3300008111|Ga0114344_1177611 | Not Available | 700 | Open in IMG/M |
| 3300008111|Ga0114344_1180459 | Not Available | 691 | Open in IMG/M |
| 3300008113|Ga0114346_1002731 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 14622 | Open in IMG/M |
| 3300008113|Ga0114346_1013024 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5342 | Open in IMG/M |
| 3300008113|Ga0114346_1074911 | All Organisms → Viruses → Predicted Viral | 1612 | Open in IMG/M |
| 3300008113|Ga0114346_1111395 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1234 | Open in IMG/M |
| 3300008113|Ga0114346_1113478 | Not Available | 1218 | Open in IMG/M |
| 3300008113|Ga0114346_1120590 | Not Available | 1168 | Open in IMG/M |
| 3300008113|Ga0114346_1150313 | Not Available | 995 | Open in IMG/M |
| 3300008113|Ga0114346_1220056 | All Organisms → Viruses → Predicted Viral | 2139 | Open in IMG/M |
| 3300008113|Ga0114346_1266920 | Not Available | 621 | Open in IMG/M |
| 3300008114|Ga0114347_1174227 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1121 | Open in IMG/M |
| 3300008114|Ga0114347_1217971 | Not Available | 618 | Open in IMG/M |
| 3300008116|Ga0114350_1064648 | Not Available | 1272 | Open in IMG/M |
| 3300008116|Ga0114350_1122966 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 777 | Open in IMG/M |
| 3300008116|Ga0114350_1123088 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 776 | Open in IMG/M |
| 3300008116|Ga0114350_1142772 | Not Available | 682 | Open in IMG/M |
| 3300008116|Ga0114350_1192393 | Not Available | 512 | Open in IMG/M |
| 3300008117|Ga0114351_1045214 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5592 | Open in IMG/M |
| 3300008117|Ga0114351_1288725 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 784 | Open in IMG/M |
| 3300008117|Ga0114351_1406002 | Not Available | 576 | Open in IMG/M |
| 3300008118|Ga0114352_1075134 | Not Available | 700 | Open in IMG/M |
| 3300008118|Ga0114352_1094282 | Not Available | 623 | Open in IMG/M |
| 3300008119|Ga0114354_1003436 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 16598 | Open in IMG/M |
| 3300008120|Ga0114355_1144606 | Not Available | 854 | Open in IMG/M |
| 3300008120|Ga0114355_1154538 | Not Available | 808 | Open in IMG/M |
| 3300008120|Ga0114355_1156947 | Not Available | 798 | Open in IMG/M |
| 3300008120|Ga0114355_1160695 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 783 | Open in IMG/M |
| 3300008120|Ga0114355_1183883 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 697 | Open in IMG/M |
| 3300008120|Ga0114355_1221269 | Not Available | 585 | Open in IMG/M |
| 3300008122|Ga0114359_1234569 | Not Available | 648 | Open in IMG/M |
| 3300008258|Ga0114840_1021783 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1066 | Open in IMG/M |
| 3300008258|Ga0114840_1048540 | Not Available | 673 | Open in IMG/M |
| 3300008259|Ga0114841_1097415 | All Organisms → Viruses → Predicted Viral | 1535 | Open in IMG/M |
| 3300008261|Ga0114336_1005715 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 17834 | Open in IMG/M |
| 3300008261|Ga0114336_1009528 | Not Available | 6208 | Open in IMG/M |
| 3300008261|Ga0114336_1023918 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3919 | Open in IMG/M |
| 3300008261|Ga0114336_1045327 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2316 | Open in IMG/M |
| 3300008261|Ga0114336_1094518 | Not Available | 1865 | Open in IMG/M |
| 3300008261|Ga0114336_1376132 | Not Available | 500 | Open in IMG/M |
| 3300008262|Ga0114337_1038588 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2628 | Open in IMG/M |
| 3300008262|Ga0114337_1171660 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 915 | Open in IMG/M |
| 3300008266|Ga0114363_1039243 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4251 | Open in IMG/M |
| 3300008448|Ga0114876_1052476 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1831 | Open in IMG/M |
| 3300008448|Ga0114876_1228330 | Not Available | 600 | Open in IMG/M |
| 3300008448|Ga0114876_1232682 | Not Available | 589 | Open in IMG/M |
| 3300008450|Ga0114880_1101076 | All Organisms → Viruses → Predicted Viral | 1114 | Open in IMG/M |
| 3300008953|Ga0104241_1004177 | Not Available | 1039 | Open in IMG/M |
| 3300008953|Ga0104241_1006295 | Not Available | 833 | Open in IMG/M |
| 3300008953|Ga0104241_1015248 | Not Available | 522 | Open in IMG/M |
| 3300008962|Ga0104242_1001916 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4124 | Open in IMG/M |
| 3300008962|Ga0104242_1007125 | All Organisms → Viruses → Predicted Viral | 2011 | Open in IMG/M |
| 3300008962|Ga0104242_1028574 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 957 | Open in IMG/M |
| 3300008964|Ga0102889_1188830 | Not Available | 600 | Open in IMG/M |
| 3300008996|Ga0102831_1055893 | All Organisms → Viruses → Predicted Viral | 1321 | Open in IMG/M |
| 3300008996|Ga0102831_1060497 | All Organisms → Viruses → Predicted Viral | 1265 | Open in IMG/M |
| 3300008996|Ga0102831_1060562 | Not Available | 1265 | Open in IMG/M |
| 3300008996|Ga0102831_1107986 | Not Available | 926 | Open in IMG/M |
| 3300008996|Ga0102831_1300158 | Not Available | 531 | Open in IMG/M |
| 3300009026|Ga0102829_1015696 | Not Available | 2125 | Open in IMG/M |
| 3300009026|Ga0102829_1173577 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 695 | Open in IMG/M |
| 3300009026|Ga0102829_1292144 | Not Available | 541 | Open in IMG/M |
| 3300009026|Ga0102829_1315923 | Not Available | 522 | Open in IMG/M |
| 3300009050|Ga0102909_1064596 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 904 | Open in IMG/M |
| 3300009050|Ga0102909_1068244 | Not Available | 876 | Open in IMG/M |
| 3300009051|Ga0102864_1102209 | Not Available | 782 | Open in IMG/M |
| 3300009051|Ga0102864_1176751 | Not Available | 583 | Open in IMG/M |
| 3300009056|Ga0102860_1036118 | Not Available | 1310 | Open in IMG/M |
| 3300009058|Ga0102854_1168569 | Not Available | 627 | Open in IMG/M |
| 3300009058|Ga0102854_1242917 | Not Available | 517 | Open in IMG/M |
| 3300009059|Ga0102830_1252413 | Not Available | 515 | Open in IMG/M |
| 3300009068|Ga0114973_10002526 | Not Available | 13213 | Open in IMG/M |
| 3300009068|Ga0114973_10223578 | All Organisms → Viruses → Predicted Viral | 1022 | Open in IMG/M |
| 3300009068|Ga0114973_10510196 | Not Available | 622 | Open in IMG/M |
| 3300009068|Ga0114973_10543596 | Not Available | 599 | Open in IMG/M |
| 3300009068|Ga0114973_10642700 | Not Available | 542 | Open in IMG/M |
| 3300009079|Ga0102814_10730428 | Not Available | 545 | Open in IMG/M |
| 3300009086|Ga0102812_10308543 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 861 | Open in IMG/M |
| 3300009152|Ga0114980_10000254 | All Organisms → Viruses | 37749 | Open in IMG/M |
| 3300009152|Ga0114980_10002788 | Not Available | 12187 | Open in IMG/M |
| 3300009152|Ga0114980_10034058 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3140 | Open in IMG/M |
| 3300009152|Ga0114980_10266687 | Not Available | 998 | Open in IMG/M |
| 3300009152|Ga0114980_10293859 | Not Available | 943 | Open in IMG/M |
| 3300009154|Ga0114963_10000010 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae | 115658 | Open in IMG/M |
| 3300009155|Ga0114968_10052444 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2623 | Open in IMG/M |
| 3300009155|Ga0114968_10246564 | Not Available | 1016 | Open in IMG/M |
| 3300009155|Ga0114968_10401532 | Not Available | 748 | Open in IMG/M |
| 3300009158|Ga0114977_10000196 | Not Available | 39672 | Open in IMG/M |
| 3300009158|Ga0114977_10002042 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 13086 | Open in IMG/M |
| 3300009158|Ga0114977_10002498 | Not Available | 11804 | Open in IMG/M |
| 3300009159|Ga0114978_10064775 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2473 | Open in IMG/M |
| 3300009159|Ga0114978_10098495 | Not Available | 1933 | Open in IMG/M |
| 3300009159|Ga0114978_10149590 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1505 | Open in IMG/M |
| 3300009159|Ga0114978_10379725 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 850 | Open in IMG/M |
| 3300009159|Ga0114978_10390862 | Not Available | 834 | Open in IMG/M |
| 3300009159|Ga0114978_10522161 | Not Available | 695 | Open in IMG/M |
| 3300009161|Ga0114966_10092494 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2047 | Open in IMG/M |
| 3300009161|Ga0114966_10097828 | All Organisms → Viruses → Predicted Viral | 1978 | Open in IMG/M |
| 3300009161|Ga0114966_10098475 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1970 | Open in IMG/M |
| 3300009161|Ga0114966_10209000 | Not Available | 1230 | Open in IMG/M |
| 3300009161|Ga0114966_10357214 | Not Available | 867 | Open in IMG/M |
| 3300009163|Ga0114970_10637659 | Not Available | 570 | Open in IMG/M |
| 3300009164|Ga0114975_10001785 | Not Available | 14982 | Open in IMG/M |
| 3300009164|Ga0114975_10128447 | Not Available | 1458 | Open in IMG/M |
| 3300009164|Ga0114975_10129042 | All Organisms → Viruses → Predicted Viral | 1454 | Open in IMG/M |
| 3300009180|Ga0114979_10137413 | Not Available | 1500 | Open in IMG/M |
| 3300009180|Ga0114979_10177753 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1296 | Open in IMG/M |
| 3300009180|Ga0114979_10213264 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1166 | Open in IMG/M |
| 3300009181|Ga0114969_10001418 | Not Available | 20367 | Open in IMG/M |
| 3300009181|Ga0114969_10119528 | All Organisms → Viruses → Predicted Viral | 1681 | Open in IMG/M |
| 3300009181|Ga0114969_10312194 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 924 | Open in IMG/M |
| 3300009183|Ga0114974_10040298 | Not Available | 3176 | Open in IMG/M |
| 3300009183|Ga0114974_10213345 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1173 | Open in IMG/M |
| 3300009184|Ga0114976_10087131 | Not Available | 1794 | Open in IMG/M |
| 3300009184|Ga0114976_10220854 | Not Available | 1037 | Open in IMG/M |
| 3300009184|Ga0114976_10465420 | Not Available | 655 | Open in IMG/M |
| 3300009419|Ga0114982_1000061 | Not Available | 54120 | Open in IMG/M |
| 3300009419|Ga0114982_1007317 | Not Available | 4062 | Open in IMG/M |
| 3300009419|Ga0114982_1031747 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1711 | Open in IMG/M |
| 3300009419|Ga0114982_1058832 | All Organisms → Viruses → Predicted Viral | 1206 | Open in IMG/M |
| 3300009419|Ga0114982_1127373 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 785 | Open in IMG/M |
| 3300009419|Ga0114982_1131563 | Not Available | 772 | Open in IMG/M |
| 3300010160|Ga0114967_10362398 | Not Available | 730 | Open in IMG/M |
| 3300010312|Ga0102883_1116091 | Not Available | 772 | Open in IMG/M |
| 3300010312|Ga0102883_1144998 | Not Available | 680 | Open in IMG/M |
| 3300010312|Ga0102883_1235854 | Not Available | 514 | Open in IMG/M |
| 3300010354|Ga0129333_10069570 | All Organisms → Viruses → Predicted Viral | 3270 | Open in IMG/M |
| 3300010354|Ga0129333_10088469 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2865 | Open in IMG/M |
| 3300010354|Ga0129333_10169490 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1997 | Open in IMG/M |
| 3300010354|Ga0129333_10492417 | All Organisms → Viruses → Predicted Viral | 1075 | Open in IMG/M |
| 3300010370|Ga0129336_10120819 | Not Available | 1527 | Open in IMG/M |
| 3300010370|Ga0129336_10530957 | Not Available | 632 | Open in IMG/M |
| 3300010388|Ga0136551_1008415 | All Organisms → Viruses → Predicted Viral | 2204 | Open in IMG/M |
| 3300010388|Ga0136551_1037556 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 901 | Open in IMG/M |
| 3300010885|Ga0133913_10169208 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5837 | Open in IMG/M |
| 3300010885|Ga0133913_10868779 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2344 | Open in IMG/M |
| 3300010885|Ga0133913_12391403 | All Organisms → Viruses → Predicted Viral | 1293 | Open in IMG/M |
| 3300010885|Ga0133913_12592590 | All Organisms → Viruses → Predicted Viral | 1231 | Open in IMG/M |
| 3300010885|Ga0133913_12972858 | All Organisms → Viruses → Predicted Viral | 1132 | Open in IMG/M |
| 3300010965|Ga0138308_107392 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7413 | Open in IMG/M |
| 3300010965|Ga0138308_108266 | Not Available | 6819 | Open in IMG/M |
| 3300010965|Ga0138308_186999 | All Organisms → Viruses → Predicted Viral | 1105 | Open in IMG/M |
| 3300010970|Ga0137575_10002943 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3277 | Open in IMG/M |
| 3300011009|Ga0129318_10037157 | Not Available | 1193 | Open in IMG/M |
| 3300011010|Ga0139557_1009263 | All Organisms → Viruses → Predicted Viral | 1961 | Open in IMG/M |
| 3300011010|Ga0139557_1019454 | All Organisms → Viruses → Predicted Viral | 1251 | Open in IMG/M |
| 3300011011|Ga0139556_1026653 | Not Available | 843 | Open in IMG/M |
| 3300011268|Ga0151620_1098316 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 924 | Open in IMG/M |
| 3300011268|Ga0151620_1103342 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 897 | Open in IMG/M |
| 3300011268|Ga0151620_1219731 | Not Available | 570 | Open in IMG/M |
| 3300011268|Ga0151620_1253800 | Not Available | 522 | Open in IMG/M |
| 3300012000|Ga0119951_1060506 | Not Available | 1032 | Open in IMG/M |
| 3300012006|Ga0119955_1000509 | Not Available | 21186 | Open in IMG/M |
| 3300012012|Ga0153799_1055471 | Not Available | 725 | Open in IMG/M |
| 3300012017|Ga0153801_1005653 | Not Available | 2347 | Open in IMG/M |
| 3300012346|Ga0157141_1018740 | Not Available | 908 | Open in IMG/M |
| 3300012352|Ga0157138_1000621 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6991 | Open in IMG/M |
| 3300012352|Ga0157138_1031982 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 835 | Open in IMG/M |
| 3300012663|Ga0157203_1001411 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5879 | Open in IMG/M |
| 3300012663|Ga0157203_1001671 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5323 | Open in IMG/M |
| 3300012663|Ga0157203_1015508 | All Organisms → Viruses → Predicted Viral | 1175 | Open in IMG/M |
| 3300012663|Ga0157203_1022751 | Not Available | 907 | Open in IMG/M |
| 3300012663|Ga0157203_1050529 | Not Available | 563 | Open in IMG/M |
| 3300012663|Ga0157203_1055885 | Not Available | 532 | Open in IMG/M |
| 3300012665|Ga0157210_1000243 | Not Available | 26415 | Open in IMG/M |
| 3300012665|Ga0157210_1003003 | All Organisms → Viruses → Predicted Viral | 4053 | Open in IMG/M |
| 3300012665|Ga0157210_1005682 | All Organisms → Viruses → Predicted Viral | 2501 | Open in IMG/M |
| 3300012665|Ga0157210_1006040 | All Organisms → Viruses → Predicted Viral | 2386 | Open in IMG/M |
| 3300012665|Ga0157210_1019042 | All Organisms → Viruses → Predicted Viral | 1120 | Open in IMG/M |
| 3300012666|Ga0157498_1012898 | Not Available | 1321 | Open in IMG/M |
| 3300012666|Ga0157498_1017711 | All Organisms → Viruses → Predicted Viral | 1116 | Open in IMG/M |
| 3300012666|Ga0157498_1019371 | Not Available | 1061 | Open in IMG/M |
| 3300012666|Ga0157498_1027762 | Not Available | 878 | Open in IMG/M |
| 3300012667|Ga0157208_10001447 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5329 | Open in IMG/M |
| 3300012667|Ga0157208_10002665 | All Organisms → Viruses → Predicted Viral | 3375 | Open in IMG/M |
| 3300012667|Ga0157208_10003773 | All Organisms → Viruses → Predicted Viral | 2624 | Open in IMG/M |
| 3300012667|Ga0157208_10008049 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1545 | Open in IMG/M |
| 3300012711|Ga0157607_1069785 | Not Available | 1135 | Open in IMG/M |
| 3300012712|Ga0157598_1026611 | Not Available | 514 | Open in IMG/M |
| 3300012723|Ga0157604_1082141 | Not Available | 842 | Open in IMG/M |
| 3300012761|Ga0138288_1210314 | Not Available | 721 | Open in IMG/M |
| 3300012763|Ga0138289_1197104 | Not Available | 537 | Open in IMG/M |
| 3300012772|Ga0138287_1153590 | Not Available | 973 | Open in IMG/M |
| 3300012779|Ga0138284_1104252 | Not Available | 728 | Open in IMG/M |
| 3300012779|Ga0138284_1217774 | Not Available | 816 | Open in IMG/M |
| 3300012779|Ga0138284_1219230 | Not Available | 680 | Open in IMG/M |
| 3300013004|Ga0164293_10035778 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4095 | Open in IMG/M |
| 3300013004|Ga0164293_10125041 | Not Available | 1942 | Open in IMG/M |
| 3300013004|Ga0164293_10282603 | Not Available | 1157 | Open in IMG/M |
| 3300013004|Ga0164293_10350382 | Not Available | 1008 | Open in IMG/M |
| 3300013005|Ga0164292_10348507 | All Organisms → Viruses → Predicted Viral | 1000 | Open in IMG/M |
| 3300013005|Ga0164292_10583173 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 724 | Open in IMG/M |
| 3300013005|Ga0164292_10601541 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 710 | Open in IMG/M |
| 3300013005|Ga0164292_10830323 | Not Available | 583 | Open in IMG/M |
| 3300013006|Ga0164294_10106388 | All Organisms → Viruses → Predicted Viral | 2073 | Open in IMG/M |
| 3300013014|Ga0164295_10100810 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2143 | Open in IMG/M |
| 3300013092|Ga0163199_1142351 | Not Available | 974 | Open in IMG/M |
| 3300013092|Ga0163199_1390496 | Not Available | 517 | Open in IMG/M |
| 3300013372|Ga0177922_10131355 | Not Available | 677 | Open in IMG/M |
| 3300013372|Ga0177922_10819731 | Not Available | 909 | Open in IMG/M |
| 3300013372|Ga0177922_10892113 | Not Available | 502 | Open in IMG/M |
| 3300013372|Ga0177922_11242976 | Not Available | 1861 | Open in IMG/M |
| 3300014050|Ga0119952_1021812 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2123 | Open in IMG/M |
| 3300014962|Ga0134315_1048049 | Not Available | 657 | Open in IMG/M |
| 3300017701|Ga0181364_1005861 | All Organisms → Viruses → Predicted Viral | 2118 | Open in IMG/M |
| 3300017761|Ga0181356_1118969 | Not Available | 845 | Open in IMG/M |
| 3300017766|Ga0181343_1051873 | Not Available | 1206 | Open in IMG/M |
| 3300017766|Ga0181343_1121303 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 735 | Open in IMG/M |
| 3300017766|Ga0181343_1172599 | Not Available | 598 | Open in IMG/M |
| 3300017766|Ga0181343_1231531 | Not Available | 501 | Open in IMG/M |
| 3300017778|Ga0181349_1211216 | Not Available | 666 | Open in IMG/M |
| 3300017785|Ga0181355_1053149 | Not Available | 1718 | Open in IMG/M |
| 3300018775|Ga0188848_1038437 | Not Available | 500 | Open in IMG/M |
| 3300019146|Ga0188881_10005993 | All Organisms → Viruses → Predicted Viral | 1470 | Open in IMG/M |
| 3300019146|Ga0188881_10018272 | Not Available | 871 | Open in IMG/M |
| 3300019784|Ga0181359_1051332 | Not Available | 1590 | Open in IMG/M |
| 3300019784|Ga0181359_1075466 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1271 | Open in IMG/M |
| 3300019784|Ga0181359_1083756 | Not Available | 1191 | Open in IMG/M |
| 3300019784|Ga0181359_1100351 | All Organisms → Viruses → Predicted Viral | 1062 | Open in IMG/M |
| 3300019784|Ga0181359_1127079 | Not Available | 904 | Open in IMG/M |
| 3300019784|Ga0181359_1270191 | Not Available | 505 | Open in IMG/M |
| 3300020048|Ga0207193_1029384 | Not Available | 6418 | Open in IMG/M |
| 3300020048|Ga0207193_1033106 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5895 | Open in IMG/M |
| 3300020048|Ga0207193_1057014 | All Organisms → Viruses → Predicted Viral | 3992 | Open in IMG/M |
| 3300020048|Ga0207193_1389501 | Not Available | 935 | Open in IMG/M |
| 3300020048|Ga0207193_1778405 | Not Available | 613 | Open in IMG/M |
| 3300020141|Ga0211732_1021558 | Not Available | 567 | Open in IMG/M |
| 3300020141|Ga0211732_1054525 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9484 | Open in IMG/M |
| 3300020141|Ga0211732_1205367 | Not Available | 1350 | Open in IMG/M |
| 3300020141|Ga0211732_1245054 | Not Available | 933 | Open in IMG/M |
| 3300020141|Ga0211732_1288974 | All Organisms → Viruses → Predicted Viral | 4406 | Open in IMG/M |
| 3300020141|Ga0211732_1341262 | Not Available | 1004 | Open in IMG/M |
| 3300020141|Ga0211732_1445911 | Not Available | 640 | Open in IMG/M |
| 3300020141|Ga0211732_1536763 | All Organisms → Viruses → Predicted Viral | 2448 | Open in IMG/M |
| 3300020151|Ga0211736_10029885 | Not Available | 696 | Open in IMG/M |
| 3300020151|Ga0211736_10051323 | Not Available | 904 | Open in IMG/M |
| 3300020151|Ga0211736_10198849 | All Organisms → Viruses → Predicted Viral | 1305 | Open in IMG/M |
| 3300020151|Ga0211736_11013769 | Not Available | 1164 | Open in IMG/M |
| 3300020159|Ga0211734_10093806 | Not Available | 823 | Open in IMG/M |
| 3300020159|Ga0211734_10507253 | Not Available | 1394 | Open in IMG/M |
| 3300020159|Ga0211734_10585049 | All Organisms → Viruses → Predicted Viral | 2670 | Open in IMG/M |
| 3300020159|Ga0211734_10941120 | Not Available | 520 | Open in IMG/M |
| 3300020159|Ga0211734_11102215 | All Organisms → Viruses → Predicted Viral | 1777 | Open in IMG/M |
| 3300020159|Ga0211734_11109833 | Not Available | 532 | Open in IMG/M |
| 3300020159|Ga0211734_11270924 | Not Available | 1484 | Open in IMG/M |
| 3300020160|Ga0211733_10247758 | All Organisms → Viruses → Predicted Viral | 1599 | Open in IMG/M |
| 3300020160|Ga0211733_10793729 | Not Available | 518 | Open in IMG/M |
| 3300020161|Ga0211726_10133432 | Not Available | 2470 | Open in IMG/M |
| 3300020161|Ga0211726_10173845 | Not Available | 875 | Open in IMG/M |
| 3300020161|Ga0211726_10416811 | All Organisms → Viruses → Predicted Viral | 1573 | Open in IMG/M |
| 3300020161|Ga0211726_10705071 | Not Available | 1431 | Open in IMG/M |
| 3300020161|Ga0211726_10816379 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5713 | Open in IMG/M |
| 3300020162|Ga0211735_10231876 | All Organisms → Viruses → Predicted Viral | 2648 | Open in IMG/M |
| 3300020172|Ga0211729_10278362 | All Organisms → Viruses → Predicted Viral | 4794 | Open in IMG/M |
| 3300020172|Ga0211729_10419800 | Not Available | 685 | Open in IMG/M |
| 3300020172|Ga0211729_11168916 | Not Available | 1255 | Open in IMG/M |
| 3300020172|Ga0211729_11321185 | Not Available | 565 | Open in IMG/M |
| 3300020205|Ga0211731_10691159 | Not Available | 1036 | Open in IMG/M |
| 3300020205|Ga0211731_11202395 | Not Available | 940 | Open in IMG/M |
| 3300020480|Ga0208201_105812 | Not Available | 1004 | Open in IMG/M |
| 3300020490|Ga0208052_104899 | All Organisms → Viruses → Predicted Viral | 1162 | Open in IMG/M |
| 3300020492|Ga0208483_1022228 | Not Available | 712 | Open in IMG/M |
| 3300020494|Ga0208326_101472 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2058 | Open in IMG/M |
| 3300020494|Ga0208326_113322 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 763 | Open in IMG/M |
| 3300020498|Ga0208050_1000020 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 60220 | Open in IMG/M |
| 3300020498|Ga0208050_1000109 | Not Available | 19457 | Open in IMG/M |
| 3300020498|Ga0208050_1001191 | All Organisms → Viruses → Predicted Viral | 3721 | Open in IMG/M |
| 3300020498|Ga0208050_1002953 | All Organisms → Viruses → Predicted Viral | 2221 | Open in IMG/M |
| 3300020498|Ga0208050_1009349 | All Organisms → Viruses → Predicted Viral | 1124 | Open in IMG/M |
| 3300020498|Ga0208050_1010110 | Not Available | 1068 | Open in IMG/M |
| 3300020498|Ga0208050_1012275 | Not Available | 942 | Open in IMG/M |
| 3300020498|Ga0208050_1023027 | Not Available | 639 | Open in IMG/M |
| 3300020513|Ga0208090_1000488 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7127 | Open in IMG/M |
| 3300020514|Ga0208202_1025625 | Not Available | 670 | Open in IMG/M |
| 3300020519|Ga0208223_1006345 | All Organisms → Viruses → Predicted Viral | 2061 | Open in IMG/M |
| 3300020519|Ga0208223_1008387 | Not Available | 1717 | Open in IMG/M |
| 3300020524|Ga0208858_1003253 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2943 | Open in IMG/M |
| 3300020529|Ga0208233_1000039 | Not Available | 23657 | Open in IMG/M |
| 3300020530|Ga0208235_1007283 | All Organisms → Viruses → Predicted Viral | 1464 | Open in IMG/M |
| 3300020533|Ga0208364_1000171 | Not Available | 15574 | Open in IMG/M |
| 3300020537|Ga0208722_1016019 | Not Available | 1226 | Open in IMG/M |
| 3300020541|Ga0208359_1000136 | Not Available | 14971 | Open in IMG/M |
| 3300020549|Ga0207942_1005267 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1874 | Open in IMG/M |
| 3300020549|Ga0207942_1011835 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1154 | Open in IMG/M |
| 3300020549|Ga0207942_1012119 | Not Available | 1138 | Open in IMG/M |
| 3300020551|Ga0208360_1010599 | Not Available | 1314 | Open in IMG/M |
| 3300020551|Ga0208360_1012570 | Not Available | 1182 | Open in IMG/M |
| 3300020557|Ga0208231_1004395 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2807 | Open in IMG/M |
| 3300020557|Ga0208231_1005012 | Not Available | 2594 | Open in IMG/M |
| 3300020562|Ga0208597_1015772 | All Organisms → Viruses → Predicted Viral | 1839 | Open in IMG/M |
| 3300020564|Ga0208719_1045521 | Not Available | 803 | Open in IMG/M |
| 3300020570|Ga0208465_1051626 | Not Available | 517 | Open in IMG/M |
| 3300020572|Ga0207909_1016499 | Not Available | 1378 | Open in IMG/M |
| 3300020572|Ga0207909_1020697 | Not Available | 1187 | Open in IMG/M |
| 3300020575|Ga0208053_1052991 | Not Available | 760 | Open in IMG/M |
| 3300021438|Ga0213920_1026092 | Not Available | 1375 | Open in IMG/M |
| 3300021438|Ga0213920_1039508 | All Organisms → Viruses → Predicted Viral | 1025 | Open in IMG/M |
| 3300021519|Ga0194048_10015548 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3383 | Open in IMG/M |
| 3300021519|Ga0194048_10017001 | All Organisms → Viruses → Predicted Viral | 3210 | Open in IMG/M |
| 3300021519|Ga0194048_10079173 | Not Available | 1283 | Open in IMG/M |
| 3300021952|Ga0213921_1061905 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 533 | Open in IMG/M |
| 3300021952|Ga0213921_1066289 | Not Available | 510 | Open in IMG/M |
| 3300021956|Ga0213922_1054301 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 882 | Open in IMG/M |
| 3300021956|Ga0213922_1097969 | Not Available | 594 | Open in IMG/M |
| 3300021961|Ga0222714_10021604 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5008 | Open in IMG/M |
| 3300021961|Ga0222714_10051755 | All Organisms → Viruses → Predicted Viral | 2839 | Open in IMG/M |
| 3300021961|Ga0222714_10063544 | All Organisms → Viruses → Predicted Viral | 2481 | Open in IMG/M |
| 3300021961|Ga0222714_10072283 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2280 | Open in IMG/M |
| 3300021961|Ga0222714_10099373 | All Organisms → Viruses → Predicted Viral | 1845 | Open in IMG/M |
| 3300021961|Ga0222714_10120858 | All Organisms → Viruses → Predicted Viral | 1618 | Open in IMG/M |
| 3300021961|Ga0222714_10150891 | Not Available | 1395 | Open in IMG/M |
| 3300021961|Ga0222714_10161316 | All Organisms → Viruses → Predicted Viral | 1333 | Open in IMG/M |
| 3300021961|Ga0222714_10184498 | Not Available | 1218 | Open in IMG/M |
| 3300021961|Ga0222714_10237646 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1029 | Open in IMG/M |
| 3300021961|Ga0222714_10318767 | Not Available | 846 | Open in IMG/M |
| 3300021961|Ga0222714_10475734 | Not Available | 645 | Open in IMG/M |
| 3300021961|Ga0222714_10545259 | Not Available | 588 | Open in IMG/M |
| 3300021961|Ga0222714_10631310 | Not Available | 531 | Open in IMG/M |
| 3300021961|Ga0222714_10685690 | Not Available | 502 | Open in IMG/M |
| 3300021962|Ga0222713_10010034 | Not Available | 8565 | Open in IMG/M |
| 3300021962|Ga0222713_10056026 | All Organisms → Viruses → Predicted Viral | 2985 | Open in IMG/M |
| 3300021962|Ga0222713_10066632 | All Organisms → Viruses → Predicted Viral | 2680 | Open in IMG/M |
| 3300021962|Ga0222713_10105943 | All Organisms → Viruses → Predicted Viral | 2006 | Open in IMG/M |
| 3300021962|Ga0222713_10127121 | Not Available | 1790 | Open in IMG/M |
| 3300021962|Ga0222713_10133242 | All Organisms → Viruses → Predicted Viral | 1737 | Open in IMG/M |
| 3300021962|Ga0222713_10200034 | Not Available | 1337 | Open in IMG/M |
| 3300021962|Ga0222713_10336189 | Not Available | 949 | Open in IMG/M |
| 3300021962|Ga0222713_10370327 | Not Available | 890 | Open in IMG/M |
| 3300021962|Ga0222713_10446641 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 785 | Open in IMG/M |
| 3300021962|Ga0222713_10447308 | Not Available | 784 | Open in IMG/M |
| 3300021962|Ga0222713_10555234 | Not Available | 677 | Open in IMG/M |
| 3300021962|Ga0222713_10592049 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 648 | Open in IMG/M |
| 3300021962|Ga0222713_10694914 | Not Available | 581 | Open in IMG/M |
| 3300021962|Ga0222713_10736742 | Not Available | 557 | Open in IMG/M |
| 3300021963|Ga0222712_10016365 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6367 | Open in IMG/M |
| 3300021963|Ga0222712_10048858 | All Organisms → Viruses → Predicted Viral | 3176 | Open in IMG/M |
| 3300021963|Ga0222712_10091645 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2147 | Open in IMG/M |
| 3300021963|Ga0222712_10129989 | All Organisms → Viruses → Predicted Viral | 1724 | Open in IMG/M |
| 3300021963|Ga0222712_10142274 | Not Available | 1628 | Open in IMG/M |
| 3300021963|Ga0222712_10305448 | Not Available | 996 | Open in IMG/M |
| 3300021963|Ga0222712_10433457 | Not Available | 791 | Open in IMG/M |
| 3300021963|Ga0222712_10483236 | Not Available | 736 | Open in IMG/M |
| 3300021963|Ga0222712_10537870 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 684 | Open in IMG/M |
| 3300021963|Ga0222712_10666163 | Not Available | 591 | Open in IMG/M |
| 3300021963|Ga0222712_10748999 | Not Available | 544 | Open in IMG/M |
| 3300021963|Ga0222712_10825527 | Not Available | 508 | Open in IMG/M |
| 3300022190|Ga0181354_1118311 | Not Available | 853 | Open in IMG/M |
| 3300022190|Ga0181354_1227753 | Not Available | 542 | Open in IMG/M |
| 3300022407|Ga0181351_1075612 | All Organisms → Viruses → Predicted Viral | 1354 | Open in IMG/M |
| 3300022407|Ga0181351_1087458 | All Organisms → Viruses → Predicted Viral | 1229 | Open in IMG/M |
| 3300022407|Ga0181351_1101215 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1113 | Open in IMG/M |
| 3300022553|Ga0212124_10128340 | Not Available | 1408 | Open in IMG/M |
| 3300022553|Ga0212124_10131607 | Not Available | 1387 | Open in IMG/M |
| 3300022748|Ga0228702_1116246 | Not Available | 612 | Open in IMG/M |
| 3300022752|Ga0214917_10006047 | Not Available | 12715 | Open in IMG/M |
| 3300022752|Ga0214917_10282715 | Not Available | 750 | Open in IMG/M |
| 3300023174|Ga0214921_10000248 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae | 107027 | Open in IMG/M |
| 3300023174|Ga0214921_10001139 | Not Available | 46199 | Open in IMG/M |
| 3300023174|Ga0214921_10005138 | Not Available | 18694 | Open in IMG/M |
| 3300023174|Ga0214921_10070500 | All Organisms → Viruses → Predicted Viral | 2855 | Open in IMG/M |
| 3300023174|Ga0214921_10102769 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2136 | Open in IMG/M |
| 3300023174|Ga0214921_10139993 | All Organisms → Viruses → Predicted Viral | 1676 | Open in IMG/M |
| 3300023174|Ga0214921_10228282 | All Organisms → Viruses → Predicted Viral | 1122 | Open in IMG/M |
| 3300023174|Ga0214921_10242499 | All Organisms → Viruses → Predicted Viral | 1067 | Open in IMG/M |
| 3300023174|Ga0214921_10316545 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 856 | Open in IMG/M |
| 3300023184|Ga0214919_10000994 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 47901 | Open in IMG/M |
| 3300023184|Ga0214919_10005931 | Not Available | 17012 | Open in IMG/M |
| 3300023184|Ga0214919_10117406 | All Organisms → Viruses → Predicted Viral | 2208 | Open in IMG/M |
| 3300023184|Ga0214919_10208397 | Not Available | 1456 | Open in IMG/M |
| 3300023184|Ga0214919_10224477 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1377 | Open in IMG/M |
| 3300023184|Ga0214919_10668547 | Not Available | 596 | Open in IMG/M |
| 3300024289|Ga0255147_1051051 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 803 | Open in IMG/M |
| 3300024306|Ga0255148_1070984 | Not Available | 601 | Open in IMG/M |
| 3300024343|Ga0244777_10000630 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 27401 | Open in IMG/M |
| 3300024343|Ga0244777_10002138 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 13731 | Open in IMG/M |
| 3300024343|Ga0244777_10002688 | Not Available | 12106 | Open in IMG/M |
| 3300024343|Ga0244777_10013132 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5227 | Open in IMG/M |
| 3300024343|Ga0244777_10394584 | Not Available | 862 | Open in IMG/M |
| 3300024343|Ga0244777_10557405 | Not Available | 698 | Open in IMG/M |
| 3300024343|Ga0244777_10593148 | Not Available | 672 | Open in IMG/M |
| 3300024346|Ga0244775_10000092 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae | 113108 | Open in IMG/M |
| 3300024346|Ga0244775_10000125 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 97139 | Open in IMG/M |
| 3300024346|Ga0244775_10000885 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 36159 | Open in IMG/M |
| 3300024346|Ga0244775_10003798 | Not Available | 15978 | Open in IMG/M |
| 3300024346|Ga0244775_10022570 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5694 | Open in IMG/M |
| 3300024346|Ga0244775_10024089 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5482 | Open in IMG/M |
| 3300024346|Ga0244775_10061303 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3246 | Open in IMG/M |
| 3300024346|Ga0244775_10068712 | All Organisms → Viruses → Predicted Viral | 3042 | Open in IMG/M |
| 3300024346|Ga0244775_10094857 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2539 | Open in IMG/M |
| 3300024346|Ga0244775_10124369 | All Organisms → Viruses → Predicted Viral | 2184 | Open in IMG/M |
| 3300024346|Ga0244775_10199240 | All Organisms → Viruses → Predicted Viral | 1680 | Open in IMG/M |
| 3300024346|Ga0244775_10201621 | All Organisms → Viruses → Predicted Viral | 1669 | Open in IMG/M |
| 3300024346|Ga0244775_10216233 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1604 | Open in IMG/M |
| 3300024346|Ga0244775_10235866 | All Organisms → Viruses → Predicted Viral | 1527 | Open in IMG/M |
| 3300024346|Ga0244775_10236951 | All Organisms → Viruses → Predicted Viral | 1523 | Open in IMG/M |
| 3300024346|Ga0244775_10236982 | Not Available | 1523 | Open in IMG/M |
| 3300024346|Ga0244775_10253081 | Not Available | 1467 | Open in IMG/M |
| 3300024346|Ga0244775_10291812 | All Organisms → Viruses → Predicted Viral | 1353 | Open in IMG/M |
| 3300024346|Ga0244775_10346470 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1227 | Open in IMG/M |
| 3300024346|Ga0244775_10359799 | All Organisms → Viruses → Predicted Viral | 1200 | Open in IMG/M |
| 3300024346|Ga0244775_10407764 | Not Available | 1117 | Open in IMG/M |
| 3300024346|Ga0244775_10415538 | Not Available | 1105 | Open in IMG/M |
| 3300024346|Ga0244775_10454817 | Not Available | 1049 | Open in IMG/M |
| 3300024346|Ga0244775_10485321 | All Organisms → Viruses → Predicted Viral | 1010 | Open in IMG/M |
| 3300024346|Ga0244775_10508615 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 983 | Open in IMG/M |
| 3300024346|Ga0244775_10688523 | Not Available | 824 | Open in IMG/M |
| 3300024346|Ga0244775_10747420 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 785 | Open in IMG/M |
| 3300024346|Ga0244775_10783976 | Not Available | 763 | Open in IMG/M |
| 3300024346|Ga0244775_10950218 | Not Available | 680 | Open in IMG/M |
| 3300024346|Ga0244775_10962253 | Not Available | 675 | Open in IMG/M |
| 3300024346|Ga0244775_11082195 | Not Available | 629 | Open in IMG/M |
| 3300024346|Ga0244775_11499195 | Not Available | 516 | Open in IMG/M |
| 3300024348|Ga0244776_10001119 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 29341 | Open in IMG/M |
| 3300024348|Ga0244776_10051215 | Not Available | 3222 | Open in IMG/M |
| 3300024348|Ga0244776_10085262 | All Organisms → Viruses → Predicted Viral | 2390 | Open in IMG/M |
| 3300024348|Ga0244776_10090623 | All Organisms → Viruses → Predicted Viral | 2304 | Open in IMG/M |
| 3300024348|Ga0244776_10405703 | Not Available | 903 | Open in IMG/M |
| 3300024348|Ga0244776_10641662 | Not Available | 664 | Open in IMG/M |
| 3300024483|Ga0255224_1037284 | Not Available | 990 | Open in IMG/M |
| 3300024490|Ga0255185_1028153 | Not Available | 793 | Open in IMG/M |
| 3300024533|Ga0256299_1013808 | All Organisms → Viruses → Predicted Viral | 1485 | Open in IMG/M |
| 3300024537|Ga0255225_1001359 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2903 | Open in IMG/M |
| 3300024564|Ga0255237_1109190 | Not Available | 629 | Open in IMG/M |
| 3300024571|Ga0256302_1051756 | Not Available | 964 | Open in IMG/M |
| 3300025585|Ga0208546_1022630 | All Organisms → Viruses → Predicted Viral | 1580 | Open in IMG/M |
| 3300025585|Ga0208546_1036772 | Not Available | 1189 | Open in IMG/M |
| 3300025585|Ga0208546_1056405 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 926 | Open in IMG/M |
| 3300025744|Ga0255245_1031600 | Not Available | 667 | Open in IMG/M |
| 3300026457|Ga0255160_1072947 | Not Available | 566 | Open in IMG/M |
| 3300026931|Ga0209850_1020500 | Not Available | 542 | Open in IMG/M |
| 3300027114|Ga0208009_1032873 | All Organisms → Viruses → Predicted Viral | 1069 | Open in IMG/M |
| 3300027114|Ga0208009_1050444 | Not Available | 781 | Open in IMG/M |
| 3300027121|Ga0255074_1011213 | Not Available | 1193 | Open in IMG/M |
| 3300027121|Ga0255074_1026195 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 729 | Open in IMG/M |
| 3300027127|Ga0255071_1003026 | All Organisms → Viruses → Predicted Viral | 3029 | Open in IMG/M |
| 3300027127|Ga0255071_1013609 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1317 | Open in IMG/M |
| 3300027129|Ga0255067_1055021 | Not Available | 568 | Open in IMG/M |
| 3300027131|Ga0255066_1013367 | All Organisms → Viruses → Predicted Viral | 1228 | Open in IMG/M |
| 3300027132|Ga0255110_1052938 | Not Available | 639 | Open in IMG/M |
| 3300027133|Ga0255070_1005132 | All Organisms → Viruses → Predicted Viral | 2484 | Open in IMG/M |
| 3300027138|Ga0255064_1003757 | All Organisms → Viruses → Predicted Viral | 2913 | Open in IMG/M |
| 3300027139|Ga0255082_1020399 | All Organisms → Viruses → Predicted Viral | 1104 | Open in IMG/M |
| 3300027140|Ga0255080_1010304 | All Organisms → Viruses → Predicted Viral | 1643 | Open in IMG/M |
| 3300027140|Ga0255080_1026103 | Not Available | 946 | Open in IMG/M |
| 3300027140|Ga0255080_1064104 | Not Available | 563 | Open in IMG/M |
| 3300027142|Ga0255065_1030000 | Not Available | 1031 | Open in IMG/M |
| 3300027150|Ga0255112_1092969 | Not Available | 556 | Open in IMG/M |
| 3300027151|Ga0255063_1013545 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1771 | Open in IMG/M |
| 3300027188|Ga0208921_1004092 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2520 | Open in IMG/M |
| 3300027193|Ga0208800_1020542 | Not Available | 872 | Open in IMG/M |
| 3300027203|Ga0208925_116895 | Not Available | 525 | Open in IMG/M |
| 3300027206|Ga0208023_1000188 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 14062 | Open in IMG/M |
| 3300027212|Ga0208554_1001902 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3394 | Open in IMG/M |
| 3300027212|Ga0208554_1065542 | Not Available | 565 | Open in IMG/M |
| 3300027215|Ga0208166_1014550 | Not Available | 928 | Open in IMG/M |
| 3300027219|Ga0208167_1077075 | Not Available | 536 | Open in IMG/M |
| 3300027224|Ga0208164_1054599 | Not Available | 710 | Open in IMG/M |
| 3300027224|Ga0208164_1067686 | Not Available | 622 | Open in IMG/M |
| 3300027237|Ga0208930_1042586 | Not Available | 623 | Open in IMG/M |
| 3300027238|Ga0208808_1011482 | Not Available | 1229 | Open in IMG/M |
| 3300027239|Ga0208807_1058724 | Not Available | 518 | Open in IMG/M |
| 3300027246|Ga0208931_1012673 | Not Available | 1807 | Open in IMG/M |
| 3300027246|Ga0208931_1039040 | Not Available | 935 | Open in IMG/M |
| 3300027247|Ga0208679_1051898 | Not Available | 769 | Open in IMG/M |
| 3300027255|Ga0208681_1039337 | Not Available | 875 | Open in IMG/M |
| 3300027293|Ga0255132_1111515 | Not Available | 542 | Open in IMG/M |
| 3300027337|Ga0255087_1048893 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 801 | Open in IMG/M |
| 3300027365|Ga0209300_1009946 | All Organisms → Viruses → Predicted Viral | 2619 | Open in IMG/M |
| 3300027418|Ga0208022_1131728 | Not Available | 500 | Open in IMG/M |
| 3300027488|Ga0255084_1055056 | Not Available | 708 | Open in IMG/M |
| 3300027492|Ga0255093_1051106 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 803 | Open in IMG/M |
| 3300027518|Ga0208787_1156844 | Not Available | 505 | Open in IMG/M |
| 3300027529|Ga0255077_1067984 | Not Available | 666 | Open in IMG/M |
| 3300027563|Ga0209552_1000209 | Not Available | 18535 | Open in IMG/M |
| 3300027563|Ga0209552_1003475 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5079 | Open in IMG/M |
| 3300027563|Ga0209552_1037207 | Not Available | 1414 | Open in IMG/M |
| 3300027563|Ga0209552_1039371 | Not Available | 1367 | Open in IMG/M |
| 3300027563|Ga0209552_1047076 | Not Available | 1231 | Open in IMG/M |
| 3300027563|Ga0209552_1162032 | Not Available | 571 | Open in IMG/M |
| 3300027563|Ga0209552_1183196 | Not Available | 526 | Open in IMG/M |
| 3300027578|Ga0255075_1027931 | Not Available | 1074 | Open in IMG/M |
| 3300027586|Ga0208966_1014813 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2311 | Open in IMG/M |
| 3300027586|Ga0208966_1018180 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2069 | Open in IMG/M |
| 3300027586|Ga0208966_1027100 | Not Available | 1678 | Open in IMG/M |
| 3300027586|Ga0208966_1110276 | Not Available | 750 | Open in IMG/M |
| 3300027608|Ga0208974_1013699 | All Organisms → Viruses → Predicted Viral | 2586 | Open in IMG/M |
| 3300027608|Ga0208974_1050106 | All Organisms → Viruses → Predicted Viral | 1202 | Open in IMG/M |
| 3300027608|Ga0208974_1091607 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 820 | Open in IMG/M |
| 3300027608|Ga0208974_1142946 | Not Available | 612 | Open in IMG/M |
| 3300027608|Ga0208974_1171645 | Not Available | 538 | Open in IMG/M |
| 3300027621|Ga0208951_1000455 | Not Available | 18780 | Open in IMG/M |
| 3300027621|Ga0208951_1147560 | Not Available | 615 | Open in IMG/M |
| 3300027627|Ga0208942_1090330 | Not Available | 883 | Open in IMG/M |
| 3300027631|Ga0208133_1000144 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 27624 | Open in IMG/M |
| 3300027631|Ga0208133_1047943 | All Organisms → Viruses → Predicted Viral | 1037 | Open in IMG/M |
| 3300027631|Ga0208133_1091045 | Not Available | 715 | Open in IMG/M |
| 3300027644|Ga0209356_1012819 | Not Available | 2920 | Open in IMG/M |
| 3300027644|Ga0209356_1065514 | Not Available | 1105 | Open in IMG/M |
| 3300027644|Ga0209356_1086313 | Not Available | 928 | Open in IMG/M |
| 3300027649|Ga0208960_1158573 | Not Available | 556 | Open in IMG/M |
| 3300027656|Ga0209357_1133050 | Not Available | 674 | Open in IMG/M |
| 3300027656|Ga0209357_1147676 | Not Available | 629 | Open in IMG/M |
| 3300027659|Ga0208975_1018531 | All Organisms → Viruses → Predicted Viral | 2307 | Open in IMG/M |
| 3300027659|Ga0208975_1040945 | Not Available | 1448 | Open in IMG/M |
| 3300027659|Ga0208975_1043285 | Not Available | 1401 | Open in IMG/M |
| 3300027659|Ga0208975_1055272 | All Organisms → Viruses → Predicted Viral | 1211 | Open in IMG/M |
| 3300027659|Ga0208975_1056311 | All Organisms → Viruses → Predicted Viral | 1197 | Open in IMG/M |
| 3300027679|Ga0209769_1043263 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1533 | Open in IMG/M |
| 3300027679|Ga0209769_1081405 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1061 | Open in IMG/M |
| 3300027689|Ga0209551_1025377 | All Organisms → Viruses → Predicted Viral | 2000 | Open in IMG/M |
| 3300027689|Ga0209551_1032273 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1760 | Open in IMG/M |
| 3300027689|Ga0209551_1073510 | Not Available | 1120 | Open in IMG/M |
| 3300027689|Ga0209551_1149553 | Not Available | 734 | Open in IMG/M |
| 3300027689|Ga0209551_1193698 | Not Available | 625 | Open in IMG/M |
| 3300027697|Ga0209033_1011074 | All Organisms → Viruses → Predicted Viral | 3990 | Open in IMG/M |
| 3300027697|Ga0209033_1027654 | All Organisms → Viruses → Predicted Viral | 2215 | Open in IMG/M |
| 3300027697|Ga0209033_1028205 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2185 | Open in IMG/M |
| 3300027697|Ga0209033_1119226 | Not Available | 849 | Open in IMG/M |
| 3300027697|Ga0209033_1173895 | Not Available | 657 | Open in IMG/M |
| 3300027710|Ga0209599_10000387 | Not Available | 29316 | Open in IMG/M |
| 3300027710|Ga0209599_10000956 | Not Available | 15440 | Open in IMG/M |
| 3300027710|Ga0209599_10007716 | Not Available | 3483 | Open in IMG/M |
| 3300027710|Ga0209599_10042879 | All Organisms → Viruses → Predicted Viral | 1206 | Open in IMG/M |
| 3300027720|Ga0209617_10021604 | Not Available | 2816 | Open in IMG/M |
| 3300027720|Ga0209617_10331455 | Not Available | 565 | Open in IMG/M |
| 3300027720|Ga0209617_10346218 | Not Available | 549 | Open in IMG/M |
| 3300027732|Ga0209442_1323232 | Not Available | 525 | Open in IMG/M |
| 3300027733|Ga0209297_1000035 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae | 115006 | Open in IMG/M |
| 3300027733|Ga0209297_1000053 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 93676 | Open in IMG/M |
| 3300027734|Ga0209087_1111322 | Not Available | 1146 | Open in IMG/M |
| 3300027734|Ga0209087_1132974 | Not Available | 1017 | Open in IMG/M |
| 3300027741|Ga0209085_1000015 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae | 115655 | Open in IMG/M |
| 3300027744|Ga0209355_1000088 | Not Available | 52348 | Open in IMG/M |
| 3300027753|Ga0208305_10358729 | Not Available | 504 | Open in IMG/M |
| 3300027754|Ga0209596_1001143 | Not Available | 23372 | Open in IMG/M |
| 3300027754|Ga0209596_1007610 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7621 | Open in IMG/M |
| 3300027754|Ga0209596_1022694 | All Organisms → Viruses → Predicted Viral | 3712 | Open in IMG/M |
| 3300027754|Ga0209596_1037637 | All Organisms → Viruses → Predicted Viral | 2651 | Open in IMG/M |
| 3300027754|Ga0209596_1220537 | Not Available | 796 | Open in IMG/M |
| 3300027756|Ga0209444_10070877 | All Organisms → Viruses → Predicted Viral | 1504 | Open in IMG/M |
| 3300027756|Ga0209444_10076981 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1422 | Open in IMG/M |
| 3300027756|Ga0209444_10129371 | Not Available | 992 | Open in IMG/M |
| 3300027759|Ga0209296_1001285 | Not Available | 19522 | Open in IMG/M |
| 3300027759|Ga0209296_1010281 | Not Available | 5644 | Open in IMG/M |
| 3300027759|Ga0209296_1026116 | All Organisms → Viruses → Predicted Viral | 3266 | Open in IMG/M |
| 3300027759|Ga0209296_1047621 | All Organisms → Viruses → Predicted Viral | 2255 | Open in IMG/M |
| 3300027759|Ga0209296_1097577 | Not Available | 1410 | Open in IMG/M |
| 3300027759|Ga0209296_1212666 | Not Available | 819 | Open in IMG/M |
| 3300027759|Ga0209296_1263814 | Not Available | 702 | Open in IMG/M |
| 3300027760|Ga0209598_10002897 | Not Available | 13165 | Open in IMG/M |
| 3300027760|Ga0209598_10356396 | Not Available | 551 | Open in IMG/M |
| 3300027760|Ga0209598_10384779 | Not Available | 518 | Open in IMG/M |
| 3300027763|Ga0209088_10000029 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 114777 | Open in IMG/M |
| 3300027763|Ga0209088_10022130 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3274 | Open in IMG/M |
| 3300027769|Ga0209770_10002990 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8377 | Open in IMG/M |
| 3300027769|Ga0209770_10023017 | All Organisms → Viruses → Predicted Viral | 2732 | Open in IMG/M |
| 3300027769|Ga0209770_10030324 | All Organisms → Viruses → Predicted Viral | 2354 | Open in IMG/M |
| 3300027769|Ga0209770_10055646 | Not Available | 1672 | Open in IMG/M |
| 3300027769|Ga0209770_10125802 | All Organisms → Viruses → Predicted Viral | 1043 | Open in IMG/M |
| 3300027769|Ga0209770_10154252 | Not Available | 924 | Open in IMG/M |
| 3300027769|Ga0209770_10158623 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 909 | Open in IMG/M |
| 3300027769|Ga0209770_10278526 | Not Available | 642 | Open in IMG/M |
| 3300027769|Ga0209770_10295678 | Not Available | 618 | Open in IMG/M |
| 3300027770|Ga0209086_10076961 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1771 | Open in IMG/M |
| 3300027782|Ga0209500_10104497 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1398 | Open in IMG/M |
| 3300027782|Ga0209500_10407433 | Not Available | 545 | Open in IMG/M |
| 3300027793|Ga0209972_10000283 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 50683 | Open in IMG/M |
| 3300027793|Ga0209972_10299717 | Not Available | 709 | Open in IMG/M |
| 3300027793|Ga0209972_10307195 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 698 | Open in IMG/M |
| 3300027793|Ga0209972_10388370 | Not Available | 595 | Open in IMG/M |
| 3300027797|Ga0209107_10000099 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 52410 | Open in IMG/M |
| 3300027797|Ga0209107_10000474 | Not Available | 23387 | Open in IMG/M |
| 3300027797|Ga0209107_10075397 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1851 | Open in IMG/M |
| 3300027797|Ga0209107_10181700 | All Organisms → Viruses → Predicted Viral | 1051 | Open in IMG/M |
| 3300027797|Ga0209107_10197518 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 995 | Open in IMG/M |
| 3300027797|Ga0209107_10396018 | Not Available | 630 | Open in IMG/M |
| 3300027798|Ga0209353_10204227 | Not Available | 864 | Open in IMG/M |
| 3300027798|Ga0209353_10338037 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 631 | Open in IMG/M |
| 3300027804|Ga0209358_10001805 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 16727 | Open in IMG/M |
| 3300027804|Ga0209358_10065468 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2099 | Open in IMG/M |
| 3300027805|Ga0209229_10002039 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8260 | Open in IMG/M |
| 3300027805|Ga0209229_10021237 | All Organisms → Viruses → Predicted Viral | 2804 | Open in IMG/M |
| 3300027805|Ga0209229_10096206 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1333 | Open in IMG/M |
| 3300027805|Ga0209229_10323774 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 677 | Open in IMG/M |
| 3300027805|Ga0209229_10367325 | Not Available | 628 | Open in IMG/M |
| 3300027805|Ga0209229_10494982 | Not Available | 522 | Open in IMG/M |
| 3300027816|Ga0209990_10289875 | Not Available | 735 | Open in IMG/M |
| 3300027836|Ga0209230_10012736 | All Organisms → Viruses → Predicted Viral | 3848 | Open in IMG/M |
| 3300027892|Ga0209550_10018636 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6113 | Open in IMG/M |
| 3300027892|Ga0209550_10041830 | All Organisms → Viruses → Predicted Viral | 3785 | Open in IMG/M |
| 3300027892|Ga0209550_10060854 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2991 | Open in IMG/M |
| 3300027892|Ga0209550_10117940 | All Organisms → Viruses → Predicted Viral | 1950 | Open in IMG/M |
| 3300027892|Ga0209550_10180505 | All Organisms → Viruses → Predicted Viral | 1464 | Open in IMG/M |
| 3300027892|Ga0209550_10201802 | All Organisms → Viruses → Predicted Viral | 1356 | Open in IMG/M |
| 3300027892|Ga0209550_10266168 | Not Available | 1123 | Open in IMG/M |
| 3300027892|Ga0209550_10395039 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 858 | Open in IMG/M |
| 3300027892|Ga0209550_10400302 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 850 | Open in IMG/M |
| 3300027892|Ga0209550_10423155 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 819 | Open in IMG/M |
| 3300027892|Ga0209550_10697812 | Not Available | 584 | Open in IMG/M |
| 3300027969|Ga0209191_1000524 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 29376 | Open in IMG/M |
| 3300027973|Ga0209298_10000082 | Not Available | 54809 | Open in IMG/M |
| 3300027974|Ga0209299_1000511 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 21852 | Open in IMG/M |
| (restricted) 3300027977|Ga0247834_1006363 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 13294 | Open in IMG/M |
| 3300028025|Ga0247723_1000570 | Not Available | 24817 | Open in IMG/M |
| 3300028025|Ga0247723_1003982 | All Organisms → cellular organisms → Bacteria | 7165 | Open in IMG/M |
| 3300028025|Ga0247723_1005553 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5660 | Open in IMG/M |
| 3300028025|Ga0247723_1013453 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3027 | Open in IMG/M |
| 3300028025|Ga0247723_1022289 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2111 | Open in IMG/M |
| 3300028025|Ga0247723_1032401 | Not Available | 1631 | Open in IMG/M |
| 3300028025|Ga0247723_1037958 | All Organisms → Viruses → Predicted Viral | 1457 | Open in IMG/M |
| 3300028025|Ga0247723_1038612 | All Organisms → Viruses → Predicted Viral | 1438 | Open in IMG/M |
| 3300028025|Ga0247723_1052425 | All Organisms → Viruses → Predicted Viral | 1161 | Open in IMG/M |
| 3300028027|Ga0247722_10138753 | Not Available | 881 | Open in IMG/M |
| 3300028113|Ga0255234_1019743 | Not Available | 1694 | Open in IMG/M |
| 3300028178|Ga0265593_1048295 | Not Available | 1228 | Open in IMG/M |
| 3300031758|Ga0315907_10123779 | All Organisms → Viruses → Predicted Viral | 2205 | Open in IMG/M |
| 3300031758|Ga0315907_10263043 | All Organisms → Viruses → Predicted Viral | 1427 | Open in IMG/M |
| 3300031758|Ga0315907_10567541 | Not Available | 886 | Open in IMG/M |
| 3300031758|Ga0315907_11095540 | Not Available | 566 | Open in IMG/M |
| 3300031758|Ga0315907_11219132 | Not Available | 525 | Open in IMG/M |
| 3300031784|Ga0315899_10242704 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1800 | Open in IMG/M |
| 3300031784|Ga0315899_10305705 | Not Available | 1572 | Open in IMG/M |
| 3300031784|Ga0315899_10608904 | Not Available | 1029 | Open in IMG/M |
| 3300031784|Ga0315899_10922243 | Not Available | 785 | Open in IMG/M |
| 3300031784|Ga0315899_11709772 | Not Available | 516 | Open in IMG/M |
| 3300031786|Ga0315908_10768493 | Not Available | 790 | Open in IMG/M |
| 3300031786|Ga0315908_11578677 | Not Available | 509 | Open in IMG/M |
| 3300031787|Ga0315900_10332922 | Not Available | 1236 | Open in IMG/M |
| 3300031787|Ga0315900_10417527 | Not Available | 1051 | Open in IMG/M |
| 3300031787|Ga0315900_10418017 | Not Available | 1050 | Open in IMG/M |
| 3300031787|Ga0315900_10676290 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 736 | Open in IMG/M |
| 3300031857|Ga0315909_10160196 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1838 | Open in IMG/M |
| 3300031857|Ga0315909_10187244 | Not Available | 1656 | Open in IMG/M |
| 3300031857|Ga0315909_10232766 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1430 | Open in IMG/M |
| 3300031857|Ga0315909_10382611 | All Organisms → Viruses → Predicted Viral | 1015 | Open in IMG/M |
| 3300031857|Ga0315909_10411956 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 964 | Open in IMG/M |
| 3300031951|Ga0315904_10412406 | All Organisms → Viruses → Predicted Viral | 1220 | Open in IMG/M |
| 3300031951|Ga0315904_10614153 | Not Available | 932 | Open in IMG/M |
| 3300031951|Ga0315904_11122322 | Not Available | 611 | Open in IMG/M |
| 3300031951|Ga0315904_11282761 | Not Available | 555 | Open in IMG/M |
| 3300031951|Ga0315904_11386512 | Not Available | 525 | Open in IMG/M |
| 3300031963|Ga0315901_10050923 | All Organisms → Viruses → Predicted Viral | 4058 | Open in IMG/M |
| 3300031963|Ga0315901_10580820 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 855 | Open in IMG/M |
| 3300031963|Ga0315901_10690048 | Not Available | 759 | Open in IMG/M |
| 3300031963|Ga0315901_10715930 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 739 | Open in IMG/M |
| 3300031963|Ga0315901_10819083 | Not Available | 672 | Open in IMG/M |
| 3300031963|Ga0315901_11062312 | Not Available | 560 | Open in IMG/M |
| 3300032050|Ga0315906_11127257 | Not Available | 576 | Open in IMG/M |
| 3300032092|Ga0315905_10003501 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 16187 | Open in IMG/M |
| 3300032092|Ga0315905_10045941 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4432 | Open in IMG/M |
| 3300032092|Ga0315905_10068066 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3608 | Open in IMG/M |
| 3300032092|Ga0315905_10194092 | Not Available | 2003 | Open in IMG/M |
| 3300032092|Ga0315905_10273319 | All Organisms → Viruses → Predicted Viral | 1632 | Open in IMG/M |
| 3300032092|Ga0315905_10334667 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1442 | Open in IMG/M |
| 3300032092|Ga0315905_11282584 | Not Available | 591 | Open in IMG/M |
| 3300032093|Ga0315902_10703375 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 821 | Open in IMG/M |
| 3300032093|Ga0315902_11232383 | Not Available | 534 | Open in IMG/M |
| 3300032116|Ga0315903_10094399 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2875 | Open in IMG/M |
| 3300032116|Ga0315903_10664997 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 786 | Open in IMG/M |
| 3300033482|Ga0316627_102759899 | Not Available | 521 | Open in IMG/M |
| 3300033488|Ga0316621_10305388 | Not Available | 1048 | Open in IMG/M |
| 3300033816|Ga0334980_0021473 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2771 | Open in IMG/M |
| 3300033816|Ga0334980_0026679 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2470 | Open in IMG/M |
| 3300033816|Ga0334980_0217799 | Not Available | 761 | Open in IMG/M |
| 3300033816|Ga0334980_0248203 | Not Available | 702 | Open in IMG/M |
| 3300033816|Ga0334980_0259935 | Not Available | 682 | Open in IMG/M |
| 3300033978|Ga0334977_0060282 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2091 | Open in IMG/M |
| 3300033978|Ga0334977_0120725 | Not Available | 1383 | Open in IMG/M |
| 3300033978|Ga0334977_0127044 | All Organisms → Viruses → Predicted Viral | 1340 | Open in IMG/M |
| 3300033980|Ga0334981_0001307 | Not Available | 17740 | Open in IMG/M |
| 3300033980|Ga0334981_0395332 | Not Available | 593 | Open in IMG/M |
| 3300033981|Ga0334982_0246278 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 861 | Open in IMG/M |
| 3300033981|Ga0334982_0290357 | Not Available | 773 | Open in IMG/M |
| 3300033992|Ga0334992_0019658 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4209 | Open in IMG/M |
| 3300033992|Ga0334992_0027108 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3465 | Open in IMG/M |
| 3300033992|Ga0334992_0057201 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2195 | Open in IMG/M |
| 3300033992|Ga0334992_0060068 | All Organisms → Viruses → Predicted Viral | 2130 | Open in IMG/M |
| 3300033992|Ga0334992_0460747 | Not Available | 558 | Open in IMG/M |
| 3300033993|Ga0334994_0026266 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3813 | Open in IMG/M |
| 3300033993|Ga0334994_0063226 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2266 | Open in IMG/M |
| 3300033993|Ga0334994_0077412 | All Organisms → Viruses → Predicted Viral | 2000 | Open in IMG/M |
| 3300033993|Ga0334994_0129866 | Not Available | 1442 | Open in IMG/M |
| 3300033995|Ga0335003_0099587 | All Organisms → Viruses → Predicted Viral | 1505 | Open in IMG/M |
| 3300033996|Ga0334979_0040823 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3046 | Open in IMG/M |
| 3300033996|Ga0334979_0269253 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 978 | Open in IMG/M |
| 3300034012|Ga0334986_0258386 | Not Available | 943 | Open in IMG/M |
| 3300034013|Ga0334991_0000390 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 43050 | Open in IMG/M |
| 3300034013|Ga0334991_0003562 | Not Available | 12004 | Open in IMG/M |
| 3300034013|Ga0334991_0388532 | Not Available | 539 | Open in IMG/M |
| 3300034018|Ga0334985_0121158 | Not Available | 1820 | Open in IMG/M |
| 3300034019|Ga0334998_0297270 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 960 | Open in IMG/M |
| 3300034022|Ga0335005_0511538 | Not Available | 666 | Open in IMG/M |
| 3300034023|Ga0335021_0374714 | Not Available | 748 | Open in IMG/M |
| 3300034050|Ga0335023_0038021 | All Organisms → Viruses → Predicted Viral | 2825 | Open in IMG/M |
| 3300034060|Ga0334983_0698901 | Not Available | 540 | Open in IMG/M |
| 3300034061|Ga0334987_0094728 | All Organisms → Viruses → Predicted Viral | 2314 | Open in IMG/M |
| 3300034061|Ga0334987_0110430 | All Organisms → Viruses → Predicted Viral | 2093 | Open in IMG/M |
| 3300034062|Ga0334995_0114110 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2019 | Open in IMG/M |
| 3300034062|Ga0334995_0653223 | Not Available | 601 | Open in IMG/M |
| 3300034062|Ga0334995_0739197 | Not Available | 548 | Open in IMG/M |
| 3300034064|Ga0335001_0478265 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 662 | Open in IMG/M |
| 3300034066|Ga0335019_0371631 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 880 | Open in IMG/M |
| 3300034066|Ga0335019_0466077 | Not Available | 760 | Open in IMG/M |
| 3300034068|Ga0334990_0002792 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 9927 | Open in IMG/M |
| 3300034068|Ga0334990_0385796 | Not Available | 755 | Open in IMG/M |
| 3300034071|Ga0335028_0000074 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 78686 | Open in IMG/M |
| 3300034071|Ga0335028_0303686 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 945 | Open in IMG/M |
| 3300034071|Ga0335028_0326573 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 900 | Open in IMG/M |
| 3300034071|Ga0335028_0514508 | Not Available | 659 | Open in IMG/M |
| 3300034071|Ga0335028_0674801 | Not Available | 544 | Open in IMG/M |
| 3300034082|Ga0335020_0019934 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3806 | Open in IMG/M |
| 3300034082|Ga0335020_0082961 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1646 | Open in IMG/M |
| 3300034082|Ga0335020_0102162 | All Organisms → Viruses → Predicted Viral | 1461 | Open in IMG/M |
| 3300034092|Ga0335010_0329882 | Not Available | 862 | Open in IMG/M |
| 3300034093|Ga0335012_0082369 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1816 | Open in IMG/M |
| 3300034093|Ga0335012_0266129 | Not Available | 882 | Open in IMG/M |
| 3300034093|Ga0335012_0407812 | Not Available | 663 | Open in IMG/M |
| 3300034095|Ga0335022_0209277 | All Organisms → Viruses → Predicted Viral | 1163 | Open in IMG/M |
| 3300034101|Ga0335027_0777857 | Not Available | 557 | Open in IMG/M |
| 3300034102|Ga0335029_0003158 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 13083 | Open in IMG/M |
| 3300034103|Ga0335030_0003480 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 12276 | Open in IMG/M |
| 3300034106|Ga0335036_0605140 | Not Available | 664 | Open in IMG/M |
| 3300034108|Ga0335050_0367072 | Not Available | 658 | Open in IMG/M |
| 3300034109|Ga0335051_0123055 | All Organisms → Viruses → Predicted Viral | 1337 | Open in IMG/M |
| 3300034109|Ga0335051_0135365 | Not Available | 1264 | Open in IMG/M |
| 3300034110|Ga0335055_0072388 | All Organisms → Viruses → Predicted Viral | 1584 | Open in IMG/M |
| 3300034111|Ga0335063_0015270 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4939 | Open in IMG/M |
| 3300034112|Ga0335066_0626314 | Not Available | 553 | Open in IMG/M |
| 3300034116|Ga0335068_0000147 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 60361 | Open in IMG/M |
| 3300034118|Ga0335053_0171544 | Not Available | 1447 | Open in IMG/M |
| 3300034118|Ga0335053_0504656 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 713 | Open in IMG/M |
| 3300034120|Ga0335056_0048894 | Not Available | 2774 | Open in IMG/M |
| 3300034121|Ga0335058_0108268 | All Organisms → Viruses → Predicted Viral | 1626 | Open in IMG/M |
| 3300034122|Ga0335060_0610316 | Not Available | 547 | Open in IMG/M |
| 3300034166|Ga0335016_0007798 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 9510 | Open in IMG/M |
| 3300034166|Ga0335016_0109067 | Not Available | 1969 | Open in IMG/M |
| 3300034167|Ga0335017_0121267 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1534 | Open in IMG/M |
| 3300034168|Ga0335061_0000014 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 108755 | Open in IMG/M |
| 3300034168|Ga0335061_0422231 | Not Available | 686 | Open in IMG/M |
| 3300034200|Ga0335065_0010115 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6667 | Open in IMG/M |
| 3300034272|Ga0335049_0011111 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6716 | Open in IMG/M |
| 3300034272|Ga0335049_0196203 | All Organisms → Viruses → Predicted Viral | 1420 | Open in IMG/M |
| 3300034272|Ga0335049_0842590 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 538 | Open in IMG/M |
| 3300034279|Ga0335052_0360265 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 785 | Open in IMG/M |
| 3300034280|Ga0334997_0723034 | Not Available | 605 | Open in IMG/M |
| 3300034280|Ga0334997_0724818 | Not Available | 604 | Open in IMG/M |
| 3300034283|Ga0335007_0000033 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 91959 | Open in IMG/M |
| 3300034283|Ga0335007_0251846 | All Organisms → Viruses → Predicted Viral | 1188 | Open in IMG/M |
| 3300034284|Ga0335013_0144493 | Not Available | 1623 | Open in IMG/M |
| 3300034284|Ga0335013_0570855 | Not Available | 665 | Open in IMG/M |
| 3300034284|Ga0335013_0598566 | Not Available | 644 | Open in IMG/M |
| 3300034284|Ga0335013_0746594 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 553 | Open in IMG/M |
| 3300034284|Ga0335013_0816825 | Not Available | 520 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 18.13% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 11.18% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 10.48% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 8.71% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 7.31% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 5.28% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 4.93% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 4.31% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 3.87% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 3.70% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 3.43% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 2.90% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 1.58% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 1.58% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 1.41% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 0.97% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 0.97% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 0.88% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.88% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.79% |
| Estuary | Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary | 0.79% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment | 0.70% |
| Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 0.62% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.62% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 0.44% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.35% |
| Freshwater, Surface Ice | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Surface Ice | 0.35% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.35% |
| Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 0.26% |
| Lake Chemocline | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake Chemocline | 0.26% |
| Pond Fresh Water | Environmental → Aquatic → Freshwater → Pond → Unclassified → Pond Fresh Water | 0.26% |
| Lake | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Lake | 0.18% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.18% |
| Freshwater And Marine | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater And Marine | 0.18% |
| Stentor Amethystinus | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Stentor Amethystinus | 0.18% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Unclassified → Freshwater | 0.18% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.18% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.09% |
| Lotic | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Lotic | 0.09% |
| Surface Water | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Surface Water | 0.09% |
| Freshwater And Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine | 0.09% |
| Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 0.09% |
| Hypersaline | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Unclassified → Hypersaline | 0.09% |
| Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Sand | 0.09% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2166559019 | Stentor MTG 1 | Environmental | Open in IMG/M |
| 2199352004 | Freshwater microbial communities from Lake Mendota, WI - Practice 15JUN2010 epilimnion | Environmental | Open in IMG/M |
| 3300000268 | Lotic microbial communities from Mississippi River at two locations in the state of Minnesota, sample from River Site 1, Mississippi Headwaters ver2 | Environmental | Open in IMG/M |
| 3300000525 | Hypersaline microbial communities from Lake Vida, Antarctica - Brine Hole Two >0.2 micron | Environmental | Open in IMG/M |
| 3300000736 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011 | Environmental | Open in IMG/M |
| 3300000756 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 | Environmental | Open in IMG/M |
| 3300000882 | Freshwater microbial communities from the Columbia River | Environmental | Open in IMG/M |
| 3300000929 | Marine plume microbial communities from the Columbia River - 15 PSU | Environmental | Open in IMG/M |
| 3300001255 | Freshwater microbial communities from Lake Mendota, WI - 13JUN2010 deep hole epilimnion | Environmental | Open in IMG/M |
| 3300001282 | Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnion | Environmental | Open in IMG/M |
| 3300002161 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA | Environmental | Open in IMG/M |
| 3300002201 | Freshwater microbial communities from San Paulo Zoo lake, Brazil - SEP 2013 | Environmental | Open in IMG/M |
| 3300002272 | Freshwater microbial communities from Lake Mendota, WI - 27JUL2010 deep hole epilimnion ns | Environmental | Open in IMG/M |
| 3300002273 | Freshwater microbial communities from Lake Mendota, WI - 29JUN2012 deep hole epilimnion | Environmental | Open in IMG/M |
| 3300002304 | Freshwater microbial communities from Lake Mendota, WI - 17JUL2012 deep hole epilimnion | Environmental | Open in IMG/M |
| 3300002350 | Freshwater microbial communities from Lake Mendota, WI - 13JUL2012 deep hole epilimnion | Environmental | Open in IMG/M |
| 3300002400 | Freshwater microbial communities from Lake Mendota, WI - 26AUG2009 deep hole epilimnion | Environmental | Open in IMG/M |
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300002471 | Freshwater microbial communities from San Paulo Zoo lake, Brazil - MAY 2013 | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300003388 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SN | Environmental | Open in IMG/M |
| 3300003413 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD | Environmental | Open in IMG/M |
| 3300003429 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN | Environmental | Open in IMG/M |
| 3300003430 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD | Environmental | Open in IMG/M |
| 3300003490 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN | Environmental | Open in IMG/M |
| 3300003491 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300003493 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN | Environmental | Open in IMG/M |
| 3300003497 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN | Environmental | Open in IMG/M |
| 3300003499 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN | Environmental | Open in IMG/M |
| 3300003986 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SN (v2) | Environmental | Open in IMG/M |
| 3300004054 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (v2) | Environmental | Open in IMG/M |
| 3300004096 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 2) | Environmental | Open in IMG/M |
| 3300004124 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SD (version 2) | Environmental | Open in IMG/M |
| 3300004125 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (version 2) | Environmental | Open in IMG/M |
| 3300004126 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (version 2) | Environmental | Open in IMG/M |
| 3300004240 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN | Environmental | Open in IMG/M |
| 3300004772 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA0.5M | Environmental | Open in IMG/M |
| 3300004797 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004836 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005069 | Metagenomes from Harmful Algal Blooms in Lake Erie, HABS-E2014-0024 | Environmental | Open in IMG/M |
| 3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
| 3300005525 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaG | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005528 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG | Environmental | Open in IMG/M |
| 3300005580 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300005583 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF | Environmental | Open in IMG/M |
| 3300005584 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF | Environmental | Open in IMG/M |
| 3300005585 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ON33MSRF | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300005941 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 | Environmental | Open in IMG/M |
| 3300006030 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
| 3300006641 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006875 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006917 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007162 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series HT 2014_7_11 | Environmental | Open in IMG/M |
| 3300007165 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_16 | Environmental | Open in IMG/M |
| 3300007363 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007543 | Estuarine microbial communities from the Columbia River estuary - metaG 1370B-3 | Environmental | Open in IMG/M |
| 3300007544 | Estuarine microbial communities from the Columbia River estuary - metaG 1449B-3 | Environmental | Open in IMG/M |
| 3300007545 | Estuarine microbial communities from the Columbia River estuary - metaG 1547B-3 | Environmental | Open in IMG/M |
| 3300007546 | Estuarine microbial communities from the Columbia River estuary - metaG 1547A-02 | Environmental | Open in IMG/M |
| 3300007547 | Estuarine microbial communities from the Columbia River estuary - metaG 1547B-02 | Environmental | Open in IMG/M |
| 3300007548 | Estuarine microbial communities from the Columbia River estuary - metaG 1548B-3 | Environmental | Open in IMG/M |
| 3300007553 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.689 | Environmental | Open in IMG/M |
| 3300007554 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.709 | Environmental | Open in IMG/M |
| 3300007555 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.555 | Environmental | Open in IMG/M |
| 3300007557 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.715 | Environmental | Open in IMG/M |
| 3300007559 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 | Environmental | Open in IMG/M |
| 3300007560 | Estuarine microbial communities from the Columbia River estuary - metaG 1560A-02 | Environmental | Open in IMG/M |
| 3300007562 | Estuarine microbial communities from the Columbia River estuary - metaG 1561A-02 | Environmental | Open in IMG/M |
| 3300007590 | Estuarine microbial communities from the Columbia River estuary - metaG 1562A-02 | Environmental | Open in IMG/M |
| 3300007593 | Estuarine microbial communities from the Columbia River estuary - metaG 1563A-3 | Environmental | Open in IMG/M |
| 3300007597 | Estuarine microbial communities from the Columbia River estuary - metaG 1563A-02 | Environmental | Open in IMG/M |
| 3300007606 | Estuarine microbial communities from the Columbia River estuary - metaG 1569-02 | Environmental | Open in IMG/M |
| 3300007617 | Estuarine microbial communities from the Columbia River estuary - metaG 1554B-02 | Environmental | Open in IMG/M |
| 3300007618 | Estuarine microbial communities from the Columbia River estuary - metaG 1554A-02 | Environmental | Open in IMG/M |
| 3300007620 | Estuarine microbial communities from the Columbia River estuary - metaG 1546C-02 | Environmental | Open in IMG/M |
| 3300007621 | Estuarine microbial communities from the Columbia River estuary - metaG 1547A-3 | Environmental | Open in IMG/M |
| 3300007622 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-02 | Environmental | Open in IMG/M |
| 3300007624 | Estuarine microbial communities from the Columbia River estuary - metaG 1548A-02 | Environmental | Open in IMG/M |
| 3300007629 | Estuarine microbial communities from the Columbia River estuary - metaG 1554B-3 | Environmental | Open in IMG/M |
| 3300007634 | Estuarine microbial communities from the Columbia River estuary - metaG 1555A-02 | Environmental | Open in IMG/M |
| 3300007636 | Estuarine microbial communities from the Columbia River estuary - metaG 1371A-3 | Environmental | Open in IMG/M |
| 3300007637 | Estuarine microbial communities from the Columbia River estuary - metaG 1556A-02 | Environmental | Open in IMG/M |
| 3300007639 | Estuarine microbial communities from the Columbia River estuary - metaG 1449C-02 | Environmental | Open in IMG/M |
| 3300007642 | Estuarine microbial communities from the Columbia River estuary - metaG 1548A-3 | Environmental | Open in IMG/M |
| 3300007644 | Estuarine microbial communities from the Columbia River estuary - metaG 1555B-02 | Environmental | Open in IMG/M |
| 3300007647 | Estuarine microbial communities from the Columbia River estuary - metaG 1370B-02 | Environmental | Open in IMG/M |
| 3300007670 | Estuarine microbial communities from the Columbia River estuary - metaG 1449C-3 | Environmental | Open in IMG/M |
| 3300007706 | Estuarine microbial communities from the Columbia River estuary - metaG 1555B-3 | Environmental | Open in IMG/M |
| 3300007708 | Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02 | Environmental | Open in IMG/M |
| 3300007716 | Estuarine microbial communities from the Columbia River estuary - metaG 1546B-3 | Environmental | Open in IMG/M |
| 3300007861 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1372B_3um | Environmental | Open in IMG/M |
| 3300007864 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461B_3.0um | Environmental | Open in IMG/M |
| 3300007954 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1373B_0.2um | Environmental | Open in IMG/M |
| 3300007972 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460ABC_3.0um | Environmental | Open in IMG/M |
| 3300007973 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um | Environmental | Open in IMG/M |
| 3300007974 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2um | Environmental | Open in IMG/M |
| 3300007992 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461AB_0.2um | Environmental | Open in IMG/M |
| 3300008021 | Estuarine microbial communities from the Columbia River estuary - metaG 1569A-3 | Environmental | Open in IMG/M |
| 3300008052 | Estuarine microbial communities from the Columbia River estuary - metaG 1553A-02 | Environmental | Open in IMG/M |
| 3300008055 | Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393 | Host-Associated | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008108 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA | Environmental | Open in IMG/M |
| 3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
| 3300008111 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-C-NA | Environmental | Open in IMG/M |
| 3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
| 3300008114 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NA | Environmental | Open in IMG/M |
| 3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
| 3300008117 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008118 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-100-LTR | Environmental | Open in IMG/M |
| 3300008119 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0110-C-NA | Environmental | Open in IMG/M |
| 3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
| 3300008122 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample HABS-E2014-0124-100-LTR | Environmental | Open in IMG/M |
| 3300008258 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample HABS-E2014-0110-3-NA | Environmental | Open in IMG/M |
| 3300008259 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0132-C-NA | Environmental | Open in IMG/M |
| 3300008261 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NA | Environmental | Open in IMG/M |
| 3300008262 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-C-NA | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
| 3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
| 3300008953 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007_MT4 | Environmental | Open in IMG/M |
| 3300008962 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007_MT5 | Environmental | Open in IMG/M |
| 3300008964 | Estuarine microbial communities from the Columbia River estuary - metaG 1551A-02 | Environmental | Open in IMG/M |
| 3300008996 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747 | Environmental | Open in IMG/M |
| 3300009026 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 | Environmental | Open in IMG/M |
| 3300009050 | Estuarine microbial communities from the Columbia River estuary - metaG 1557A-02 | Environmental | Open in IMG/M |
| 3300009051 | Estuarine microbial communities from the Columbia River estuary - metaG 1449B-02 | Environmental | Open in IMG/M |
| 3300009056 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-3 | Environmental | Open in IMG/M |
| 3300009058 | Estuarine microbial communities from the Columbia River estuary - metaG 1370A-02 | Environmental | Open in IMG/M |
| 3300009059 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.703 | Environmental | Open in IMG/M |
| 3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009079 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741 | Environmental | Open in IMG/M |
| 3300009086 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713 | Environmental | Open in IMG/M |
| 3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
| 3300009154 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG | Environmental | Open in IMG/M |
| 3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
| 3300009163 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG | Environmental | Open in IMG/M |
| 3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
| 3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
| 3300009419 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT | Environmental | Open in IMG/M |
| 3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
| 3300010312 | Estuarine microbial communities from the Columbia River estuary - metaG 1549B-02 | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
| 3300010388 | Freshwater microbial communities from the surface of the forest pond in Jussy, Geneva, Switzerland - JEBV, may 2015 | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300010965 | Microbial communities from Lake Cadagno chemocline, Switzerland. Combined Assembly of Gp0156211, Gp0156621 | Environmental | Open in IMG/M |
| 3300010970 | Freshwater microbial communities from the surface of the forest pond in Jussy, Geneva, Switzerland - JEBV1, april 2016 | Environmental | Open in IMG/M |
| 3300011009 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_0.1_0.8_DNA | Environmental | Open in IMG/M |
| 3300011010 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Surface Ice | Environmental | Open in IMG/M |
| 3300011011 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300011268 | Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555 | Environmental | Open in IMG/M |
| 3300012000 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007A | Environmental | Open in IMG/M |
| 3300012006 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1101B | Environmental | Open in IMG/M |
| 3300012012 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300012017 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300012346 | Freshwater microbial communities from Emily Creek, Ontario, Canada - S29 | Environmental | Open in IMG/M |
| 3300012352 | Freshwater microbial communities from Baxter Creek, Ontario, Canada - S37 | Environmental | Open in IMG/M |
| 3300012663 | Freshwater microbial communities from Indian River, Ontario, Canada - S50 | Environmental | Open in IMG/M |
| 3300012665 | Freshwater microbial communities from Talbot River, Ontario, Canada - S11 | Environmental | Open in IMG/M |
| 3300012666 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Surface Ice version 2 | Environmental | Open in IMG/M |
| 3300012667 | Freshwater microbial communities from Maskinonge River, Ontario, Canada - S15 | Environmental | Open in IMG/M |
| 3300012711 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES133 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012712 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES121 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012723 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES129 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012761 | Freshwater microbial communities from Lake Simoncouche, Canada - S_130826_M_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012763 | Freshwater microbial communities from Lake Simoncouche, Canada - S_140108_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012772 | Freshwater microbial communities from Lake Simoncouche, Canada - S_130826_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012779 | Freshwater microbial communities from Lake Simoncouche, Canada - S_130206_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
| 3300013006 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES005 metaG | Environmental | Open in IMG/M |
| 3300013014 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES006 metaG | Environmental | Open in IMG/M |
| 3300013092 | Freshwater microbial communities from Powell Lake, British Columbia, Canada to study Microbial Dark Matter (Phase II) - PL_2010_150m | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300014050 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007B | Environmental | Open in IMG/M |
| 3300014962 | Surface water microbial communities from Bangladesh - BaraHaldiaSW0309 | Environmental | Open in IMG/M |
| 3300017701 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
| 3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300018775 | Metatranscriptome of marine microbial communities from Baltic Sea - GS679_0p8 | Environmental | Open in IMG/M |
| 3300019146 | Metatranscriptome of marine microbial communities from Baltic Sea - GS860_ls5 | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
| 3300020141 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1 | Environmental | Open in IMG/M |
| 3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
| 3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
| 3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
| 3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
| 3300020162 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1 | Environmental | Open in IMG/M |
| 3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
| 3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
| 3300020480 | Freshwater microbial communities from Lake Mendota, WI - 16JUL2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020490 | Freshwater microbial communities from Lake Mendota, WI - 18JUL2008 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020492 | Freshwater microbial communities from Lake Mendota, WI - 01JUN2011 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
| 3300020494 | Freshwater microbial communities from Lake Mendota, WI - 25SEP2008 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020498 | Freshwater microbial communities from Lake Mendota, WI - 13JUN2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020513 | Freshwater microbial communities from Lake Mendota, WI - 20JUL2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020514 | Freshwater microbial communities from Lake Mendota, WI - 27AUG2008 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020519 | Freshwater microbial communities from Lake Mendota, WI - 07OCT2009 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
| 3300020524 | Freshwater microbial communities from Lake Mendota, WI - 16NOV2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020529 | Freshwater microbial communities from Lake Mendota, WI - 07SEP2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020530 | Freshwater microbial communities from Lake Mendota, WI - 22OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020533 | Freshwater microbial communities from Lake Mendota, WI - 08JUN2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020537 | Freshwater microbial communities from Lake Mendota, WI - 21SEP2011 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020541 | Freshwater microbial communities from Lake Mendota, WI - 26AUG2009 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020549 | Freshwater microbial communities from Lake Mendota, WI - 12OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020551 | Freshwater microbial communities from Lake Mendota, WI - 27JUL2010 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
| 3300020557 | Freshwater microbial communities from Lake Mendota, WI - 15JUN2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020562 | Freshwater microbial communities from Lake Mendota, WI - 05MAY2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020564 | Freshwater microbial communities from Lake Mendota, WI - 30JUL2009 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020570 | Freshwater microbial communities from Lake Mendota, WI - 31AUG2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020572 | Freshwater microbial communities from Lake Mendota, WI - 05MAY2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020575 | Freshwater microbial communities from Lake Mendota, WI - 20MAY2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021140 | Freshwater microbial communities from Lake Mendota, WI - Practice 29OCT2010 epilimnion | Environmental | Open in IMG/M |
| 3300021438 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 11-17 MG | Environmental | Open in IMG/M |
| 3300021519 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m | Environmental | Open in IMG/M |
| 3300021952 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 20-17 MG | Environmental | Open in IMG/M |
| 3300021956 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17 MG | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300022553 | Powell_combined assembly | Environmental | Open in IMG/M |
| 3300022748 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 20-17_Aug_MG | Environmental | Open in IMG/M |
| 3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
| 3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
| 3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
| 3300024289 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepA_8h | Environmental | Open in IMG/M |
| 3300024306 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepB_8h | Environmental | Open in IMG/M |
| 3300024343 | Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fraction | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300024348 | 0.2um to 3um size fraction coassembly | Environmental | Open in IMG/M |
| 3300024483 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024490 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Cont_RepB_0h | Environmental | Open in IMG/M |
| 3300024533 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024537 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024564 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepC_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024571 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025585 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025744 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepB_0h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026457 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Colum_RepB_8h | Environmental | Open in IMG/M |
| 3300026931 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T2_23-Sept-14 (SPAdes) | Environmental | Open in IMG/M |
| 3300027114 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_16 (SPAdes) | Environmental | Open in IMG/M |
| 3300027121 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepC_8h | Environmental | Open in IMG/M |
| 3300027127 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepC_8h | Environmental | Open in IMG/M |
| 3300027129 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepB_8h | Environmental | Open in IMG/M |
| 3300027131 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepA_8h | Environmental | Open in IMG/M |
| 3300027132 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Miss_RepC_8h | Environmental | Open in IMG/M |
| 3300027133 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepB_8h | Environmental | Open in IMG/M |
| 3300027138 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepB_0h | Environmental | Open in IMG/M |
| 3300027139 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepB_8h | Environmental | Open in IMG/M |
| 3300027140 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepC_8h | Environmental | Open in IMG/M |
| 3300027142 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepC_0h | Environmental | Open in IMG/M |
| 3300027150 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Yuk_RepB_8h | Environmental | Open in IMG/M |
| 3300027151 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepA_0h | Environmental | Open in IMG/M |
| 3300027188 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.709 (SPAdes) | Environmental | Open in IMG/M |
| 3300027193 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 (SPAdes) | Environmental | Open in IMG/M |
| 3300027203 | Estuarine microbial communities from the Columbia River estuary - metaG 1371A-3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027206 | Estuarine microbial communities from the Columbia River estuary - metaG 1370A-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027212 | Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027215 | Estuarine microbial communities from the Columbia River estuary - metaG 1546C-3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027219 | Estuarine microbial communities from the Columbia River estuary - metaG 1546A-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027224 | Estuarine microbial communities from the Columbia River estuary - metaG 1449C-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027237 | Estuarine microbial communities from the Columbia River estuary - metaG 1554B-3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027238 | Estuarine microbial communities from the Columbia River estuary - metaG 1555C-3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027239 | Estuarine microbial communities from the Columbia River estuary - metaG 1555B-3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027246 | Estuarine microbial communities from the Columbia River estuary - metaG 1555B-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027247 | Estuarine microbial communities from the Columbia River estuary - metaG 1555A-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027255 | Estuarine microbial communities from the Columbia River estuary - metaG 1558A-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027293 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Law_RepA_8d | Environmental | Open in IMG/M |
| 3300027337 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepA_8d | Environmental | Open in IMG/M |
| 3300027365 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 RT (SPAdes) | Environmental | Open in IMG/M |
| 3300027418 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747 (SPAdes) | Environmental | Open in IMG/M |
| 3300027488 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepA_8d | Environmental | Open in IMG/M |
| 3300027492 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepA_8d | Environmental | Open in IMG/M |
| 3300027518 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series HT 2014_7_11 (SPAdes) | Environmental | Open in IMG/M |
| 3300027529 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepC_8h | Environmental | Open in IMG/M |
| 3300027563 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027578 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepA_8h | Environmental | Open in IMG/M |
| 3300027586 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027621 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027627 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027631 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 (SPAdes) | Environmental | Open in IMG/M |
| 3300027644 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027649 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ON33MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027656 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027679 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027689 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027697 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027710 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT (SPAdes) | Environmental | Open in IMG/M |
| 3300027720 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027732 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027741 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027744 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027753 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741 (SPAdes) | Environmental | Open in IMG/M |
| 3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027756 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027760 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027763 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027769 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027770 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027793 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027797 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027804 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
| 3300027816 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027836 | Freshwater and sediment microbial communities from Lake Ontario - Sta 18 epilimnion Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300027892 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027969 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027973 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027974 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027977 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_12m | Environmental | Open in IMG/M |
| 3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
| 3300028027 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 3H_FC | Environmental | Open in IMG/M |
| 3300028113 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028178 | Saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2011_5_24_36m | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
| 3300031786 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA124 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
| 3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
| 3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
| 3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300033482 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_C | Environmental | Open in IMG/M |
| 3300033488 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D1_C | Environmental | Open in IMG/M |
| 3300033816 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Sep2004-rr0005 | Environmental | Open in IMG/M |
| 3300033978 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME28Sep2014-rr0002 | Environmental | Open in IMG/M |
| 3300033980 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME09Aug2015-rr0007 | Environmental | Open in IMG/M |
| 3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
| 3300033992 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Jun2014-rr0035 | Environmental | Open in IMG/M |
| 3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
| 3300033995 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23May2014-rr0056 | Environmental | Open in IMG/M |
| 3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
| 3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
| 3300034013 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Jun2018-rr0034 | Environmental | Open in IMG/M |
| 3300034018 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME04Jul2014-rr0021 | Environmental | Open in IMG/M |
| 3300034019 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Sep2014-rr0049 | Environmental | Open in IMG/M |
| 3300034022 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Apr2018-rr0058 | Environmental | Open in IMG/M |
| 3300034023 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Oct2016-rr0090 | Environmental | Open in IMG/M |
| 3300034050 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07May2013-rr0095 | Environmental | Open in IMG/M |
| 3300034060 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16May2013-rr0016 | Environmental | Open in IMG/M |
| 3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034064 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME14Nov2013-rr0054 | Environmental | Open in IMG/M |
| 3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
| 3300034068 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Apr2016-rr0031 | Environmental | Open in IMG/M |
| 3300034071 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Oct2008D10-rr0110 | Environmental | Open in IMG/M |
| 3300034082 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088 | Environmental | Open in IMG/M |
| 3300034092 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069 | Environmental | Open in IMG/M |
| 3300034093 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072 | Environmental | Open in IMG/M |
| 3300034095 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Feb2014D0-rr0091 | Environmental | Open in IMG/M |
| 3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
| 3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
| 3300034103 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Sep2002-rr0119 | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| 3300034108 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Jun2014-rr0157 | Environmental | Open in IMG/M |
| 3300034109 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME26Aug2009-rr0158 | Environmental | Open in IMG/M |
| 3300034110 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME01Jun2009D10-rr0171 | Environmental | Open in IMG/M |
| 3300034111 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Oct2011-rr0186 | Environmental | Open in IMG/M |
| 3300034112 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191 | Environmental | Open in IMG/M |
| 3300034116 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-CONTROL-GENDONOR | Environmental | Open in IMG/M |
| 3300034118 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165 | Environmental | Open in IMG/M |
| 3300034120 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2014-rr0172 | Environmental | Open in IMG/M |
| 3300034121 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19May2015-rr0174 | Environmental | Open in IMG/M |
| 3300034122 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2014-rr0181 | Environmental | Open in IMG/M |
| 3300034166 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Sep2012-rr0079 | Environmental | Open in IMG/M |
| 3300034167 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Apr2015-rr0082 | Environmental | Open in IMG/M |
| 3300034168 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME06Apr2016-rr0183 | Environmental | Open in IMG/M |
| 3300034200 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2013-rr0190 | Environmental | Open in IMG/M |
| 3300034272 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2017-rr0156 | Environmental | Open in IMG/M |
| 3300034279 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2014-rr0163 | Environmental | Open in IMG/M |
| 3300034280 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME10Aug2009-rr0048 | Environmental | Open in IMG/M |
| 3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
| 3300034284 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jul2016-rr0075 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| stn_00022970 | 2166559019 | Stentor Amethystinus | RKMKRRTKMRMSDTYINDQLNAAQKLLWSGSLHEVDEAHNIIAKLISDRIEQTNLT |
| stn_00391830 | 2166559019 | Stentor Amethystinus | MRMSDQYINDQLSKAQALLWSGSLHEVDEAHNIISNLIKDRIEQVSN |
| 2199962015 | 2199352004 | Freshwater | MKMSDQYINDQLSKAQALLWSGSLHEVDEAHNIVSNLIRDRLEQVSN |
| 2200091245 | 2199352004 | Freshwater | MKMSDKYLNDQLSKAQKLLWGGSETENIEAHNIIAKLIKDKIEQVEL |
| M3P_100607421 | 3300000268 | Lotic | IYINDQLNKAQKLLWGGSETENIEAHNIISKLIRDRIEQVEG* |
| JGI1221J11331_10100786 | 3300000525 | Hypersaline | MNMSDIYLDQCLAKAQALLWGGSETENIEAHNIIAKLIADRAQIQNWT* |
| JGI12547J11936_10115467 | 3300000736 | Freshwater And Sediment | LWTQCLRKRKKTKMRMSDIYINDQLSKAQALLWSGSLHEVDEAHNIVSNLIRDRLEQVSN |
| JGI12547J11936_10150584 | 3300000736 | Freshwater And Sediment | MKMSDIYINDQLSKAQALLWSGSLHEVDEAHNIVSKLIQDRMAWEEGTNV* |
| JGI12547J11936_10156664 | 3300000736 | Freshwater And Sediment | LTSMTTGKKTRTKMRMSDQYINDQLSKAQALLWSGSLHEVDEAHNIVSNLIQDRLEQVSN |
| JGI12547J11936_10230193 | 3300000736 | Freshwater And Sediment | MKMSDEYLNERLNTAQKLLWGGSETENIAAHNIISKLIQDRMSGDEGNND* |
| JGI12547J11936_10517872 | 3300000736 | Freshwater And Sediment | MKMSDPYIDSVLAEAQKLLWGGSETENIEAHNLISKLIKDRLSDESV* |
| JGI12421J11937_100425733 | 3300000756 | Freshwater And Sediment | MRMSDNYINDQLNTAQKLLWGGSETENIEAHNIIAKLISDRIEQADLS* |
| JGI12421J11937_100685315 | 3300000756 | Freshwater And Sediment | MKMSDEYLNERLNTAQKLLWGGSETENIEAHNIISKLIQDRMAWEEGT |
| JGI12421J11937_101148413 | 3300000756 | Freshwater And Sediment | MKMSDIYINEQLSKAQALLWSGSLHEQDEAHNIIAKLINDRMEKAEGQND* |
| JGI12421J11937_101395223 | 3300000756 | Freshwater And Sediment | MRMSDTYINDQLSKAQALLWSGSLHEVDEAHNIVSNLI |
| JGI12421J11937_101758291 | 3300000756 | Freshwater And Sediment | MRMSDQYINDQLSKAQALLWSGSLHEVDEAHNIVSNLIQDRLEQVSN* |
| FwDRAFT_1000785815 | 3300000882 | Freshwater And Marine | MMKIKMSDVYINDQLNKAQALLWSGSLHEVDEAHNIISKLIQDRLGNG* |
| FwDRAFT_100238114 | 3300000882 | Freshwater And Marine | MKMSDVYINDQLNKAQQLLWGGSETENIEAHNIISKLISDRMEQVDL* |
| NpDRAFT_100788243 | 3300000929 | Freshwater And Marine | YINDQLSKAQALLWSGSLHEVDEAHNIVSNLIRDRLEQVSN* |
| B570J13889_10000124 | 3300001255 | Freshwater | MSDDYINDQLNKAQQLLWGGSETENIEAHNIISKLIKDRIEQVS* |
| B570J14230_100410662 | 3300001282 | Freshwater | MSDEYLNDQLSKAQALLWGGSETENIEAHNIIAKLIKDKVEQVGL* |
| B570J14230_100655993 | 3300001282 | Freshwater | MKMTDEYINDQLNTAQKLLWGGSETENIEAHNIIARLIKDRVEQTNLV* |
| JGI24766J26685_1000015515 | 3300002161 | Freshwater And Sediment | MKMSDPYIDEQLSKAQKLLWGGSETENIEAHNIISKLIRDRMSEQEGQNV* |
| JGI24766J26685_100216695 | 3300002161 | Freshwater And Sediment | MQMSDIYINEQLNKAQKLLWSGSLHEQDEAHNXIAKLIKDRMPDA* |
| JGI24766J26685_100259133 | 3300002161 | Freshwater And Sediment | MKMSDRYVNXQLNKAQKLLWGGSETENIEAHNIIAKLIKDREDLIEHS* |
| metazooDRAFT_12615762 | 3300002201 | Lake | MKLSEFYINQQLNKSQKLLWGGSETENIEAHNIISRLIKELESN* |
| B570J29579_1028151 | 3300002272 | Freshwater | KKMKMSDTYINDQLNKAQQLLWGGSETENIEAHNIIAKLIKDRIEQTDLL* |
| B570J29588_1066462 | 3300002273 | Freshwater | MSDEYLNDQLSKAQALLWGGSETENIEAHNIISKLIKDKIEQVGL* |
| B570J29606_10198442 | 3300002304 | Freshwater | MKMSDKYLNDQLGKAQELLWGGSETENIEAHNIISKLIKDKIEQVEL* |
| B570J29583_10004787 | 3300002350 | Freshwater | MQQTDKYINEQLSKAQALLWSGSLHEQDEAHNIIAKLINDRMGKXEGQND* |
| B570J29625_10015305 | 3300002400 | Freshwater | MSDEYLNDQLSKAQKLLWGGSETENIEAHNIIAKLIKDKIEQVGL* |
| B570J29032_1093940103 | 3300002408 | Freshwater | MKMSDDYINDQLNKAQQLLWGGSETENIEAHNIISKLIKDRIEQVS* |
| B570J29032_1094408603 | 3300002408 | Freshwater | MRMTDQYINDQLNTAQKLLWGGSETENIEAHNIIAKLIKDRIEQVNLS* |
| B570J29032_1096466333 | 3300002408 | Freshwater | MKMSDEYINDQLNKAQKLLWGGSETENIEAHNIISKLIRDRVEQIS* |
| metazooDRAFT_14756782 | 3300002471 | Lake | MVTTDKYVNDILEKAQKLLWSGSETENIEAHNMIAALIKDRMSLTN* |
| B570J40625_10000017946 | 3300002835 | Freshwater | MKMSDQYINDQLSKAQALLWSGSLHEVDEAHNIVSNLIRDRLEQVSN* |
| B570J40625_1000238037 | 3300002835 | Freshwater | MQQTDKYINEQLSKAQALLWSGSLHEQDEAHNIIAKLINDRMGKAEGQND* |
| B570J40625_1000625164 | 3300002835 | Freshwater | MKMTDEYINDQLNTAQKLLWGGSETENIEAHNIIAKLIKDRVEQTNLV* |
| B570J40625_1002346655 | 3300002835 | Freshwater | MKTSDRYVDDQLSKAQALLWSGSLHEVDEAHNIISNLILDRMEQTDLT* |
| B570J40625_1002420547 | 3300002835 | Freshwater | MKMSDEYINDQLNKAQKLLWGGSETENIEAHNIISKLIRDRMEGDEGQND* |
| B570J40625_1002627392 | 3300002835 | Freshwater | MKMSDEYLNDQLSKAQALLWGGSETENIEAHNIISKLIKDKVEQVGL* |
| B570J40625_1002733692 | 3300002835 | Freshwater | MQMTNEYINDQLNKAQKLLWGGSETENIEAHNIIARLIKDREHLIQNS* |
| B570J40625_1004333212 | 3300002835 | Freshwater | MKMSDEYLNDQLSKAQALLWGGSETENIEAHNIIAKLIKDKVEQVGL* |
| B570J40625_1004479383 | 3300002835 | Freshwater | KMSDRYVNDQLNKAQKLLWGGSETENIEAHNMIAQLIKDREDLIEHS* |
| B570J40625_1006090771 | 3300002835 | Freshwater | MKMSDTYINDQLSRAQELLWGGSETENIEAHNIISKLIRDRVEQTEGQ* |
| B570J40625_1007044182 | 3300002835 | Freshwater | MKMSDEYINDQLNKAQKLLWGGSETENIEAHNIIAKLIKDRVEQVGL* |
| B570J40625_1012615821 | 3300002835 | Freshwater | MKMSDEYLNDQLSKAQKLLWGGSETENIEAHNIIAKLIKDKIEQVGL* |
| B570J40625_1017401402 | 3300002835 | Freshwater | MQQTDIYINEQLNKAQKLLWSGSLHEQDEAHNIIAKLIKDRMPDA* |
| JGI25908J49247_100175784 | 3300003277 | Freshwater Lake | MKMSDKYLNDQLSTAQKLLWGGSETENIEAHNIIAKLIKDKIEQAEL* |
| JGI25908J49247_100922952 | 3300003277 | Freshwater Lake | MQQTDHYINTELSKAQALLWSGSLHEVDEAHNIISNLIQDRMGKAEGTNV* |
| JGI25908J49247_100983012 | 3300003277 | Freshwater Lake | MKMSDEYLNERLNTAQKLLWGGSETENIEAHNIISKLIQDRMAWEEGTNV* |
| JGI25908J49247_101518222 | 3300003277 | Freshwater Lake | MKMSDEYLNERLNTAQKLLWGGSETENIEETENIEAHNIISKLIQDRMAWEEGTNV* |
| JGI25910J50241_1000016948 | 3300003388 | Freshwater Lake | MSDKYLNDQLSTAQKLLWGGSETENIEAHNIIAKLIKDKIEQAEL* |
| JGI25910J50241_101720362 | 3300003388 | Freshwater Lake | MRMSDIYINDQLSKAQALLWSGSLHEVDEAHNIVSNLIRDRLEQVSN* |
| JGI25922J50271_100018993 | 3300003413 | Freshwater Lake | MKMSDVYINDQLNKAQQLLWGGSETENIEAHNIIAKLIKDRIEQTDLS* |
| JGI25922J50271_100079415 | 3300003413 | Freshwater Lake | MKMSDKYLNDQLSKAQKLLWGGSETENIEAHNIISKLIKEKIEQVEL* |
| JGI25922J50271_100090087 | 3300003413 | Freshwater Lake | MKMSDKYLNDQLSKAQKLLWGGSETENIEAHNIIAKLIKDKIEQVEL* |
| JGI25922J50271_100145903 | 3300003413 | Freshwater Lake | MKMSDNYLNDQLNKAQKLLWSGSLHEQDEAHNIIAKLIKDRIEQADLT* |
| JGI25922J50271_100364405 | 3300003413 | Freshwater Lake | DIYINEQLNKAQKLLWGGSETENIEAHNIIAKLIKDRMSEQEGTNE* |
| JGI25922J50271_100472993 | 3300003413 | Freshwater Lake | MKMSDAYLNDQLNTAQKLLWGGSETENIEAHNIIAKLIKDRIEQADLL* |
| JGI25922J50271_100571763 | 3300003413 | Freshwater Lake | MKMSDEYLNDQLSKAQKLLWGGSETENIEAHNIIAKLIKDKIEQVRL* |
| JGI25922J50271_100627143 | 3300003413 | Freshwater Lake | MKMSDKYLNDQLSKAQKLLWGGSETENIEAXNXISKLIKEKIEQVEL* |
| JGI25922J50271_100750132 | 3300003413 | Freshwater Lake | MRMSDQYINDQLNTAQKLLWGGSETENIEAHNIIAKLIKDRIEQVDLS* |
| JGI25922J50271_101016722 | 3300003413 | Freshwater Lake | MRMSDNYINDQLSTAQKLLWGGSETENIEAHNIISKLIQDRVEQTDQI* |
| JGI25922J50271_101174842 | 3300003413 | Freshwater Lake | MSDEYINDQLNTAQKLLWGGSETENIAAHNIISKLIKDRVEQTDLV* |
| JGI25914J50564_100158545 | 3300003429 | Freshwater Lake | MKMSDVYINDQLNKAQQLLWGGSETENIEAHNIIAKLIKDRIEQTDLL* |
| JGI25914J50564_100538932 | 3300003429 | Freshwater Lake | MRMSDNYLNDQLNTAQKLLWGGSETENIEAHNIIAKLINDRIEQADLS* |
| JGI25914J50564_100567541 | 3300003429 | Freshwater Lake | MRMSDNYINDQLNTAQKLLWGGSETENIEAHNIIAKLISDRIEQVDPS* |
| JGI25921J50272_1000076732 | 3300003430 | Freshwater Lake | MSDVYINDQLNKAQQLLWGGSETENIEAHNIIAKLIKDRIEQTDLS* |
| JGI25921J50272_100069577 | 3300003430 | Freshwater Lake | MKMSDQYIDEVLNKAQKLLWGGSETENIEAHNLIAKLIKDRMEDAEV* |
| JGI25921J50272_100268723 | 3300003430 | Freshwater Lake | MKMSDAYINDQLNKAQQLLWGGSETENIEAHNIIAKLIKDRIEQVGDRG* |
| JGI25921J50272_100320174 | 3300003430 | Freshwater Lake | MQMSDIYINEQLNKAQKLLWSGSLHEQDEAHNIIAKLIKDRMPDA* |
| JGI25921J50272_100336032 | 3300003430 | Freshwater Lake | MQMSDIYINEQLNKAQKLLWGGSETENIEAHNIIAKLIKDRMSEQEGTNE* |
| JGI25921J50272_100373272 | 3300003430 | Freshwater Lake | MKMSDIYINDQLSKAQALLWSGSLHEVDEAHNIVSNLIRDRLEQVSN* |
| JGI25921J50272_100456173 | 3300003430 | Freshwater Lake | MKMSDQYIDEVLNKAQKLLWGGSETENIEAHNLISKLIKDRMEDVSN* |
| JGI25921J50272_100474553 | 3300003430 | Freshwater Lake | MQMSDIYINEQLNKAQKLLWGGSETENIEAHNIIAKLIKDRMSEQEGQNV* |
| JGI25921J50272_100682762 | 3300003430 | Freshwater Lake | MKMSDTYINDQLSTAQKLLWGGSETENIEAHNIISKLIRDRIEQTEGQ* |
| JGI25921J50272_100914692 | 3300003430 | Freshwater Lake | MKMSDPYIDEQLNKAQKLLWGGSETENIEAHNIISKLIRDRMERDEGTNDSL* |
| JGI25921J50272_101176662 | 3300003430 | Freshwater Lake | MSDQYIDDVLNRAQKLLWGGSETENIEAHNMIAKLIKDRMSEKEGTNE* |
| JGI25926J51410_10351321 | 3300003490 | Freshwater Lake | TKMRMSDQYINDQLSKAQALLWSGSLHEVDEAHNIVSKLIQDRIEQTDLA* |
| JGI25924J51412_10286873 | 3300003491 | Freshwater Lake | NDQLSKAQALLWSGSLHEVDEAHNIVSNLIQDRLEQVSN* |
| JGI25924J51412_10468711 | 3300003491 | Freshwater Lake | MRMSDQYINDQLSKAQALLWSGSLHEVDEAHNIVSKLIQDRIEQTDLA* |
| JGI25923J51411_10377091 | 3300003493 | Freshwater Lake | MRMSDIYINDQLSKAQALLWSGSLHEVDEAHNIVSDLIRDRLEQVSN* |
| JGI25923J51411_10712692 | 3300003493 | Freshwater Lake | MRISDNYLNDQLNTAQALLWSGSLHEVDEAHNIIAKLISDRIEQVXPS* |
| JGI25925J51416_100782862 | 3300003497 | Freshwater Lake | MRMSDIYINDQLSKAQALLWSGSLHEVDEAHNIVSNLIQDRLEQVSN* |
| JGI25925J51416_101125393 | 3300003497 | Freshwater Lake | MSDIYINERLNTAQKLLWGGSETENIEAHNIISKLIQDRNAWEEGTNE* |
| JGI25930J51415_10092976 | 3300003499 | Freshwater Lake | MKMSDTYINDQLSKAQQLLWGGSETENIEAHNIISKLIRDRIEQTEGQ* |
| JGI25930J51415_10101192 | 3300003499 | Freshwater Lake | MKMSDAYINDQLNKAQQLLWGGSETENIEAHNIIAKLIKDRIEQTEGQ* |
| JGI25930J51415_10184094 | 3300003499 | Freshwater Lake | MKQTDKYINEQLSKAQALLWSGSLHEQDEAHNIIAKLINDRMGKAEGQND* |
| JGI25930J51415_10649482 | 3300003499 | Freshwater Lake | MQQTDKYINEQLSKAQALLWSGSLHEQDEAHNIIAKLIKDRMSEREGTNE* |
| Ga0063233_102155093 | 3300003986 | Freshwater Lake | MKMSDIYINDQLNKAQKLLWGGSETENIEAHNIISKLIQDRMAWEEGTNE* |
| Ga0063232_100620263 | 3300004054 | Freshwater Lake | MKMSDEYINDQLNKAQTLLWGGSETENIEAHNIIAKLIKDRVEQTNLI* |
| Ga0063232_100834422 | 3300004054 | Freshwater Lake | MMRRKKMKMSDVYINDQLNKAQQLLWGGSETENIEAHNIIAKLIKDRIEQTDLS* |
| Ga0063232_102750461 | 3300004054 | Freshwater Lake | LWTQCLKKKRKKTKMKMSDNYINDQLNTAQKLLWGGSETENIEAHNIIAKLISDRIEQADLS* |
| Ga0066177_101301911 | 3300004096 | Freshwater Lake | NDQLDKAQKLLWGGSETENIEAHNIIAKLIKDREDLIEHS* |
| Ga0066177_102506321 | 3300004096 | Freshwater Lake | MSDPYIDEQLNKAQKLLWGGSETENIEAHNIISKLIRDRMSGDEGTNESL* |
| Ga0066177_103129113 | 3300004096 | Freshwater Lake | MSDVYINDQLNTAQKLLWGGSETENIAAHNIISKLIKDIVEQIDQI* |
| Ga0066177_105417961 | 3300004096 | Freshwater Lake | KMKKRRTKMKMSDKYLNDQLSTAQKLLWGGSETENIEAHNIIAKLIKDKIEQVEL* |
| Ga0066178_100630331 | 3300004124 | Freshwater Lake | MTGMRTKMKMSDEYINDQLNKAQTLLWGGSETENIEAHNIIAKLIKDRVEQTNLI* |
| Ga0066182_101652632 | 3300004125 | Freshwater Lake | MKMSDIYINERLNTAQKLLWGGSETENIEAHNIISKLIQDRMAWEEGTNE* |
| Ga0066179_102179363 | 3300004126 | Freshwater Lake | SDEYLNERLNTAQKLLWGGSETENIEAHNIISKLIQDRMAWEEGTNE* |
| Ga0007787_106266912 | 3300004240 | Freshwater Lake | MQMSDIYINEQLNKAQQLLWGGSETENIEAHNIIAKLIKDRMSDKGE* |
| Ga0007791_100786051 | 3300004772 | Freshwater | MKMSEHYINNQLSIAQKLLWGGSETENIAAHNIIAKLLKDLGLDEDQE* |
| Ga0007764_116987273 | 3300004797 | Freshwater Lake | MKMSDTYINDQLNKAQQLLWGGSETENIEAHNIIAKLISDRIEQADVL* |
| Ga0007759_114354151 | 3300004836 | Freshwater Lake | NDQLNTAQKLLWGGSETENIEAHNIIAKLISDRIEQVDPS* |
| Ga0071350_10097064 | 3300005069 | Freshwater | MSDIYINEQLNKAQKLLWGGSETENIEAHNIIAKLIKDRLGNDE* |
| Ga0070374_100589386 | 3300005517 | Freshwater Lake | MKMSDRYLNDQLDKAQKLLWGGSETENIEAHNIIAKLIKDREDLIEHS* |
| Ga0070374_100797686 | 3300005517 | Freshwater Lake | MKMSDEYINDQLNTAQKLLWGGSETENIAAHNIISKLIKDRVEQTDLV* |
| Ga0070374_101219762 | 3300005517 | Freshwater Lake | MKMSDTYINDQLNKAQQLLWGGSETENIEAHNIIAKLIKDRIEQTDLL* |
| Ga0070374_101309063 | 3300005517 | Freshwater Lake | MRMSDEYINDQLSTAQKLLWGGSETENIEAHNIISKLIKDRVEQVYN* |
| Ga0070374_101598702 | 3300005517 | Freshwater Lake | MKMSDAYINDQLNTAQKLLWGGSETENIEAHNIIAKLIKDRIEQTDLI* |
| Ga0070374_101891994 | 3300005517 | Freshwater Lake | MMRRKKMKMSDTYINDQLNKAQKLLWGGSETENIEAHNIISKLIKDRVEQVDQI* |
| Ga0070374_102099644 | 3300005517 | Freshwater Lake | MKMTDEYINDQLSTAQKLLWGGSETENIEAHNIIAKLIKDRV |
| Ga0070374_102347483 | 3300005517 | Freshwater Lake | MKMSDEYLNDQLSKAQALLWGGSETENIEAHNIISKLIKDKIEQVGL* |
| Ga0070374_102582361 | 3300005517 | Freshwater Lake | INDQLSKAQALLWSGSLHEVDEAHNIVSDLIRDRLEQVSN* |
| Ga0070374_102739731 | 3300005517 | Freshwater Lake | MKMSDEYLNERLNTAQKLLWGGSETENIEAHNIISKLIQDRMAW |
| Ga0070374_103192522 | 3300005517 | Freshwater Lake | MKMSDKYLNDQLSTAQKLLWGGSETENIEAHNIIAKLIKDKIEQVEL* |
| Ga0070374_103274732 | 3300005517 | Freshwater Lake | MKMSDVYLNDQLNKAQQLLWGGSETENIEAHNIIAKLISDRIEQADLS* |
| Ga0070374_104796113 | 3300005517 | Freshwater Lake | KMKMSDIYINDQLSKAQALLWSGSLHEVDEAHNIISKLIRDRMEGDEGQND* |
| Ga0070374_105391752 | 3300005517 | Freshwater Lake | MKMSDTYINDQLNKAQKLLWGGSETENIEAHNIISKLIRDRIEQTEGQ* |
| Ga0070374_105879012 | 3300005517 | Freshwater Lake | MKMSDVYINDQLNTAQKLLWGGSETENIAAHNIISKLIKDRVEQI* |
| Ga0070374_106466921 | 3300005517 | Freshwater Lake | MKMSDQYINDQLSKAQALLWSGSLHEVDEAHNIVSNLIR |
| Ga0070374_106928991 | 3300005517 | Freshwater Lake | MKMSDTYINDQLNKAQKLLWGGSETENIEAHNIISKLIK |
| Ga0068877_103439032 | 3300005525 | Freshwater Lake | MKMSDDYINDQLNKAQKLLWGGSETENIEAHNIISKLIKDKIEQVS* |
| Ga0068877_104892142 | 3300005525 | Freshwater Lake | MQQTDKYINEQLSKAQKLLWGGSETENIEAHNIISKLIKDRMSEQEGTNE* |
| Ga0068876_100277875 | 3300005527 | Freshwater Lake | MKMTKEFINLKLNEAQQLLWGGSETENIAAHNIIAELIKDLQDEQ* |
| Ga0068876_100941031 | 3300005527 | Freshwater Lake | KMQMSDIYINEQLNKAQKLLWGGSETENIEAHNIIAKLIKDRLGNDE* |
| Ga0068876_101110394 | 3300005527 | Freshwater Lake | RTKMKMSDEYINEQLSKAQKLLWSGSLHEVDEAHNIVSNLIKDRVEQVSN* |
| Ga0068876_101811951 | 3300005527 | Freshwater Lake | MQQTDIYINDQLSKAQALLWSGSLHEVDEAHNIIAKLINDRMGKSEGQNDSL* |
| Ga0068876_102143051 | 3300005527 | Freshwater Lake | YINDQLNKAQQLLWGGSETENIEAHNIISKLIRDRVEQTEGQ* |
| Ga0068876_102786434 | 3300005527 | Freshwater Lake | MQQTDKYINEQLSKAQALLWSGSLHEVDEAHNIIAKLINDRMSEKEGTNV* |
| Ga0068876_103273364 | 3300005527 | Freshwater Lake | MQQTDKYINEQLSKAQALLWSGSLHEQDEAHNIIAKLIKDRMGETEGQNV* |
| Ga0068876_104066383 | 3300005527 | Freshwater Lake | MKMSDTYINDQLNKAQKLLWGGSETENIEAHNIIAKLIKDRIEQTEGQ* |
| Ga0068876_105016581 | 3300005527 | Freshwater Lake | MQQTDIYINDQLSKAQKLLWSGSLHEVDEAHNIIAKLINDRMGKSEGQNDSL* |
| Ga0068872_100631641 | 3300005528 | Freshwater Lake | KKMQMSDIYINEQLNKAQKLLWGGSETENIEAHNIIAKLIKDRLGNDE* |
| Ga0068872_101021105 | 3300005528 | Freshwater Lake | MKMSDAYINDQLNKAQQLLWGGSETENIEAHNIISKLIRDRVEQTEGQ* |
| Ga0068872_101170191 | 3300005528 | Freshwater Lake | MKMSDAYINDQLNKAQQLLWGGSETENIEAHNIISKLIR |
| Ga0068872_101465432 | 3300005528 | Freshwater Lake | MQQTDLYINEQLQAAQKLLWSGSLHEVDEAHNIISNLIRDRMSNLSDKGN* |
| Ga0068872_101879334 | 3300005528 | Freshwater Lake | MEMTNIYIDQQLNRAQQLLWGGSETENIEAHNIIAKLIKDRMSDKGE* |
| Ga0068872_105901742 | 3300005528 | Freshwater Lake | MKMSDEYINEQLSKAQKLLWSGSLHEVDEAHNIVSNLIKDRIEQVSN* |
| Ga0049083_100146529 | 3300005580 | Freshwater Lentic | MKMSDRYVNDQLNKAQKLLWGGSETENIEAHNMIAQLIKDREDLIEHS* |
| Ga0049083_100302018 | 3300005580 | Freshwater Lentic | MRMSDIYINDQLSKAQALLWSGSLHEVDEAHNIVSNL |
| Ga0049083_100329014 | 3300005580 | Freshwater Lentic | MKMSDRYVNDQLDKAQKLLWGGSETENIEAHNIIAKLIKDREDLIEHS* |
| Ga0049083_100730992 | 3300005580 | Freshwater Lentic | MRMSDNYLNDQLNKAQELLWGGSETENIEAHNIIAKLISDRIVQVKNS* |
| Ga0049083_102190131 | 3300005580 | Freshwater Lentic | ELSKAQALLWSGSLHEVDEAHNIISNLIQDRMGKAEGTNV* |
| Ga0049081_102235811 | 3300005581 | Freshwater Lentic | EQLSKAQALLWSGSLHEVDEAHNIIAKLINDRMSEKEGTNV* |
| Ga0049081_102616682 | 3300005581 | Freshwater Lentic | MKMSDIYINEQLSKAQALLWSGSLHEVDEAHNIIAKLINDRMEKAEGQND* |
| Ga0049081_103263792 | 3300005581 | Freshwater Lentic | MKMSDQYINEQLSKAQALLWSGSLHEQDEAHNIIAKLINDRMEKAEGQND* |
| Ga0049080_100193814 | 3300005582 | Freshwater Lentic | MQQTDNHINTELSKAQALLWSGSLHEVDEAHNIISNLIKDRMGKAEGTNV* |
| Ga0049080_100846545 | 3300005582 | Freshwater Lentic | MKMSDEYINEQLSKAQALLWSGSLHEQDEAHNIIAKLINDRMEKAEGQND* |
| Ga0049080_102042291 | 3300005582 | Freshwater Lentic | RKKKMKMSDIYINDQLSKAQALLWSGSLHEVDEAHNIVSKLIQDRMAWEEGTNV* |
| Ga0049080_102850242 | 3300005582 | Freshwater Lentic | MEMSDIYINDQLNKAQKLLWGGSETENIEAHNIISKLIQDRMAWDEGTNV* |
| Ga0049085_100142595 | 3300005583 | Freshwater Lentic | MKMSDAYLNAQLDTAQKLLWGGSETENIEAHNIISKLIYDRIEQTE* |
| Ga0049085_100937202 | 3300005583 | Freshwater Lentic | MRISDNYLNDQLNTAQALLWSGSLHEVDEAHNIIAKLISDRIEQVDPS* |
| Ga0049085_101197472 | 3300005583 | Freshwater Lentic | MKMSDKYLNEQLDIAQKLLWGGSETENIEAHNIISKLIYDRIEQVNL* |
| Ga0049085_101958731 | 3300005583 | Freshwater Lentic | MKMSDEYLNDQLSKAQKLLWGGSETENIEAHNMIAKLIKDREDLIKNS* |
| Ga0049082_100226543 | 3300005584 | Freshwater Lentic | MKMSDEYLNDQLSKAQKLLWGGSETENIEAHNMIAQLIKDREDLIQHS* |
| Ga0049082_100403023 | 3300005584 | Freshwater Lentic | MRMSDNYINDQLSTAQKLLWSGSETENIAAHNIISKLIQDRVEQADQN* |
| Ga0049082_100423481 | 3300005584 | Freshwater Lentic | MKMSDTYVNDQLSIAQALLWSGSLHEVDEAHNIISKLIRDRVEQTEGQ* |
| Ga0049082_100456353 | 3300005584 | Freshwater Lentic | MRMSDNYINDQLNTAQKLLWGGSETENIEAHNIIAKLISDRIEQQDQS* |
| Ga0049084_101286883 | 3300005585 | Freshwater Lentic | MKMSDIYINEQLSKAQALLWSGSLHEVDEAHNIISNLIQDRMGKAEGTNV* |
| Ga0078894_101008835 | 3300005662 | Freshwater Lake | MEMSDKYLNDQLSKAQELLWGGSETENIEAHNIISKLIKDRLGDE* |
| Ga0078894_101380097 | 3300005662 | Freshwater Lake | MKMSDVYLNDQLNKAQQLLWGGSETENIEAHNIIAKLIKDRIEQADLS* |
| Ga0078894_101819742 | 3300005662 | Freshwater Lake | MRMSDEYINDQLSTAQKLLWGGSETENIEAHNIIARLIKDRVEQTNLT* |
| Ga0078894_101840394 | 3300005662 | Freshwater Lake | MKMSDEYINDQLSKAQTLLWGGSETENIEAHNIISKLIRDRVEQVGL* |
| Ga0078894_102117043 | 3300005662 | Freshwater Lake | MKMSDEYINDQLSKAQQLLWGGSETENIEAHNIISKLIRDRVEQISI* |
| Ga0078894_102205537 | 3300005662 | Freshwater Lake | MKMSDQYIDDVLNRAQKLLWGGSETENIEAHNMIAKLIKDRMSEKEGTNE* |
| Ga0078894_102472513 | 3300005662 | Freshwater Lake | MKMSDQYIDEVLNKAQKLLWGGSETENIEAHNLISKLIKDRVEQVSN* |
| Ga0078894_102519203 | 3300005662 | Freshwater Lake | MKMSDIYINDQLNKAQKLLWGGSETENIEAHNIISKLIRDRMSGDEGTNESL* |
| Ga0078894_102758613 | 3300005662 | Freshwater Lake | MKMSDEYINDQLNRAQQLLWGGSETENIEAHNIIAKLIKDRVEQINLI* |
| Ga0078894_103196414 | 3300005662 | Freshwater Lake | MKMSDTYINDQLNKAQQLLWGGSETENIEAHNIIAKLIKDRIEQTEGQ* |
| Ga0078894_103237564 | 3300005662 | Freshwater Lake | MKMSDKYLNDQLSKAQKLLWGGSETENIEAHNIIAKLIKEKIEQVEL* |
| Ga0078894_103275545 | 3300005662 | Freshwater Lake | MKMSDTYINDQLSKAQALLWSGSLHEVDEAHNIVSNLIRDRVEQVDQI* |
| Ga0078894_103981654 | 3300005662 | Freshwater Lake | MKMSDKYLNDQLSKAQKLLWGGSETENIEAHNIISKLIKERIEQVEL* |
| Ga0078894_104855683 | 3300005662 | Freshwater Lake | MKMSDTYINDQLNKAQQLLWGGSETENIEAHNIISKLIRDRIEQTEGQ* |
| Ga0078894_104994043 | 3300005662 | Freshwater Lake | MKMSDQYINDQLNKAQQLLWGGSETENIEAHNIISKLIRDRIEQTEGL* |
| Ga0078894_105272974 | 3300005662 | Freshwater Lake | MKMSDPYIDEQLNKAQKLLWGGSETENIEAHNIISKLIRDRMSGDEGTNESL* |
| Ga0078894_106566202 | 3300005662 | Freshwater Lake | MKMSDIYINDQLNKAQKLLWGGSETENIEAHNIISKLIRDRMEGDEGQND* |
| Ga0078894_108653241 | 3300005662 | Freshwater Lake | MKMSDKYLNDQLSKAQALLWGGSETENIEAHNIIAKLIKDKIEQVEL* |
| Ga0078894_109283122 | 3300005662 | Freshwater Lake | MKMSDRYVDDQLSKAQALLWSGSLHEVDEAHNIISKLIRDRMEGDEGQND* |
| Ga0078894_109757482 | 3300005662 | Freshwater Lake | MKMSDSYINDQLNKAQQLLWGGSETENIEAHNIISKLIKDRIEQVGDRG* |
| Ga0078894_110079352 | 3300005662 | Freshwater Lake | MKMSDKYINDQLSTAQKLLWGGSETENIEAHNIIAKLIKDRIEQVEL* |
| Ga0078894_112012982 | 3300005662 | Freshwater Lake | MKMSDQYINEQLNKAQQLLWGGSETENIEAHNIISKLIRDRIEQVGDRG* |
| Ga0078894_112165882 | 3300005662 | Freshwater Lake | MKMSDKYLNDQLSKAQALLWGGSETENIEAHNIISKLIKDKVEQVEL* |
| Ga0078894_112770281 | 3300005662 | Freshwater Lake | MKMSDIYINDQLNKAQKLLWGGSETENIEAHNIIS |
| Ga0078894_112908703 | 3300005662 | Freshwater Lake | MTTGKKTKMKMSDQYINDQLSKAQALLWSGSLHEVDEAHNIVSNLIRDRLEQVSN* |
| Ga0078894_113138452 | 3300005662 | Freshwater Lake | MSDQYLNEQLSKAQQLLWGGSETENIEAHNIIARLIKDRMDGAGGENE* |
| Ga0078894_114309991 | 3300005662 | Freshwater Lake | MKMSDTYINDQLSTAQKLLWGGSETENIEAHNIISKLIRD |
| Ga0078894_115275502 | 3300005662 | Freshwater Lake | MRMSDIYINDQLSKAQALLWSGSLHEVDEAHNIISNLIRDRLEQVSN* |
| Ga0078894_115587782 | 3300005662 | Freshwater Lake | MKTSDRYVNDQLSKAQALLWSGSLHEVDEAHNIISNLILDRIEQTDQI* |
| Ga0078894_115634792 | 3300005662 | Freshwater Lake | MKMSDDYLNDQLNKAQALLWGGSETENIEAHNIISKLIKDRVEQVGL* |
| Ga0078894_115766143 | 3300005662 | Freshwater Lake | MTVSDQYVNKVLSEAQALLWGGSETENIAAHNMIAKLIKD |
| Ga0078894_115819122 | 3300005662 | Freshwater Lake | MKMTDEYINDQLNKAQQLLWGGSETENIEAHNIIAKLIKDRVEQTNLV* |
| Ga0078894_116963661 | 3300005662 | Freshwater Lake | DTYINDQLNKAQQLLWGGSETENIEAHNIIAKLIKDRIEQADLL* |
| Ga0078894_117123231 | 3300005662 | Freshwater Lake | DTYINDQLNKAQQLLWGGSETENIEAHNIIAKLIKDRIEQTDLL* |
| Ga0078894_117780242 | 3300005662 | Freshwater Lake | MKMSDKYLNDQLSKAQKLLWGGSETENIEAHNIIAKLIKDRIEQVGL* |
| Ga0078894_117902032 | 3300005662 | Freshwater Lake | MKMSDKYINDQLSTAQKLLWGGSETENIEAHNIISKLIKDKIEQVEL* |
| Ga0079957_10171462 | 3300005805 | Lake | MQQTDLYINERLQAAQKLLWSGSLHEVDEAHNIISDLIRDRMSDLSDKGN* |
| Ga0079957_10405434 | 3300005805 | Lake | MQQTDKYINEQLSKAQALLWSGSLHEVDEAHNIIAKLINDRMGKAEGQNV* |
| Ga0070743_1000115127 | 3300005941 | Estuarine | MKMSDRYVNDQLDKAQKLLWGGSETENIEAHNIIAKLIKDRIEQTNLT* |
| Ga0070743_100501852 | 3300005941 | Estuarine | MKMSDKYLNDQLSKAQALLWGGSETENIEAHNIISKLIRDKIEQVEL* |
| Ga0070743_100581352 | 3300005941 | Estuarine | MKMSDAYLNDRLDKAQKLLWGGSETENIEAHNIIAELIKDRIEQTN* |
| Ga0070743_100782523 | 3300005941 | Estuarine | MKMSDQYINDQLNKAQQLLWGGSETENIEAHNIISKLIKDRIEQVGDRG* |
| Ga0070743_102071452 | 3300005941 | Estuarine | MRMSDNYINDQLNKAQKLLWGGSETENIEAHNIISKLIQDRNAWEEGTNE* |
| Ga0070743_102619762 | 3300005941 | Estuarine | MKMSDQYVDEILNKAQKLLWGGSETENIEAHNLIAKLIKDRMEDAEV* |
| Ga0070743_102812402 | 3300005941 | Estuarine | MKMSDEYLNDQLNIAQKLLWGGSETENIEAHNIISKLIKDRVEQI* |
| Ga0075470_100158257 | 3300006030 | Aqueous | MKMTDNYINERLNKAQQLLWGGSETENIEAHNIIAELIKDRIEQTEGI* |
| Ga0075470_100212644 | 3300006030 | Aqueous | MKMSDNYINEQLSKAQQLLWGGSETENIEAHNIISKLIKDKVEQVEQ* |
| Ga0070744_1000008318 | 3300006484 | Estuarine | MRMSDNYINDQLNKAQKLLWGGSETENIEAHNIISKLIKDRVEQTDQI* |
| Ga0070744_1000041422 | 3300006484 | Estuarine | MRSLKMMRRNQMKMSDIYLNDQLDKAQKLLWGGSETENIEAHNIIAKLISDRIEQADLS* |
| Ga0070744_100104008 | 3300006484 | Estuarine | MKMSDEYLNDQLSKAQALLWGGSETENIEAHNIIAKLIKDKIEQVGL* |
| Ga0070744_100145706 | 3300006484 | Estuarine | MQQADHYINQELSKAQALLWSGSLHEVDEAHNIISNLIKDRMGKAEGTNV* |
| Ga0070744_100262862 | 3300006484 | Estuarine | MRMSDNYLNDQLNTAQKLLWGGSETENIEAHNIIAKLISDRIEQADLS* |
| Ga0070744_100287635 | 3300006484 | Estuarine | QCLKMMRRKKMKMSDEYINDQLSTAQKLLWGGSETENIEAHNIISKLIKDRVEQVSN* |
| Ga0070744_100320906 | 3300006484 | Estuarine | MKMSDEYINDQLNKAQKLLWGGSETENIAAHNIISKLIKDRMQHSQPGAE* |
| Ga0070744_100436064 | 3300006484 | Estuarine | MQMSDIYINEQLNKAQKLLWGGSETENIEAHNIISKLIKDRMSEQEGTNE* |
| Ga0070744_100532852 | 3300006484 | Estuarine | MSDNYLNDQLNTAQKLLWGGSETENIEAHNIIAKLIKDRIEQTNLT* |
| Ga0070744_100665144 | 3300006484 | Estuarine | MKMSDPYINDQLNKAQKLLWGGSETENIEAHNIIAKLIKDRMEGNEGENDSL* |
| Ga0070744_100768343 | 3300006484 | Estuarine | MQQTDKYINEQLSKAQALLWSGSLHEQDEAHNIIAKLINDRMEKAEGQND* |
| Ga0070744_100838453 | 3300006484 | Estuarine | MKMSDEYINDQLNKAQKLLWGGSETENIEAHNIISKLIRDRMSGDEGTND* |
| Ga0070744_100934052 | 3300006484 | Estuarine | MQQTDHYINTELSKAQALLWSGSLHEVDEAHNIISNLIQDRMGKAEGTNDSL* |
| Ga0070744_101005861 | 3300006484 | Estuarine | MKMSDIYINDQLNKAQKLLWGGSETENIEAHNIISKLIRDRMERDEGTN |
| Ga0070744_101500491 | 3300006484 | Estuarine | MEMTNEYINDRLNIAQQLLWGGSETENIEAHNIIAELIKDRIETVGAK* |
| Ga0070744_101832522 | 3300006484 | Estuarine | MKMSDEYLNDQLSKAQALLWGGSETENIEAHNIIAKLIKDKIEQVEL* |
| Ga0070744_101854952 | 3300006484 | Estuarine | MEMSDIYINERLNTAQKLLWGGSETENIEAHNIISKLIQDRMAWEEGTNV* |
| Ga0070744_102143771 | 3300006484 | Estuarine | MKMSDVYINDQLNKAQQLLWGGSETENIEAHNIIAKLIKDRIEQ |
| Ga0075471_101452162 | 3300006641 | Aqueous | MKMSDEYINDQLNKAQQLLWGGSETENIEAHNIIAKLIKDRVEQVNLI* |
| Ga0075471_102571802 | 3300006641 | Aqueous | MKMSDAYINDQLNKAQKLLWGGSETENIEAHNIIAKLIKDRIEQTEGQ* |
| Ga0075464_110488311 | 3300006805 | Aqueous | WTQCSKKKRRKTKMRMSDNYINDQLNKAQKLLWGGSETENIEAHNIISKLIQDRVEQTDQI* |
| Ga0075473_103917122 | 3300006875 | Aqueous | MKMSDTYINDQLNKAQKLLWGGSETENIEAHNIISKLIRDRVEQTEGQ* |
| Ga0075472_104607122 | 3300006917 | Aqueous | MKMSDEYLNNQLSRAQELLWGGSETENIEAHNIIAKLIKDRVEQTNLI* |
| Ga0079300_1000045645 | 3300007162 | Deep Subsurface | MRRKKMKMSDEYINDQLNKAQKLLWGGSETENIEAHNIISKLIRDRMEGDEGQND* |
| Ga0079300_101385963 | 3300007162 | Deep Subsurface | MKMSDQYINDQLNKAQKLLWGGSETENIEAHNIIAKLIKDRVEQVNLI* |
| Ga0079300_102114821 | 3300007162 | Deep Subsurface | IYINEQLNKAQKLLWGGSETENIEAHNIIAKLIKDRMSEQEGQNV* |
| Ga0079302_10683953 | 3300007165 | Deep Subsurface | MKMSDPYIDEQLNKAQKLLWGGSETENIEAHNIISKLIRDRMSGDEGTNGSL* |
| Ga0075458_100803723 | 3300007363 | Aqueous | MSDIYINEQLNKAQKLLWSGSLHEQDEAHNIIAKLIKDRMPDA* |
| Ga0102853_10201643 | 3300007543 | Estuarine | MSDDYINDQLNKAQKLLWGGSETENIEAHNIISRLIKDKIEQVS* |
| Ga0102853_10283981 | 3300007543 | Estuarine | MSDAYLNDQLNTAQKLLWGGSETENIEAHNIIAQLIKDRIEQADLL* |
| Ga0102853_10677792 | 3300007543 | Estuarine | MSDIYLNDQLDKAQKLLWGGSETENIEAHNIIAKLISDRIEQADLS* |
| Ga0102861_10143213 | 3300007544 | Estuarine | MSDVYINDQLNKAQQLLWGGSETENIEAHNIISKLISDRMEQVDL* |
| Ga0102861_11201151 | 3300007544 | Estuarine | KKKRRTKMQQTDNYINEQLSKAQALLWSGSLHEQDEAHNIIAKLINDRMGKSEGQNDSL* |
| Ga0102873_100180216 | 3300007545 | Estuarine | MKMSDVYINDQLNKAQQLLWGGSETENIEAHNIIAKLIKDRIEQTDLT* |
| Ga0102873_10160429 | 3300007545 | Estuarine | KTKRRKKMEMSDIYINERLNTAQKLLWGGSETENIEAHNIISKLIKDRVEQTDQI* |
| Ga0102873_10352804 | 3300007545 | Estuarine | MSDVYINDQLNKAQKLLWGGSETENIEAHNIIAELIKDRIEQTN* |
| Ga0102873_12028453 | 3300007545 | Estuarine | MSDNYLNDQLNKAQKLLWGGSETENIEAHNIIAELIKDRIEQANLT* |
| Ga0102874_11048723 | 3300007546 | Estuarine | MKMSDNYLNDQLNKAQKLLWGGSETENIEAHNIISKLIKDRVEQTDQI* |
| Ga0102875_11494363 | 3300007547 | Estuarine | TKMKMSDNYLNDQLNKAQKLLWGGSETENIEAHNIISKLIKDRVEQTDQI* |
| Ga0102875_12712972 | 3300007547 | Estuarine | MSDQYINDQLNTAQKLLWGGSETENIEAHNIIAKLIKDRMSEQEGQNV* |
| Ga0102877_10633061 | 3300007548 | Estuarine | MSDNYINDQLNKAQKLLWGGSETENIEAHNIISKLIKDRVEQTDQI* |
| Ga0102877_11739511 | 3300007548 | Estuarine | MRKKTKMKMSDQYLNDQLNTAQKLLWGGSETENIEAHNIIAKLIKDRIEQADLL* |
| Ga0102819_10145626 | 3300007553 | Estuarine | MSDRYVNDQLDKAQKLLWGGSETENIEAHNIIAKLIKDRIEQTNLT* |
| Ga0102820_11318701 | 3300007554 | Estuarine | MSDVYINDQLNKAQKLLWGGSETENIEAHNLIAKLIKDRMEDAEV* |
| Ga0102817_10331641 | 3300007555 | Estuarine | KKRRKTKMRMSDNYINDQLNKAQKLLWGGSETENIEAHNIISKLIKDRVEQTDQI* |
| Ga0102821_100016715 | 3300007557 | Estuarine | VNDQLDKAQKLLWGGSETENIEAHNIIAKLIKDRIEQTNLT* |
| Ga0102821_10181703 | 3300007557 | Estuarine | MRMSDIYINDQLSKAQALLWSGSLHEVDEAHNIVSNLIQDRLGNE* |
| Ga0102821_10637522 | 3300007557 | Estuarine | MRMSDQYINDQLSKAQALLWSGSLHEVDEAHNIVSNLIRDRLEQVSN* |
| Ga0102828_10013775 | 3300007559 | Estuarine | MSDNYLNDQLNTAQKLLWGGSETENIEAHNIIAKLISDRIEQADLS* |
| Ga0102828_10145812 | 3300007559 | Estuarine | MQQADHYINQQLSKAQALLWSGSLHEVDEAHNIISNLIQDRMGKAEGTNV* |
| Ga0102828_10180072 | 3300007559 | Estuarine | MSDAYLNDQLNTAQKLLWGGSETENIEAHNIIAKLIKDREDLIEHS* |
| Ga0102828_10662054 | 3300007559 | Estuarine | KMSDKYLNDQLSKAQKLLWGGSETENIEAHNIISKLIKEKIEQVEL* |
| Ga0102913_11297012 | 3300007560 | Estuarine | MSDVYINDQLNKAQKLLWGGSETENIEAHNIIAELIKDRIEQANLT* |
| Ga0102915_11444241 | 3300007562 | Estuarine | MSDRYVNDQLDKAQKLLWGGSETENIEAHNIIAELIKDRIEQTN |
| Ga0102917_11154581 | 3300007590 | Estuarine | MKMSDQYINDQLNTAQKLLWGGSETENIEAHNIIAKLIKDRVEQTDLV* |
| Ga0102918_10767632 | 3300007593 | Estuarine | MSDHYLNDQLNKAQKLLWGGSETENIEAHNIIAKLISDRIEQADLS* |
| Ga0102919_10618011 | 3300007597 | Estuarine | RKRTKMKMSDVYINDQLNKAQQLLWGGSETENIEAHNIISKLISDRMEQVDL* |
| Ga0102923_12746742 | 3300007606 | Estuarine | MSDNYLNDQLNKAQKLLWGGSETENIEAHNIIAELIKDRIEQTN* |
| Ga0102897_10292564 | 3300007617 | Estuarine | KKRKKRTKMRMSDIYINDQLSKAQALLWSGSLHEVDEAHNIVSNLIRDRLEQVSN* |
| Ga0102897_12197372 | 3300007617 | Estuarine | MSDEYINDQLNKAQTLLWGGSETENIEAHNIIAKLIKDRVEQTNLI* |
| Ga0102896_11472313 | 3300007618 | Estuarine | MSDQYLNDQLNTAQKLLWGGSETENIEAHNIIAKLIK |
| Ga0102896_12232303 | 3300007618 | Estuarine | WIQCLKKTMRRKKMKMSDQHIDAVLAEAQGLLWGGSETENIAAHNLISKLIQDRMSEKNLK* |
| Ga0102871_10442553 | 3300007620 | Estuarine | MSDNYINDQLNKAQKLLWGGSETENIEAHNIIAKLISDRIEQADLS* |
| Ga0102872_11518471 | 3300007621 | Estuarine | KRKKTKMRMSDNYINDQLNTAQKLLWGGSETENIEAHNIIAKLISDRIEQADLS* |
| Ga0102863_10495843 | 3300007622 | Estuarine | MKMSDRYVNDQLNKAQKLLWGGSETENIEAHNMIVQLIKDREDLIENS* |
| Ga0102863_10719651 | 3300007622 | Estuarine | VYINDQLNKAQQLLWGGSETENIEAHNIISKLISDRMEQVDL* |
| Ga0102878_10800783 | 3300007624 | Estuarine | TQCLRKRRKKMKMSDEYIDEILNKAQKLLWGGSETENIEAHNLISKLIKDRMGTEQTS* |
| Ga0102895_10183553 | 3300007629 | Estuarine | MSDNYINDQLNKAQKLLWGGSETENIEAHNIIAELIKDRIEQANLT* |
| Ga0102901_100304914 | 3300007634 | Estuarine | MKMSDVYINDQLNKAQQLLWGGSETENIEAHNIIAKLIKDRIEQTNLV* |
| Ga0102901_12324562 | 3300007634 | Estuarine | MSDNYLNDQLNKAQELLWGGSETENIEAHNIIAKLISDRIVQVKNS* |
| Ga0102856_10363911 | 3300007636 | Estuarine | MTDQYINDQLNTAQKLLWGGSETENIEAHNIIAKLIKDRIEQVNIS* |
| Ga0102906_11346023 | 3300007637 | Estuarine | YINDQLNKAQQLLWGGSETENIEAHNIIAKLIKDRIEQTELT* |
| Ga0102865_10671231 | 3300007639 | Estuarine | RTKMKRSDVYNNDQLNKAQQLLWGGSETENIEAHNIISKLISDRMEQVDL* |
| Ga0102865_10939784 | 3300007639 | Estuarine | MRMSDIYINDQLSKAQALLWSGSLHEVDEAHNIISNLIQDRMGKAEGTNV* |
| Ga0102865_11846232 | 3300007639 | Estuarine | MKMSDKYLNDQLSTAQKLLWGGSETENIEAHNIISKLIKEKIEQVEL* |
| Ga0102876_10874451 | 3300007642 | Estuarine | TKMRMSDIYINDQLSKAQALLWSGSLHEVDEAHNIVSNLIRDRLEQVSN* |
| Ga0102876_10898861 | 3300007642 | Estuarine | MRMSDIYINDQLSKAQALLWSGSLHEVDEAHNIVS |
| Ga0102876_11839353 | 3300007642 | Estuarine | KAQALLWSGSLHEQDEAHNIIAKLINDRMEKDEGQND* |
| Ga0102902_10619561 | 3300007644 | Estuarine | TKMRMSDNYINDQLNKAQKLLWGGSETENIEAHNIISKLIKDRVEQTDQI* |
| Ga0102902_11855773 | 3300007644 | Estuarine | MSDQYLNDQLNTAQKLLWGGSETENIEAHNIIAKLIEEKIEQVNP* |
| Ga0102855_11230412 | 3300007647 | Estuarine | MKMSDEYLNERLNTAQKLLWGGSETENIEAHNIISKLIRDRMEGDEGQYDSL* |
| Ga0102855_12100362 | 3300007647 | Estuarine | MSDAYLNDQLNTAQKLLWGGSETENIEAHNIIAKLIKDRIEQADLL* |
| Ga0102862_10709412 | 3300007670 | Estuarine | MRMSDQYLNDQLSKAQALLWSGSLHEVDEAHNIVSNLIRDRLEQVSN* |
| Ga0102899_100326312 | 3300007706 | Estuarine | MKMSDVYINDQLNKAQQLLWGGSETENIEAHNIIAKL |
| Ga0102899_10119875 | 3300007706 | Estuarine | MSDRYVNDQLDKAQKLLWGGSETENIEAHNIIAKLIKDRIEQTDLT* |
| Ga0102859_10398221 | 3300007708 | Estuarine | MSDMYLNDQLNKAQKLLWGGSETENIEAHNIIAKLIKDR |
| Ga0102859_11049383 | 3300007708 | Estuarine | MQQTDKYINEQLSKAQALLWSGSLHEQDEAHNIIAKLIKDREGLIKHS* |
| Ga0102859_11840101 | 3300007708 | Estuarine | MTDQYINDQLNTAQKLLWGGSETENIEAHNIIAKLIKDRIEQADLL* |
| Ga0102867_10488841 | 3300007716 | Estuarine | MSDNNINDQLNKAQKLLWGGSETENIEAHNIISKLIKDRVEQTDQI* |
| Ga0105736_10324784 | 3300007861 | Estuary Water | MSDAYLNDQLNTAQKLLWGGSETENIEAHNIIAKLIKDRVEQTNLV |
| Ga0105749_10576361 | 3300007864 | Estuary Water | RTKMKMSDVYINDQLNKAQQLLWGGSETENIEAHNIISKLISDRMEQVDL* |
| Ga0105749_11742712 | 3300007864 | Estuary Water | MSDMYINDQLNKAQKLLWGGSETENIEAHNIIAKLIKDRMPDA* |
| Ga0105739_100165413 | 3300007954 | Estuary Water | MKMSDIYLNDQLDKAQKLLWGGSETENIEAHNIIA |
| Ga0105745_10171042 | 3300007972 | Estuary Water | MKMSDRYLNDQLDKAQKLLWGGSETENIEAHNIIAKLIKDRVDLIEHS* |
| Ga0105745_10174637 | 3300007972 | Estuary Water | MKMSDRYVNDQLNKAQKLLWGGSETENIEAHNMIVQLIKDREDLIE |
| Ga0105745_10516743 | 3300007972 | Estuary Water | MQQTDNYINEQLSKAQALLWSGSLHEQDEAHNIIAKLINDRMEKAEGQND* |
| Ga0105746_10319002 | 3300007973 | Estuary Water | MKMSDRYVNDQLNKAQKLLWGGSETENIEAHNMNVQLIKDREDLIENS* |
| Ga0105746_11304083 | 3300007973 | Estuary Water | MKRRKKMKMSDRYLNDQLDKAQKLLWGGSETENIEAHNIIAKLIKDREDLIEHS* |
| Ga0105746_11466091 | 3300007973 | Estuary Water | MRMSDIYINDQLSKAQALLWSGSLHEVDEAHNIVSNLIR |
| Ga0105746_11868783 | 3300007973 | Estuary Water | MQQTDKYINEQLSKAQALLWSGSLHEQDEAHNIIAKLIKDRMRETEGTNDSL* |
| Ga0105746_12716981 | 3300007973 | Estuary Water | KRRKKMEMSDIYINERLNTAQKLLRGGSETENIESHNIISKLIQDRMAWEEGTNE* |
| Ga0105746_13309342 | 3300007973 | Estuary Water | MQQADHYINQELSKAQALLWSGSLHEVDEAHNIISNLIQDRMGKAEGTNV* |
| Ga0105747_11318303 | 3300007974 | Estuary Water | RMSDQYINDQLSKAQALLWSGSLHEVDEAHNIVSNLIQDRLEQVSN* |
| Ga0105747_13508261 | 3300007974 | Estuary Water | YINEQLSKAQALLWSGSLHEQDEAHNIIAKLIKDRMRETEGTNDSL* |
| Ga0105748_101927104 | 3300007992 | Estuary Water | INDQLNKAQALLWSGSLHEVDEAHNIISKLIQDRLGNG* |
| Ga0102922_12966692 | 3300008021 | Estuarine | MSDNYINDQLNKAQKLLWGGSETENIEAHNIIAELIKDRIEQADLS* |
| Ga0102893_10458302 | 3300008052 | Estuarine | MKMSDEYINQILNRAQELLWGGSETENIEAHNLISKLIKDRVEQVSN* |
| Ga0102893_11759192 | 3300008052 | Estuarine | MSDEYINDQLNAAQKLLWGGSETENIEAHNIIAKLIKDRIEQTNLT* |
| Ga0108970_101144241 | 3300008055 | Estuary | NDQLSKAQALLWSGSLHEVDEAHNIVSNLIRDRLEQVSN* |
| Ga0108970_101515163 | 3300008055 | Estuary | MSDTYINDQLNKAQKLLWGGSETENIEAHNIISKLIRDRIEQTEGQ* |
| Ga0108970_101717151 | 3300008055 | Estuary | IYINDQLSKAQALLWSGSLHEVDEAHNIVSNLIQDRLEQVSN* |
| Ga0108970_102207251 | 3300008055 | Estuary | YINEQLSKAQALLWSGSLHEQDEAHNIIAKLINDRMEKAEGQND* |
| Ga0108970_104962591 | 3300008055 | Estuary | MSDEYINEQLSKAQALLWSGSLHEQDEAHNIIAKLIN |
| Ga0108970_108232343 | 3300008055 | Estuary | MSDKYLNDQLSTAQKLLWGGSETENIEAHNIIAKLIKDKIEQVEL* |
| Ga0108970_110833233 | 3300008055 | Estuary | MSDQYINDQLNKAQQLLWGGSETENIEAHNIISKLIKDRIEQVGDRG* |
| Ga0108970_115195396 | 3300008055 | Estuary | MSDPYIDEQLNKAQKLLWGGSETENIEAHNIIAKLIKDRMSEQEGQNE* |
| Ga0108970_118186631 | 3300008055 | Estuary | ERRMNSRDINEQLSKAQAVIWSKTLHEVDEAHNIVSKLIQDRMAWEEGTNV* |
| Ga0114340_100307932 | 3300008107 | Freshwater, Plankton | MTNIYIDQQLNRAQQLLWGGSETENIEAHNIIAKLIKDRMSDKGE* |
| Ga0114340_10076774 | 3300008107 | Freshwater, Plankton | MSDNYINEQLSKAQQLLWGGSETENIEAHNIISKLIKDKVEQVEQ* |
| Ga0114340_100822531 | 3300008107 | Freshwater, Plankton | MSDEYINTELNKAQKLLWGGSETENIEAHNIISRLIKERMAWKEGNNE* |
| Ga0114340_10083493 | 3300008107 | Freshwater, Plankton | MSDVYINDQLNKAQQLLWGGSETENIEAHNIISKLIKDRVEQVNL* |
| Ga0114340_10129593 | 3300008107 | Freshwater, Plankton | MSDVYINDQLNKAQKLLWGGSETENIEAHNIIAKLIKDRIEQVGDRG* |
| Ga0114340_10245734 | 3300008107 | Freshwater, Plankton | MSDQYINDQLNKAQKLLWGGSETENIEAHNIIAKLIKDRVEQVNLI* |
| Ga0114340_102636514 | 3300008107 | Freshwater, Plankton | MSDRYVNEQLNKAQKLLWGGSETENIEAHNIIAKLIKDREDLIENS* |
| Ga0114340_10278691 | 3300008107 | Freshwater, Plankton | MQQTDKYINEQLSKAQALLWSGSLHEQDEAHNIIAKLIKDRMSEQEGTNE* |
| Ga0114340_10285593 | 3300008107 | Freshwater, Plankton | MSDEYINDQLSKAQKLLWGGSETENIEAHNIISKLIKDRVEQIN* |
| Ga0114340_10286458 | 3300008107 | Freshwater, Plankton | MSDPYIDEQLSKAQKLLWGGSETENIEAHNIISKLIKDRMSGDEGQND* |
| Ga0114340_10474482 | 3300008107 | Freshwater, Plankton | MQQTDKYINEQLSKAQALLWSGSLHEQDEAHNIIAKLIKDRMSDKGE* |
| Ga0114340_10481987 | 3300008107 | Freshwater, Plankton | MSDIYINEQLNKAQQLLWGGSETENIEAHNIIAKLIKDRMSDKGE* |
| Ga0114340_10551215 | 3300008107 | Freshwater, Plankton | MQQTDKYINEQLSKAQALLWSGSLHEQDEAHNIIAKLIKDRMEKTEGQNESL* |
| Ga0114340_10591687 | 3300008107 | Freshwater, Plankton | MSDPYIDEQLSKAQELLWGGSETEKIEAHNIIAKLIKDRMSEQAGTNE* |
| Ga0114340_10760461 | 3300008107 | Freshwater, Plankton | MSDDYINDQLNKAQKLLWGGSETENIEAHNIISKLIKDKIEQVS* |
| Ga0114340_10775993 | 3300008107 | Freshwater, Plankton | MQTTDIFLNQQLAKAQELLWGGSETENIEAHNIISSLIKHRMEKNS* |
| Ga0114340_10802001 | 3300008107 | Freshwater, Plankton | MRRTKMKMSDTYINDQLSKAQQLLWGGSETENIEAHNIISKLIRDRIEQTEGQ* |
| Ga0114340_11073455 | 3300008107 | Freshwater, Plankton | MSDAYINDQLNKAQKLLWGGSETENIEAHNIIAKLIKDRIEQTEGQ* |
| Ga0114340_11117115 | 3300008107 | Freshwater, Plankton | MSDAYINDQLNKAQELLWGGSETENIEAHNIISKLIRDRVEQTEGQ* |
| Ga0114340_11199932 | 3300008107 | Freshwater, Plankton | MSDIYINEQLNKAQKLLWGGSETENIEAHNIISKLIKDRMSEQEGTNE* |
| Ga0114340_11274896 | 3300008107 | Freshwater, Plankton | MSDTYINDQLNKAQQLLWGGSETENIEAHNIISKL |
| Ga0114340_11290735 | 3300008107 | Freshwater, Plankton | YINEQLSKAQALLWSGSLHEQDEAHNIIAKLINDRMGKAEGQND* |
| Ga0114340_11395272 | 3300008107 | Freshwater, Plankton | MSDPYIDEQLNKAQKLLWGGSETENIEAHNIISKLIRDRMSGDEGTNDSL* |
| Ga0114340_11449873 | 3300008107 | Freshwater, Plankton | MTVSKEFMKDKLNEAQQLLWGGSETENIAAHNIIAELIKDLQDEQ* |
| Ga0114340_11484701 | 3300008107 | Freshwater, Plankton | MKMSDRYVNDQLSKAQELLWGGSETENIEAHNIIAKLIKDREDLIENS* |
| Ga0114340_11674672 | 3300008107 | Freshwater, Plankton | MSDTYINDQLNKAQKLLWGGSETENIEAHNIIAKLIKDRIEQTEGQ* |
| Ga0114340_11989163 | 3300008107 | Freshwater, Plankton | MSDEYINEQLSKAQALLWSGSLHEQDEAHNIIAKLINDRMG |
| Ga0114340_12069352 | 3300008107 | Freshwater, Plankton | MSDPYINEQLNKAQKLLWGGSETENIEAHNIIAKLIKDRMSEQEGTNE* |
| Ga0114340_12096692 | 3300008107 | Freshwater, Plankton | MKMSDTYINDQLSRAQELLWGGSETENIEAHNIISKLIRDRIEQVEG* |
| Ga0114340_12156672 | 3300008107 | Freshwater, Plankton | MKMSDEYINEQLSKAQKLLWSGSLHEVDEAHNIVSNLIKDRVEQVSN* |
| Ga0114340_12208313 | 3300008107 | Freshwater, Plankton | MSDAYINDQLNKAQQLLWGGSETENIEAHNIISKLIRDRVEQTEGQ* |
| Ga0114340_12547891 | 3300008107 | Freshwater, Plankton | MQQTDKYINEQLSKAQALLWSGSLHEVDEAHNIIAKLINDRMRETEGQNV* |
| Ga0114340_12565491 | 3300008107 | Freshwater, Plankton | MSDIYINEQLNKAQKLLWGGSETENIEAHNIIAKLIKDRMSEQEGTNE* |
| Ga0114341_100804744 | 3300008108 | Freshwater, Plankton | MSDRYVNDQLNKAQKLLWGGSETENIEAHNIIAKLIKDREDLIENS* |
| Ga0114341_101272681 | 3300008108 | Freshwater, Plankton | MSDTYINDQLNKAQQLLWGGSETENIEAHNIISKLIRDRVEQ |
| Ga0114341_101633916 | 3300008108 | Freshwater, Plankton | MSDAYINDQLNKAQQLLWGGSETENIEAHNIISKLIRDRVEQ |
| Ga0114341_101966826 | 3300008108 | Freshwater, Plankton | MSDPYINEQLNKAQKLLWGGSETENIEAHNIIAKLIKDRM |
| Ga0114341_102195142 | 3300008108 | Freshwater, Plankton | MSDIYINEQLSKAQALLWSGSLHEQDEAHNIIAKLINDRMGKAEGQND* |
| Ga0114341_102324463 | 3300008108 | Freshwater, Plankton | MQQTDKYINEQLSKAQALLWSGSLHEQDEAHNIIAKLIKDRMRETEGQNV* |
| Ga0114341_102942172 | 3300008108 | Freshwater, Plankton | MSDAYINDQLNKAQQLLWGGSETENIEAHNIIAKLIKDRIEQTEGQ* |
| Ga0114341_103815373 | 3300008108 | Freshwater, Plankton | MSDPYIDEQLSKAQKLLWGGSETENIEAHNIISKLIKDRMSEQEGTNE* |
| Ga0114341_104103453 | 3300008108 | Freshwater, Plankton | MSDPYIDEQLNKAQKLLWSGSLHEVDEAHNIVAQLI |
| Ga0114341_104951453 | 3300008108 | Freshwater, Plankton | MKMSDAYINDQLNKAQKLLWGGSETENIEAHNIISKLIRDRIEQTEGQ* |
| Ga0114341_105452692 | 3300008108 | Freshwater, Plankton | MKMSDEYINEQLSKAQKLLWSGSLHEVDEAHNIVSNLIKDRVEQISN* |
| Ga0114343_101133012 | 3300008110 | Freshwater, Plankton | MKMSDNYINDQLSKAQQLLWGGSETENIEAHNIISKLIRDRIEQTEGQ* |
| Ga0114343_10334298 | 3300008110 | Freshwater, Plankton | MQTTDLYLNQQLVRAQELLWGGSETENIEAHNIISSLIKHRMEKNS* |
| Ga0114343_10620712 | 3300008110 | Freshwater, Plankton | MSDTYINDQLSKAQQLLWGGSETENIEAHNIISKLIRDRIEQTEGQ* |
| Ga0114343_10649107 | 3300008110 | Freshwater, Plankton | MSDTYINEQLSKAQALLWSGSLHEQDEAHNIIAKLI |
| Ga0114343_10897241 | 3300008110 | Freshwater, Plankton | MSDIYINEQLSKAQALLWSGSLHEQDEAHNIIAKLINDRMEKVEGQND* |
| Ga0114343_11416112 | 3300008110 | Freshwater, Plankton | MSNEYLNHQLSKAQALLWGGSETENIEAHNIIAKLIKDKIEQVGL* |
| Ga0114343_11702513 | 3300008110 | Freshwater, Plankton | MKMSDQYINDQLNKAQQLLWGGSETENIEAHNIIAKLIKDRIEQTEGL* |
| Ga0114343_11859302 | 3300008110 | Freshwater, Plankton | MSDPYIDEQLNKAQKLLWGGSETENIEAHNIIAKLIKDRMSEQEGQND* |
| Ga0114343_12075291 | 3300008110 | Freshwater, Plankton | MSDRYVNDQLNKAQKLLWGGSETENIEAHNIIAKLIKDREDLIEHS* |
| Ga0114343_12165622 | 3300008110 | Freshwater, Plankton | MSDTYINDQLNKAQQLLWGGSETENIEAHNIISKLIRDRVEQTEGQ* |
| Ga0114344_11330771 | 3300008111 | Freshwater, Plankton | MTRRKKMQQTDIYINDQLSKAQALLWSGSLHEVDEAHNIIAKLINDRMGKSEGQNDSL* |
| Ga0114344_11341181 | 3300008111 | Freshwater, Plankton | MSDVYINDQLNKAQQLLWGGSETENIEAHNIISKLIKERVEQVNL* |
| Ga0114344_11776111 | 3300008111 | Freshwater, Plankton | RKKMQQTDKYINEQLSKAQALLWSGSLHEQDEAHNIIAKLIKDRMSDKGE* |
| Ga0114344_11804591 | 3300008111 | Freshwater, Plankton | MTRRKKMQQTDIYINDQLSKAQALLWSGSLHEVDEAHNIIAKLINDRMRETEGQNV* |
| Ga0114346_10027318 | 3300008113 | Freshwater, Plankton | MSDQYINDQLSKAQALLWSGSLHEVDEAHNIVSKLIQDRIEQTDLA* |
| Ga0114346_10130244 | 3300008113 | Freshwater, Plankton | MSDIYIDEQLNKAQKLLWGGSESENIEAHNIIAKLIKERMEDNEQV* |
| Ga0114346_10749116 | 3300008113 | Freshwater, Plankton | MTDEYINDQLSTAQKLLWGGSETENIEAHNIIAKLIKDRVEQTNLV* |
| Ga0114346_11113956 | 3300008113 | Freshwater, Plankton | MSDPYINEQLNKAQKLLWGGSETENIEAHNIIAKLIKDRMSEKNLD* |
| Ga0114346_11134785 | 3300008113 | Freshwater, Plankton | MSDIYINEQLSKAQALLWSGSLHEQDEAHNIIAKLINDRMEKAEGQND* |
| Ga0114346_11205903 | 3300008113 | Freshwater, Plankton | MSDNYINDQLNTAQKLLWGGSETENIEAHNIIAKLISDRIEQQDQS* |
| Ga0114346_11503132 | 3300008113 | Freshwater, Plankton | MSDQYIDEILNKAQKLLWGGSETENIEAHNLISKLIKDRVEQVSN* |
| Ga0114346_12200566 | 3300008113 | Freshwater, Plankton | MQMSDIYINEQLNKAQKLLWGGSETENIEAHNIIAKLQYMRLSH* |
| Ga0114346_12669202 | 3300008113 | Freshwater, Plankton | MKMSDPYIDEQLSKAQKLLWGGSETENIEAHNIISKLIKDRMSEQEGTNE* |
| Ga0114347_11742273 | 3300008114 | Freshwater, Plankton | MSDIYINEQLNKAQKLLWGGSETENIEAHNIIAKLIKDRMSEQEGQNV* |
| Ga0114347_12179713 | 3300008114 | Freshwater, Plankton | MSDPYIDEQLNKAQKLLWGGSETENIEAHNIIAKLIKDRIEQTEGQ* |
| Ga0114350_10646483 | 3300008116 | Freshwater, Plankton | KMKMSDQYINDQLNKAQKLLWGGSETENIEAHNIIAKLIKDRVEQVNLI* |
| Ga0114350_11229663 | 3300008116 | Freshwater, Plankton | MSDAYINDQLNKAQQLLWGGSETENIEAHNIISKLIRDRVE |
| Ga0114350_11230881 | 3300008116 | Freshwater, Plankton | MSDPYIDEQLNKAQKLLWGGSETENIEAHNIIAKLIKDRMSEQEGTNE* |
| Ga0114350_11427723 | 3300008116 | Freshwater, Plankton | MSDPYIDEQLNKAQKLLWGGSETENIEAHNIISKLIRDRMSGDEGTNE* |
| Ga0114350_11923933 | 3300008116 | Freshwater, Plankton | MSDEYINDQLNKAQKLLWGGSETENIEAHNIISKLIRDRMSGD |
| Ga0114351_104521418 | 3300008117 | Freshwater, Plankton | MQQTDLYVNEQLQAAQKLLWSGSLHEVDEAHNIISNLIRDRMSNLSDKGN* |
| Ga0114351_12887251 | 3300008117 | Freshwater, Plankton | MQQTDKYINEQLCKAQALLWSGSLHEQDEAHNIIAKLINDRMGKAEGQND |
| Ga0114351_14060021 | 3300008117 | Freshwater, Plankton | KAQALLWSGSLHEQDEAHNIIAKLINDRMGKAEGQND* |
| Ga0114352_10751343 | 3300008118 | Freshwater, Plankton | MSDPYINEQLNKAQKLLWGGSETENIEAHNIISKLIKDRMSEQEGTNE* |
| Ga0114352_10942821 | 3300008118 | Freshwater, Plankton | MQQTDKYINEQLSKAQALLWSGSLHEVDEAHNIIAKLINDRMGKSEGQNDSL* |
| Ga0114354_100343641 | 3300008119 | Freshwater, Plankton | MTDEYINDQLSTAQKLLWGGSETENIEAHNIIARLIKDRIEQTNLV* |
| Ga0114355_11446062 | 3300008120 | Freshwater, Plankton | MQQTDKYINEQLSKAQALLWSGSLHEVDEAHNIIAKLINDRMGKAEGQNDSL* |
| Ga0114355_11545382 | 3300008120 | Freshwater, Plankton | MQQTDIYINEQLNKAQKLLWGGSETENIEAHNIIAKLIKDRMPDA* |
| Ga0114355_11569474 | 3300008120 | Freshwater, Plankton | MSDEYINEQLSKAQALLWSGSLHEQDEAHNIIAKLINDRME |
| Ga0114355_11606951 | 3300008120 | Freshwater, Plankton | MKQTDIYINDQLSKAQALLWSGSLHEVDEAHNIIAKLINDRMGK |
| Ga0114355_11838832 | 3300008120 | Freshwater, Plankton | MSDQYINDQLNKAQQLLWGGSETENIEAHNIISKLIRDRIEQVGDRG* |
| Ga0114355_12212692 | 3300008120 | Freshwater, Plankton | MQQTDKYINEKLSKAQALLWSGSLHEQDEAHNIIAKLIKDRMEKTEGQNESL* |
| Ga0114359_12345693 | 3300008122 | Freshwater, Plankton | MQQTDKYINEQLSKAQALLWSGSLHEVDEAHNIIAKLINDRMSEKDGTNV* |
| Ga0114840_10217834 | 3300008258 | Freshwater, Plankton | MSDPYIDEQLNKAQKLLWGGSETENIEAHNIISKLIKDRMSEQEGTNE* |
| Ga0114840_10485401 | 3300008258 | Freshwater, Plankton | NEQLNKAQKLLWGGSETENIEAHNIIAKLIKDRMSEQEGTNE* |
| Ga0114841_10974153 | 3300008259 | Freshwater, Plankton | MKMSDNYINDQLNKAQKLLWGGSETENIEAHNIIRWNSVTI* |
| Ga0114336_100571539 | 3300008261 | Freshwater, Plankton | MSDAYLNDQLNTAQKLLWGGSETENIEAHNIIAKLIKDRIEQTDLM* |
| Ga0114336_10095284 | 3300008261 | Freshwater, Plankton | MKMSDEYINDQLSTAQKLLWGGSETENIEAHNIISKLIKDRVEQISI* |
| Ga0114336_10239187 | 3300008261 | Freshwater, Plankton | MTDEYINDQLNTAQKLLWGGSETENIEAHNIIARLIKDRIEQTNLV* |
| Ga0114336_10453275 | 3300008261 | Freshwater, Plankton | MKMSDTYIDDQLNKAQKLLWGGSETENIEAHNIISKLIQDRMAWEEGQNV* |
| Ga0114336_10945181 | 3300008261 | Freshwater, Plankton | KMKMSDIYINDQLNKAQKLLWGGSETENIEAHNIISKLIRDRMEGDEGQYDSL* |
| Ga0114336_13761322 | 3300008261 | Freshwater, Plankton | DEYINDQLNTAQKLLWGGSETENIAAHNIISKLIKDRVEQTDLV* |
| Ga0114337_10385887 | 3300008262 | Freshwater, Plankton | MSDPYIDEQLNKAQKLLWGGSETENIEAHNIISKLIRERMSGDEGTNDSL* |
| Ga0114337_11716602 | 3300008262 | Freshwater, Plankton | MQQTDKYINEQLSKAQALLWSGSLHEVDEAHNIIAKLINDRMGKAEGQND* |
| Ga0114363_103924310 | 3300008266 | Freshwater, Plankton | MSDPYIDEQLSKAQKLLWGGSETENIEAHNIISHLRYMTKGTMQA* |
| Ga0114876_10524767 | 3300008448 | Freshwater Lake | MSDNYINEQLSKAQQLLWGGSETENIEAHNIISKLIKDKVEQ |
| Ga0114876_12283303 | 3300008448 | Freshwater Lake | MKMSDEYINEQLSKAQALLWSGSLHEVDEAHNIVSNLI |
| Ga0114876_12326823 | 3300008448 | Freshwater Lake | MSDDYINDQLNKAQKLLWGGSETENIEAHNIISKL |
| Ga0114880_11010765 | 3300008450 | Freshwater Lake | MSDIYINEQLNKAQKLLWGGSETENIEAHNLIAKLIKDRMAEREGTNE* |
| Ga0104241_10041772 | 3300008953 | Freshwater | MEMTNPYIYSKLPMAQKLLWGGSETENIEAHNMIAQLIKDRVEQTEGI* |
| Ga0104241_10062952 | 3300008953 | Freshwater | MSDIYINDQLNKAQKLLWGGSETENIEAHNIIAKLIKDRMSEQEGQNV* |
| Ga0104241_10152482 | 3300008953 | Freshwater | MSDAYLNDQLDKAQKLLWGGSETENIEAHNIIAKLIKDRMEQKDLS* |
| Ga0104242_10019167 | 3300008962 | Freshwater | MEMTNPYIYSKLAMAQKLLWGGSETENIEAHNIISKLIRELDEGTMYA* |
| Ga0104242_10071254 | 3300008962 | Freshwater | MSDAYINDVLNKAQKLLWGGSETENIEAHNMIAQLIKDRVEQTEGI* |
| Ga0104242_10285742 | 3300008962 | Freshwater | MSDNYLNDQLNTAQKLLWGGSETENIEAHNIIAKLIKDRIEQTN* |
| Ga0102889_11888303 | 3300008964 | Estuarine | IPCLKKMRKTKMKMSDQYVDSVLAEAQRLLWGGSETENIEAHNLISKLIKDRVEQTDQI* |
| Ga0102831_10558933 | 3300008996 | Estuarine | MSDEYLNNQLSRAQELLWGGSETENIEAHNIIAKLIKDRIEQADLL* |
| Ga0102831_10604971 | 3300008996 | Estuarine | QCLKKKRRTKMKMSDIYINEQLSKAQALLWSGSLHEQDEAHNIIAKLINDRMEKDEGQND |
| Ga0102831_10605622 | 3300008996 | Estuarine | MKMSDTYINDQLSKAQALLWSGSLHEVDEAHNIVSNLIQDRLGNE* |
| Ga0102831_11079864 | 3300008996 | Estuarine | MSDQYVDEVLAKAQQLLWGGSETENIEAHNIISKLISDRMEQVDL* |
| Ga0102831_13001582 | 3300008996 | Estuarine | MSDNYINDQLNTAQKLLWGGSETENIEAHNIIAKLISDRIEQADLS* |
| Ga0102829_10156963 | 3300009026 | Estuarine | MSDRYVNDQLDKAQKLLWGGSETENIEAHNIIAKLIKDREDLIEHS* |
| Ga0102829_11735773 | 3300009026 | Estuarine | MSDAYLNDRLDKAQKLLWGGSETENIEAHNIIAELIKDRIEQTN* |
| Ga0102829_12921441 | 3300009026 | Estuarine | MSDNYLNDQLDKAQKFVCDGTETENIEAHNIIAKLIKDRIEQIN |
| Ga0102829_13159231 | 3300009026 | Estuarine | QCSKMMRRKKMKMSDPYINDQLNKAQKLLWGGSETENIEAHNIIAKLIKDRMEGDERENDSL* |
| Ga0102909_10645961 | 3300009050 | Estuarine | MKMSDVYINDQLNKAQQLLWGGSETENIEAHNIIAKLIKDRIEQTDIT* |
| Ga0102909_10682443 | 3300009050 | Estuarine | SDTYINDQLSKAQALLWSGSLHEVDEAHNIVSNLIRDRLEQVSN* |
| Ga0102864_11022091 | 3300009051 | Estuarine | LSDEYINEQLSKAQALLWSGSLHEQDEAHNIIAKLINDRMEKVEGQND* |
| Ga0102864_11767511 | 3300009051 | Estuarine | MSDTYINDQLNKAQKLLWGGSETENIEAHNMIVQLIKDREDLIENS* |
| Ga0102860_10361181 | 3300009056 | Estuarine | MSDRYVNDQLNKAQKLLWGGSETENIEAHNMIVQLIKDREDLIENS* |
| Ga0102854_11685692 | 3300009058 | Estuarine | MSDEYLNDQLSKAQALLWGGSETENIEAHNIIAKLIKDKIEQVGL* |
| Ga0102854_12429172 | 3300009058 | Estuarine | MSDQYIDEVLNKAQKLLWGGSETENIEAHNIIAELIKDRIEQTN* |
| Ga0102830_12524132 | 3300009059 | Estuarine | MQQTDKYINDQLSKAQALLWSGSLHEQDEAHNIIAKLINDRMENVEGQND* |
| Ga0114973_1000252632 | 3300009068 | Freshwater Lake | MRMSDQYINDQLSKAQALLWSGSLHEVDEAHNIVSNLIRERVEQIDLE* |
| Ga0114973_102235783 | 3300009068 | Freshwater Lake | MKMSDEYINDQLNKAQKLLWGGSETENIAAHNIISKLIQDRMAWEEGTNV* |
| Ga0114973_105101962 | 3300009068 | Freshwater Lake | MSDEYLNDQLNKAQQLLWGGSETENIEAHNIIAKLISDRIEQTDLP* |
| Ga0114973_105435961 | 3300009068 | Freshwater Lake | MSDNYLNDQLNTAQKLLWGGSETENIEAHNIIAKLISDRIEQADLV* |
| Ga0114973_106427002 | 3300009068 | Freshwater Lake | MSDEYLNDQLNTAQKLLWGGSETENIEAHNIIAKLISDRIEQADLV* |
| Ga0102814_107304281 | 3300009079 | Estuarine | KKKRRTKMKMSDIYINEQLSKAQALLWSGSLHEQDEAHNIIAKFINDRMEKAEGQND* |
| Ga0102812_103085431 | 3300009086 | Estuarine | RRKKMEMSDIYINERLNTAQKLLWGGSETENIEAHNIISKLIQDRMAWEEGTNDSL* |
| Ga0114980_1000025432 | 3300009152 | Freshwater Lake | MSDKYLNDQLSKAQKLLWGGSETENIEAHNIIAKLIKEKIEQVEL* |
| Ga0114980_100027883 | 3300009152 | Freshwater Lake | MKMSDEYIDEILNRAQKLLWGGSETENIEAHNLISNLIRERVEQTDLT* |
| Ga0114980_100340583 | 3300009152 | Freshwater Lake | MSDEYLNDQLNTAQKLLWGGSETENIEAHNIIAKLIKDRMEQTDLS* |
| Ga0114980_102666871 | 3300009152 | Freshwater Lake | MRMSDIYINDQLSKAQALLWSGSLHEVDEAHNIVSNLIRERIEQTDLA* |
| Ga0114980_102938591 | 3300009152 | Freshwater Lake | LNTAQKLLWGGSETENIEAHNIIAKLISDRIEQADLL* |
| Ga0114963_10000010130 | 3300009154 | Freshwater Lake | MSDQYINDQLNTAQKLLWGGSETENIEAHNIIAKLIKDRMELSDQN* |
| Ga0114968_100524443 | 3300009155 | Freshwater Lake | MSDKYLNDQLSKAQKLLWGGSETENIEAHNIIAKLIKEKIQQVEL* |
| Ga0114968_102465644 | 3300009155 | Freshwater Lake | MKITDKYLNEQLDIAQKLLWGGSETENIEAHNIISKLIYDKIEQVNP* |
| Ga0114968_104015323 | 3300009155 | Freshwater Lake | MSDEYLNDQLNTAQKLLWGGSETENIEAHNIIAKLISDRIEQTDLP* |
| Ga0114977_1000019656 | 3300009158 | Freshwater Lake | MKMSDRYVNDQLNTAQKLLWGGSETENIEAHNIIAKLIKDREDLIENS* |
| Ga0114977_1000204229 | 3300009158 | Freshwater Lake | MSDTYLNDQLNTAQKLLWGGSETENIEAHNIIAKLISDRIEQADLL* |
| Ga0114977_1000249836 | 3300009158 | Freshwater Lake | TLLTQCLKKRKKRTKMRMSDIYINDQLSKAQALLWSGSLHEVDEAHNIVSNLIRERIEQTDLA* |
| Ga0114978_100647754 | 3300009159 | Freshwater Lake | MKQTDNHINTELSKAQALLWSGSLHEVDEAHNIISNLIKDRMGKAEGTNV* |
| Ga0114978_100984951 | 3300009159 | Freshwater Lake | SDRYVNDQLDKAQKLLWGGSETENIEAHNIIAKLIKDREDLIEHS* |
| Ga0114978_101495905 | 3300009159 | Freshwater Lake | MSDKYINDQLSTAQKLLWGGSETENIEAHNIIAKLIKDKIEQVEL* |
| Ga0114978_103797253 | 3300009159 | Freshwater Lake | MKMSDEYLNTVLAKAQKLLWGGSETENIEAHNLISDLIKDRVEQVSN* |
| Ga0114978_103908622 | 3300009159 | Freshwater Lake | MSDKYLNDQLSKAQKLLWGGSETENIEAHNIISKLIRDKIEQVEL* |
| Ga0114978_105221612 | 3300009159 | Freshwater Lake | MTNEYINDQLNKAQKLLWSGSLHEQDEAHNIIAKLIKDREGLIQNS* |
| Ga0114966_100924943 | 3300009161 | Freshwater Lake | MSDTYINDQLNKAQQLLWGGSETENIEAHNIIAKLISDRVEQADLS* |
| Ga0114966_100978286 | 3300009161 | Freshwater Lake | MKITDKYLNEQLDIAQKLLWGGSETENIEAHNIISKLIYDRIEQVNP* |
| Ga0114966_100984754 | 3300009161 | Freshwater Lake | MSDNYLNDQLNTAQKLLWGGSETENIEAHNIIAELIKYRIEQTNLT* |
| Ga0114966_102090005 | 3300009161 | Freshwater Lake | RRKKMKMSDEYLNERLNTAQKLLWGGSETENIEAHNIISKLIQDRMAWEEGTNV* |
| Ga0114966_103572142 | 3300009161 | Freshwater Lake | MSDAYLNDQLDTAQKLLWGGSETENIEAHNIIAKLISDRIEQADLS* |
| Ga0114970_106376592 | 3300009163 | Freshwater Lake | MTDRYVNDQLDKAQKLLWGGSETENIEAHNIIAKLIKDREDLIEHS* |
| Ga0114975_1000178541 | 3300009164 | Freshwater Lake | MSDPYIDEQLNKAQKLLWGGSETENIEAHNIIAKLIKDRMEAIDQ* |
| Ga0114975_101284475 | 3300009164 | Freshwater Lake | MKMSDEYLNERLNTAQKLLWGGSETENIEAHNIISKLIQDRMAWEEGTNDSL* |
| Ga0114975_101290423 | 3300009164 | Freshwater Lake | MSDEYINDQLNTAQKLLWGGSETENIEAHNIIAKLIKDRVEQIS* |
| Ga0105104_106527081 | 3300009168 | Freshwater Sediment | MIMTNEYVNEQLNKAQKLLWGGSETENIEAHNIIA |
| Ga0114979_101374132 | 3300009180 | Freshwater Lake | MKMSDEYLNERLNTAQKLLWGGSETENIAAHNIISKLIQDRMAWEEGTNDSL* |
| Ga0114979_101777534 | 3300009180 | Freshwater Lake | MSDEYLNDQLNTAQKLLWGGSETENIEAHNIIAKLIKDRVEQIN* |
| Ga0114979_102132644 | 3300009180 | Freshwater Lake | MSDNYLNDQLNTAQKLLWGGSETENIEAHNIIAELIKDRVEQTNLT* |
| Ga0114969_100014184 | 3300009181 | Freshwater Lake | MSDAYLNAQLDTAQKLLWGGSETENIEAHNIISKLIYDRIEQTE* |
| Ga0114969_101195284 | 3300009181 | Freshwater Lake | MSDNYLNDQLDTAQKLLWGGSETENIEAHNIIAKLIKDRIEQTNLT* |
| Ga0114969_103121944 | 3300009181 | Freshwater Lake | MKITDKYLNEQLDIAQKLLWGGSETENIEAHNIISKLIYD |
| Ga0114974_1004029810 | 3300009183 | Freshwater Lake | MKMSDKYINEQLSKAQALLWSGSLHEQDEAHNIISKLIKDRVEQSEGQ* |
| Ga0114974_102133454 | 3300009183 | Freshwater Lake | MSDKYINDQLSTAQKLLWGGSETENIEAHNIIAKLIKEKIEQVEL* |
| Ga0114976_100871312 | 3300009184 | Freshwater Lake | MSDNYLNDQLNTAQKLLWGGSETENIEAHNIISKLIQDRMAWEEGTNV* |
| Ga0114976_102208542 | 3300009184 | Freshwater Lake | MKMSDEYVDSVLAKAQKLLWGGSETENIEAHNIIAKLIKDRVEQIN* |
| Ga0114976_104654201 | 3300009184 | Freshwater Lake | YLNDQLNTAQKLLWGGSETENIEAHNIIAKLIKDRMEQTDLS* |
| Ga0114982_100006173 | 3300009419 | Deep Subsurface | MSDNYLNDQLNTAQKLLWGGSETENIEAHNIIAKLIKDRIEQADLS* |
| Ga0114982_100731712 | 3300009419 | Deep Subsurface | MSDAYINDQLNKAQKLLWGGSETENIEAHNIIAKLIKDRVEQVEQ* |
| Ga0114982_10317474 | 3300009419 | Deep Subsurface | MSDEYINDQLNKAQKLLWGGSETENIEAHNIIAKLIKDRVEQVGL* |
| Ga0114982_10588324 | 3300009419 | Deep Subsurface | MSDEYINERLNTAQKLLWGGSETENIEAHNIISKLIKDRIEQVEG* |
| Ga0114982_11273734 | 3300009419 | Deep Subsurface | MSDTYINDQLNKAQQLLWGGSETENIEAHNIIAKLIKDRIE |
| Ga0114982_11315632 | 3300009419 | Deep Subsurface | MSDPYIDEQLNKAQKLLWGGSETENIEAHNLIAKLIKDRMAEREGTNDSL* |
| Ga0114967_103623981 | 3300010160 | Freshwater Lake | KMSDTYINDQLNKAQQLLWGGSETENIEAHNIIAKLISDRVEQADLS* |
| Ga0102883_11160911 | 3300010312 | Estuarine | MKMSDTYINDQLSKAQALLWSGSLHEVDEAHNIVSNLIRD |
| Ga0102883_11449983 | 3300010312 | Estuarine | DIYINDQLSKAQALLWSGSLHEVDEAHNIVSNLIRDRLEQVSN* |
| Ga0102883_12358542 | 3300010312 | Estuarine | MRMSDIYINDQLSKAQALLWSGSLHEVDEAHNIVSNLIRDRLE |
| Ga0129333_100695707 | 3300010354 | Freshwater To Marine Saline Gradient | MKMSDNYINEQLSKAQQLLWGGSETENIEAHNIISKLIRDRIEQVGDRG* |
| Ga0129333_100884693 | 3300010354 | Freshwater To Marine Saline Gradient | MSDIYIDEQLNKAQQLLWGGSETENIEAHNIIAKLIKDRMSDKGE* |
| Ga0129333_101694903 | 3300010354 | Freshwater To Marine Saline Gradient | MSDAYINDQLNKAQQLLWGGSETENIEAHNIISKLIKDRIEQVGDRG* |
| Ga0129333_104924173 | 3300010354 | Freshwater To Marine Saline Gradient | MSDTYINDQLAKAQKLLWGGSETENIEAHNIISQLIRDRIEQTEGQ* |
| Ga0129336_101208191 | 3300010370 | Freshwater To Marine Saline Gradient | KMKMSDTYINDQLNKAQQLLWGGSETENIEAHNIISKLIRDRVEQTEGQ* |
| Ga0129336_105309573 | 3300010370 | Freshwater To Marine Saline Gradient | MSDAYINDQLNKAQKLLWGGSETENIEAHNIIAKLIKDRIEQVGDRG* |
| Ga0136551_10084153 | 3300010388 | Pond Fresh Water | MSDEYINDQLNTAQKLLWGGSETENIEAHNIIAKLIKDRIEQTNLI* |
| Ga0136551_10375562 | 3300010388 | Pond Fresh Water | MTTTDQYTNEVLAKAQALLWGGSETENIEAHNMIAKLINDRLDQNS* |
| Ga0133913_1016920820 | 3300010885 | Freshwater Lake | MSDRYVNDQLNTAQKLLWGGSETENIEAHNIIAKLIKDREDLIENS* |
| Ga0133913_108687793 | 3300010885 | Freshwater Lake | MSDGYLNEQLDKAQKLLWGGSETENIEAHNIIAKLISDRIEQTNLM* |
| Ga0133913_123914033 | 3300010885 | Freshwater Lake | MSDNYLNDQLDTAQKLLWGGSETENIEAHNIIAKLIKDRIEQINLT* |
| Ga0133913_125925903 | 3300010885 | Freshwater Lake | MKMSDKYLNDQLSKAQKLLWGGSETENIEAHNIISKLIRDKIEQVEL* |
| Ga0133913_129728583 | 3300010885 | Freshwater Lake | MKMSDEYIDQILNRAQELLWGGSETENIEAHNLISKLIKDRVEQVSN* |
| Ga0138308_1073925 | 3300010965 | Lake Chemocline | MSDNYLNDQLNIAQKLLWGGSETENIEAHNIIAKLIKDRIEQVEQI* |
| Ga0138308_1082661 | 3300010965 | Lake Chemocline | MSDRYVNDQLNKAQKLLWSGSLHEQDEAHNIIAKLIKDREDLIENS* |
| Ga0138308_1869991 | 3300010965 | Lake Chemocline | MKMSDRYVNDQLNTAQKLLWGGSETENIEAHNIIAKLIKDREDLIE |
| Ga0137575_100029434 | 3300010970 | Pond Fresh Water | MKMSDPYVDSVLEKAQKLLWGGSETENIEAHNLIAKLIKDRMEENS* |
| Ga0129318_100371572 | 3300011009 | Freshwater To Marine Saline Gradient | MSDAYLNDQLNTAQKLLWGGSETENIEAHNIISQLIKDRIEQADLL* |
| Ga0139557_10092632 | 3300011010 | Freshwater | MSDEYINEQLSKAQALLWSGSLHEQDEAHNIIAKLINDRMGKAEGQND* |
| Ga0139557_10194543 | 3300011010 | Freshwater | MSDNYLNDQLNTAQKLLWGGSETENIEAHNIIAKLINDRIEQADLS* |
| Ga0139556_10266533 | 3300011011 | Freshwater | LNTAQALLWSGSLHEVDEAHNIIAKLISDRIEQVNPS* |
| Ga0151620_10983163 | 3300011268 | Freshwater | MSDDYINDQLSKAQALLWGGSETENIEAHNIISKLIKDKVEQVGL* |
| Ga0151620_11033422 | 3300011268 | Freshwater | MSDEYINDQLNTAQKLLWGGSETENIEAHNIIAKLIKDRVEQTNLV* |
| Ga0151620_12197311 | 3300011268 | Freshwater | MSDEYINDQLSTAQKLLWGGSETENIEAHNIISKLIKDRVEQASN* |
| Ga0151620_12538002 | 3300011268 | Freshwater | MKQTDIYINEQLNKAQKLLWSGSLHEQDEAHNIIAKLIKDRMPDA* |
| Ga0119951_10605063 | 3300012000 | Freshwater | MSDTYINDQLNKAQKLLWGGSETENIEAHNIISQLIRDRIEQTEGQ* |
| Ga0119955_100050925 | 3300012006 | Freshwater | MSDGYLNEQLDKAQKLLWGGSETENIEAHNIIAKLIKDRIEQTNLM* |
| Ga0153799_10554712 | 3300012012 | Freshwater | MQQTDNYINTELSKAQALLWSGSLHEVDEAHNIISNLIKDRMGKAEGTNV* |
| Ga0153801_10056533 | 3300012017 | Freshwater | MSDKYLNDQLSAAQKLLWGGSETENIEAHNIIAKLIKDRIEQVEL* |
| Ga0157141_10187403 | 3300012346 | Freshwater | MTTTDAYTNEVLSKAQALIWGGSETENIEAHNMIAKLIKDRMGEE* |
| Ga0157138_100062115 | 3300012352 | Freshwater | MSDEYINDQLNKAQQLLWGGSETENIEAHNIISKLIKDRVEQVDLV* |
| Ga0157138_10319821 | 3300012352 | Freshwater | MSDEYLNDQLSRAQALLWGGSETENIEAHNIISKLIKDKVEQVGL* |
| Ga0157203_10014114 | 3300012663 | Freshwater | MSDDYINDQLNTAQKLLWGGSETENIEAHNIIARLIKDRIEQTNLT* |
| Ga0157203_10016718 | 3300012663 | Freshwater | MSDKYLNDQLSKAQALLWGGSETENIEAHNIISKLIRDKIEQVEL* |
| Ga0157203_10155083 | 3300012663 | Freshwater | MSDKYINEQLSKAQALLWSGSLHEQDEAHNIIAKLINDRMGKAEGQND* |
| Ga0157203_10227513 | 3300012663 | Freshwater | DNYINDQLNTAQKLLWGGSETENIEAHNIIAKLISDRIEQANFS* |
| Ga0157203_10505292 | 3300012663 | Freshwater | MTNEYINDQLNKAQKLLWGGSETENIEAHNIIARLIKDREDLIQNS* |
| Ga0157203_10558852 | 3300012663 | Freshwater | MSDIYINDQLNKAQKLLWGGSETENIEAHNIISKLIRDRMEGDEGQND* |
| Ga0157210_100024338 | 3300012665 | Freshwater | MSDAYINDQLNKAQQLLWGGSETENIEAHNIISKLIKDRVEQVDLI* |
| Ga0157210_100300311 | 3300012665 | Freshwater | MSDVYINDQLNKAQALLWGGSETENIEAHNIISKLIRDRVEQVDQI* |
| Ga0157210_10056828 | 3300012665 | Freshwater | MKMSDAYINDQLSTAQKLLWGGSETENIAAHNIISKLIQDRVEQTDQI* |
| Ga0157210_10060403 | 3300012665 | Freshwater | MKMSDVYINDQLNTAQKLLWGGSETENIEAHNIIAKLIKDRVEQIN* |
| Ga0157210_10190423 | 3300012665 | Freshwater | MRMSDNYINDQLSTAQKLLWGGSETENIAAHNIISKLIQDRIEQTDQN* |
| Ga0157498_10128981 | 3300012666 | Freshwater, Surface Ice | QTDNYINTELSKAQALLWSGSLHEVDEAHNIISNLIKDRMGKAEGTNV* |
| Ga0157498_10177112 | 3300012666 | Freshwater, Surface Ice | MKMSDEYINTELNKAQKLLWGGSETENIEAHNIISRLIKERMAWKEGNNE* |
| Ga0157498_10193713 | 3300012666 | Freshwater, Surface Ice | MQQSDIYINEQLNKAQKLLWGGSETENIEAHNIIAKLIKDRMPND* |
| Ga0157498_10277624 | 3300012666 | Freshwater, Surface Ice | NEQLSKAQALLWSGSLHEQDEAHNIIAKLINDRMEKAEGQND* |
| Ga0157208_1000144714 | 3300012667 | Freshwater | MKMSDEYINDQLNMAQQLLWGGSETENIAAHNIISKLIKDRVEQIDLV* |
| Ga0157208_100026654 | 3300012667 | Freshwater | MSDVYINDQLSKAQKLLWGGSETENIEAHNIIAKLIKDKVEQADL* |
| Ga0157208_100037736 | 3300012667 | Freshwater | MSDQFINEQLNKAQQLLWGGSETENIEAHNIIAKLIKDRVEQADLI* |
| Ga0157208_100080492 | 3300012667 | Freshwater | MSDEYLNDQLSKAQALLWGGSETENIEAHNIISKLIKDKVEQVGL* |
| Ga0157607_10697853 | 3300012711 | Freshwater | MQQTDQYINERLQAAQQLLWSGSLHEQDEAHNIIAKLIKDRMSDKGE* |
| Ga0157598_10266112 | 3300012712 | Freshwater | KMKMSDQYINDQLSKAQALLWSGSLHEVDEAHNIVSNLIRDRLEQVSN* |
| Ga0157604_10821411 | 3300012723 | Freshwater | KMQQTDQYINERLQAAQQLLWSGSLHEQDEAHNIIAKLIKDRMSDKGE* |
| Ga0138288_12103141 | 3300012761 | Freshwater Lake | MSDTYLNDQLNTAQKLLWGGSETENIEAHNIIAKLIGDRIEQADLL* |
| Ga0138289_11971042 | 3300012763 | Freshwater Lake | KKRTKMMMSDIYINDQLSKAQALLWSGSLHEVDEAHNLISKLIQDRMSEKNLK* |
| Ga0138287_11535903 | 3300012772 | Freshwater Lake | STQCLKKRKKTKMKMSDTYLNDQLNTAQKLLWGGSETENIEAHNIIAKLISDRIEQADLL |
| Ga0138284_11042522 | 3300012779 | Freshwater Lake | MTTGKKTKMKMSDEYIDQILNRAQELLWGGSETENIEAHNLISKLIKDRVEQVSN* |
| Ga0138284_12177741 | 3300012779 | Freshwater Lake | KMKMSDRYVNDQLDKAQKLLWGGSETENIEAHNIIAKLIKDREDLIEHS* |
| Ga0138284_12192302 | 3300012779 | Freshwater Lake | MSDEYLNERLNTAQKLLWGGSETENIEAHNIISKLIQDRMAWEEGTNDSL* |
| Ga0164293_100357789 | 3300013004 | Freshwater | MKMSDEYLNERLNKAQKLLWGGSETENIEAHNIISKLIKDRIEGDEGQYDSL* |
| Ga0164293_101250413 | 3300013004 | Freshwater | MSDTYINDQLNKAQQLLWGGSETENIEAHNIIAKLIKDRIEQTDLL* |
| Ga0164293_102826032 | 3300013004 | Freshwater | MKMSDEYINDQLSKAQALLWGGSETENIEAHNIISKLIRDRVEQISN* |
| Ga0164293_103503822 | 3300013004 | Freshwater | MSDVYINDQLNKAQKLLWGGSETENIEAHNIISKLIKDRIEQVEG* |
| Ga0164292_103485072 | 3300013005 | Freshwater | MRMSDEYINDQLNKAQKLLWGGSETENIEAHNIISKLIRDRVEQIS* |
| Ga0164292_105831731 | 3300013005 | Freshwater | MQQTDKYINEQLSKAQALLWSGSLHEQDEAHNIIAKLINDRMGKTEGQND* |
| Ga0164292_106015412 | 3300013005 | Freshwater | MSDTYINDQLNKAQQLLWGGSETENIEAHNIIAKLIKDRIEQTEGQ* |
| Ga0164292_108303232 | 3300013005 | Freshwater | MKMSDNYINDQLNTAQKLLWGGSETENIEAHNIIAKLISDRIEQADLS* |
| Ga0164294_101063882 | 3300013006 | Freshwater | MSDKYLNDQLITAQKLLWGGSETENIEAHNIIAKLIKEKVEQVEL* |
| Ga0164295_101008104 | 3300013014 | Freshwater | MSDKYLNDQLSTAQKLLWGGSETENIEAHNIIAKLIKDRIEQVEL* |
| Ga0163199_11423512 | 3300013092 | Freshwater | MTDKYLNEQLDTAQKLLWGGSETENIEAHNIISKLIYDKIEQVHL* |
| Ga0163199_13904962 | 3300013092 | Freshwater | MKITDKYLNEQLDKAQKLLWGGSETENIEAHNIISKLIYDRIEQVHL* |
| Ga0177922_101313553 | 3300013372 | Freshwater | MKQTDKYINEQLSKAQALLWSGSLHEQDEAHNIIA |
| Ga0177922_108197312 | 3300013372 | Freshwater | MRISDNYLNDQLNTAQALLWSGSLHEVDEAHNIIAKLISDRIEQVNPS* |
| Ga0177922_108921131 | 3300013372 | Freshwater | DQLITAQKLLWGGSETENIEAHNIIAKLIKEKIEQVEL* |
| Ga0177922_112429762 | 3300013372 | Freshwater | MSDEYLNERLNTAQKLLWGGSETENIEAHNIISKLIQDRMAWEEGTNV* |
| Ga0119952_10218123 | 3300014050 | Freshwater | MSDQYINDQLNKAQQLLWGGSETENIEAHNIIAKLIKDRVEQVGLLGAE* |
| Ga0134315_10480492 | 3300014962 | Surface Water | MKMTDKYVNEVLSEAQKLLWGGSETENIEAHNMIARLIKDRQDLIENS* |
| Ga0181364_10058619 | 3300017701 | Freshwater Lake | MKMKMSDEYLNERLNTAQKLLWGGSETENIAAHNIISKLIQDRMSGD |
| Ga0181356_11189692 | 3300017761 | Freshwater Lake | MRMSDNYLNDQLNTAQKLLWGGSETENIEAHNIISKLIQDRNAWEEGTNE |
| Ga0181343_10518731 | 3300017766 | Freshwater Lake | RRTKMKMSDKYLNDQLSKAQKLLWGGSETENIEAHNIIAKLIKDKIEQVEL |
| Ga0181343_11213033 | 3300017766 | Freshwater Lake | MQMSDIYINEQLNKAQKLLWGGSETENIEAHNIISKLIRDRVEQIS |
| Ga0181343_11725991 | 3300017766 | Freshwater Lake | DQLNTAQKLLWGGSETENIEAHNIIAKLIKDRIEQVDLS |
| Ga0181343_12315312 | 3300017766 | Freshwater Lake | MKMSDQYINDQLNKAKQQLWGGSETENIEAHNIISKLIRDRIEQTEGQ |
| Ga0181349_12112163 | 3300017778 | Freshwater Lake | MKMSDIYINERLNTAQKLLWGGSETENIEAHNIISKLIQDRMAWEEGTNDSL |
| Ga0181355_10531492 | 3300017785 | Freshwater Lake | MKMSDIYINERLNTAQKLLWGGSETENIEAHNIISKLIQDRMAWEEGTNV |
| Ga0188848_10384371 | 3300018775 | Freshwater Lake | MRMSDEYINDQLNTAQKLLWGGSETENIEAHNIIAKLIKDRIEQTNLT |
| Ga0188881_100059934 | 3300019146 | Freshwater Lake | MQQTDIYINDQLSKAQKLLWSGSLHEVDEAHNIIAKLINDRMEKAEGQND |
| Ga0188881_100182722 | 3300019146 | Freshwater Lake | MKMSDTYINDQLSKAQKLLWSGSLHEVDEAHNIVSNLIKDRIEQTDQI |
| Ga0181359_10513323 | 3300019784 | Freshwater Lake | MRMSDIYINDQLSKAQALLWSGSLHEVDEAHNIVSNLIQDRLEQVSN |
| Ga0181359_10754665 | 3300019784 | Freshwater Lake | MKMSDIYINERLNTAQKLLWGGSETENIEAHNIISKLIQDRNAWEEGTNE |
| Ga0181359_10837564 | 3300019784 | Freshwater Lake | MKMKMSDEYLNERLNTAQKLLWGGSETENIAAHNIISKLIQDRMSGDEGNNDSL |
| Ga0181359_11003512 | 3300019784 | Freshwater Lake | MRMSDNYLNDQLNTAQKLLWGGSETENIEAHNIIAKLINDRIEQADLS |
| Ga0181359_11270794 | 3300019784 | Freshwater Lake | MQQADHYINQELSKAQALLWSGSLHEVDEAHNIISNLIQDRMGKAEGTNV |
| Ga0181359_12701912 | 3300019784 | Freshwater Lake | MKMSDRYLNDQLDKAQKLLWGGSETENIEAHNIIAKLIKDREDLIEHS |
| Ga0207193_10293845 | 3300020048 | Freshwater Lake Sediment | MKMSDKYLNDQLSKAQALLWGGSETENIEAHNIIAKLIKEKIEQVEL |
| Ga0207193_103310616 | 3300020048 | Freshwater Lake Sediment | MKMSDAYINDQLNKAQKLLWGGSETENIEAHNIISKLIQDRIEQTNLT |
| Ga0207193_10570147 | 3300020048 | Freshwater Lake Sediment | MKMSDPYINDQLNKAQKLLWGGSETENIEAHNIIAKLIKDRMEGDEGENDSL |
| Ga0207193_13895011 | 3300020048 | Freshwater Lake Sediment | TKMKMSDAYLNDQLNTAQKLLWGGSETENIEAHNIIAKLIKDRIEQADLL |
| Ga0207193_17784052 | 3300020048 | Freshwater Lake Sediment | MKMSDKYINDQLSKAQSLLWGGSETENIEAHNIISKLIKDKIEQVELXVSNIKSMVM |
| Ga0211732_10215581 | 3300020141 | Freshwater | QSDRYINEQLSKAQALLWSGSLHEVDEAHNIISSLINDRMEKAEGQNV |
| Ga0211732_105452525 | 3300020141 | Freshwater | MSDNYINDQLNKAQKLLWSGSLHEQDEAHNIIAKLIKDRVEQADLL |
| Ga0211732_12053673 | 3300020141 | Freshwater | MRMSDQYLNDQLSKAQALLWSGSLHEVDEAHNIVSNLIQDRLEQVSN |
| Ga0211732_12450542 | 3300020141 | Freshwater | MKMSDQYLNDQLSKAQALLWSGSLHEVDEAHNIISNLIKDRIEQVSS |
| Ga0211732_128897413 | 3300020141 | Freshwater | MRMSDVYINDQLSKAQKLLWGGSETENIEAHNIIAKLIKDRIEQVEQ |
| Ga0211732_13412623 | 3300020141 | Freshwater | MKMSDRYVNDQLDKAQKLLWGGSETENIEAHNIIAKLIKDREDLIEHS |
| Ga0211732_14459113 | 3300020141 | Freshwater | MEMSDIYINDQLNKAQKLLWSGSLHEQDEAHNIIAKLIKDRTGKAEGTND |
| Ga0211732_15367632 | 3300020141 | Freshwater | MRMSDNYLNDQLNKAQELLWGGSETENIEAHNIIAKLISDRIVQVKN |
| Ga0211736_100298851 | 3300020151 | Freshwater | RTKMRMSDQYINDQLSKAQALLWSGSLHEVDEAHNIVSNLIKDRLEQVSN |
| Ga0211736_100513233 | 3300020151 | Freshwater | MEMSDIYINDQLNKAQKLLWSGSLHEQDEAHNIIAKLIKDRTGKAEGTNV |
| Ga0211736_101988493 | 3300020151 | Freshwater | MQQTDHYINTQLSKAQALLWSGSLHEVDEAHNIISKLIKDRMSEQEGTNE |
| Ga0211736_110137694 | 3300020151 | Freshwater | YLNDQLSKAQALLWSGSLHEVDEAHNIISNLIRDRMSQKNLD |
| Ga0211734_100938063 | 3300020159 | Freshwater | MRMSDIYINDQLSKAQALLWSGSLHEVDEAHNIISNLIRDRMSQKNLD |
| Ga0211734_105072534 | 3300020159 | Freshwater | KRMRRTKMKMSDRYVNDQLDKAQKLLWGGSETENIEAHNIIAKLIKDREDLIEHS |
| Ga0211734_105850499 | 3300020159 | Freshwater | MKMSDKYLNDQLSKAQALLWGGSETENIEAHNIIAKLIKDKIEQVEL |
| Ga0211734_109411202 | 3300020159 | Freshwater | MKISDEYLNDQLSKAQALLWSGSLHEVDEAHNIVSNLIRDKLEQVSN |
| Ga0211734_111022157 | 3300020159 | Freshwater | MKMSDKYLNDQLSKAQALLWGGSETENIEAHNIISKLIKDKIEQVEL |
| Ga0211734_111098332 | 3300020159 | Freshwater | MRMSDQYLNDQLSKAQALLWSGSLHEVDEAHNIVSKLIKDRLEQVSN |
| Ga0211734_112709243 | 3300020159 | Freshwater | MKTSDRYVDEQLSKAQALLWSGSLHEVDEAHNIISNLIKDRVEQTDLS |
| Ga0211733_102477581 | 3300020160 | Freshwater | MRMSDVYINDQLSQAQKLLWGGSETENIEAHNIIAKLIKDRIEQVEQ |
| Ga0211733_107937292 | 3300020160 | Freshwater | MQQTDHYINTQLSKAQALLWSGSLHEVDEAHNIISNLIQDRMGRAEGTNV |
| Ga0211726_101334322 | 3300020161 | Freshwater | MQQTDHYINTQLSKAQALLWSGSLHEVDEAHNIISNLIQDRMGKAEGTNV |
| Ga0211726_101738453 | 3300020161 | Freshwater | LKKRKRTKMRMSDQYLNDQLSKAQALLWSGSLHEVDEAHNIVSNLIKDRLEQVSN |
| Ga0211726_104168113 | 3300020161 | Freshwater | MQQTDKYINEQLNKAQKLLWSGSLHEQDEAHNIIAKLIKDRMSEQEGTNE |
| Ga0211726_107050713 | 3300020161 | Freshwater | LKKRKRTKMRMSDQYLNDQLSKAQALLWSGSLHEVDEAHNIVSNLIQDRLEQVSN |
| Ga0211726_108163793 | 3300020161 | Freshwater | MSNEYINDQLNKAQKLLWSGSLHEQDEAHNIIAKLIKDRVEQTNFS |
| Ga0211735_102318767 | 3300020162 | Freshwater | MSDRYVNDQLNKAQKLLWGGSETENIEAHNIIAKLIKDREDLIEHS |
| Ga0211729_102783623 | 3300020172 | Freshwater | MSNEYINDQLNKAQKLLWSGSLHEQDEAHNIIAKLIKDRVEQTNLS |
| Ga0211729_104198002 | 3300020172 | Freshwater | MQMSDIYINEQLNKAQKLLWGGSETENIEAHNIISKLIRDRMSGDEGTNE |
| Ga0211729_111689161 | 3300020172 | Freshwater | SDIYINDQLSKAQALLWSGSLHEVDEAHNIISNLIRDRMSQKNLD |
| Ga0211729_113211851 | 3300020172 | Freshwater | MQQTDKYINEQLSKAQALLWSGSLHEVDEAHNIISSLINDRM |
| Ga0211731_106911591 | 3300020205 | Freshwater | MKMSDAYLNDQLNTAQKLLWGGSETENIEAHNIIAKLIKDKIEQVEL |
| Ga0211731_112023954 | 3300020205 | Freshwater | MQMSNEYINDQLNKAQKLLWSGSLHEQDEAHNIIAKLIKDRVEQTNFS |
| Ga0208201_1058123 | 3300020480 | Freshwater | YINDQLNKAQQLLWGGSETENIEAHNIIAKLIKDRIEQTDLL |
| Ga0208052_1048993 | 3300020490 | Freshwater | MKMTDEYINDQLNTAQKLLWGGSETENIEAHNIIARLIKDRVEQTNLV |
| Ga0208483_10222282 | 3300020492 | Freshwater | MKMSDRYVNDQLNKAQKLLWGGSETENIEAHNMIAQLIKDREDLIEHS |
| Ga0208326_1014723 | 3300020494 | Freshwater | MKMSDEYLNDQLSKAQALLWGGSETENIEAHNIIAKLIKDKVEQVGL |
| Ga0208326_1133222 | 3300020494 | Freshwater | MQMSDIYINEQLNKAQKLLWGGSETENIEAHNIIAKLIKDRMSEQEGQNV |
| Ga0208050_10000208 | 3300020498 | Freshwater | MKMSDTYINDQLNKAQQLLWGGSETENIEAHNIIAKLIKDRIEQTDLL |
| Ga0208050_10001099 | 3300020498 | Freshwater | MKMSDDYINDQLNKAQQLLWGGSETENIEAHNIISKLIKDRIEQVS |
| Ga0208050_10011918 | 3300020498 | Freshwater | MKMSDEYINDQLNKAQKLLWGGSETENIEAHNIISKLIRDRMSEKEGTND |
| Ga0208050_10029534 | 3300020498 | Freshwater | MKMSDEYLNDQLSKAQALLWGGSETENIEAHNIISKLIKDKVEQVGL |
| Ga0208050_10093492 | 3300020498 | Freshwater | MKMSDTYINDQLNKAQQLLWGGSETENIEAHNIIAKLIKDRIEQTEGQ |
| Ga0208050_10101101 | 3300020498 | Freshwater | WMMRRRRQMQMTNEYINDQLNKAQKLLWGGSETENIEAHNIIARLIKDREHLIQNS |
| Ga0208050_10122752 | 3300020498 | Freshwater | MKMSDEYLNDQLSKAQKLLWGGSETENIEAHNIIAKLIKDKIEQVGL |
| Ga0208050_10230271 | 3300020498 | Freshwater | MKMSDDYINDQLNKAQKLLWGGSETENIEAHNIIARLIKDRVEQTNLT |
| Ga0208090_100048817 | 3300020513 | Freshwater | MQQTDKYINEQLSKAQALLWSGSLHEQDEAHNIIAKLINDRMGKAEGQND |
| Ga0208202_10256252 | 3300020514 | Freshwater | MKMSDEYINEQLSKAQALLWSGSLHEQDEAHNIIAKLINDRMGKTEGQNV |
| Ga0208223_10063453 | 3300020519 | Freshwater | MKMSDIYINDQLSKAQALLWSGSLHEVDEAHNIVSNLIRDRLEQVSN |
| Ga0208223_10083874 | 3300020519 | Freshwater | MQMTNEYINDQLNKAQKLLWGGSETENIEAHNIIARLIKDREHLIQNS |
| Ga0208858_10032534 | 3300020524 | Freshwater | MKMSDKYLNDQLGKAQELLWGGSETENIEAHNIISKLIKDKIEQVEL |
| Ga0208233_10000394 | 3300020529 | Freshwater | MSDEYLNDQLSKAQALLWGGSETENIEAHNIISKLIKDKIEQVGL |
| Ga0208235_10072836 | 3300020530 | Freshwater | MKTSDRYVDDQLSKAQALLWSGSLHEVDEAHNIISNLILDRMEQTDL |
| Ga0208364_100017140 | 3300020533 | Freshwater | MKMSDEYLNDQLSKAQALLWGGSETENIEAHNIISKLIKDKIEQVGL |
| Ga0208722_10160196 | 3300020537 | Freshwater | MKTSDRYVDDQLSKAQALLWSGSLHEVDEAHNIISNLILDRMEQTDLT |
| Ga0208359_100013641 | 3300020541 | Freshwater | MSDEYLNDQLSKAQKLLWGGSETENIEAHNIIAKLIKDKIEQVGL |
| Ga0207942_10052673 | 3300020549 | Freshwater | MKMTDEYINDQLNTAQKLLWGGSETENIEAHNIIAKLIKDRVEQTNLV |
| Ga0207942_10118353 | 3300020549 | Freshwater | MKMSDEYINDQLNKAQKLLWGGSETENIEAHNIIAKLIKDRVEQVGL |
| Ga0207942_10121191 | 3300020549 | Freshwater | DDQLSKAQALLWSGSLHEVDEAHNIISNLILDRMEQTDLA |
| Ga0208360_10105993 | 3300020551 | Freshwater | LWTQCSKTMRRKKMKMSDTYINDQLNKAQQLLWGGSETENIEAHNIIAKLIKDRIEQTDL |
| Ga0208360_10125703 | 3300020551 | Freshwater | YINDQLNKAQQLLWGGSETENIEAHNIISKLIKDRIEQVS |
| Ga0208231_10043951 | 3300020557 | Freshwater | LSKAQALLWSGSLHEQDEAHNIIAKLINDRMGKTEGQND |
| Ga0208231_10050128 | 3300020557 | Freshwater | LSKAQALLWSGSLHEQDEAHNIIAKLINDRMGKAEGQND |
| Ga0208597_10157724 | 3300020562 | Freshwater | MKMSDNYINDQLSRAQELLWGGSETENIEAHNIISKLIRDRIEQVEG |
| Ga0208719_10455212 | 3300020564 | Freshwater | MRMTDQYINDQLNTAQKLLWGGSETENIEAHNIIAKLIKDRIEQVNLS |
| Ga0208465_10516262 | 3300020570 | Freshwater | MKMSDEYINDQLNKAQKLLWGGSETENIEAHNIISKLIRDRMEGDEGQND |
| Ga0207909_10164995 | 3300020572 | Freshwater | MQQTDIYINEQLNKAQKLLWSGSLHEQDEAHNIIAKLIKDRMPDA |
| Ga0207909_10206971 | 3300020572 | Freshwater | MQMTNEYINNELNKAQKLLWGGSETENIEAHNIIARLIKDREHLIQNS |
| Ga0208053_10529913 | 3300020575 | Freshwater | MKMSDRYVNDQLDKAQKLLWGGSETENIEAHNIIAKLIKDRIEQVNLS |
| Ga0214168_11252043 | 3300021140 | Freshwater | MKMSDEFINDQLNKAQKLLWGGSETENIEAHNIIA |
| Ga0213920_10260923 | 3300021438 | Freshwater | MQTTDKYLNEELARAQQLLWGGSETENIEAHNIISSLIKHRMEKNS |
| Ga0213920_10395082 | 3300021438 | Freshwater | MKMSDEYINDQLNKAQKLLWGGSETENIEAHNIIAKLIKDRMAEN |
| Ga0194048_100155488 | 3300021519 | Anoxic Zone Freshwater | MKMSDTYINDQLNKAQQLLWGGSETENIEAHNIIAKLISDRVEQADLS |
| Ga0194048_100170013 | 3300021519 | Anoxic Zone Freshwater | MNMSDAYLNDRLDKAQKLLWGGSETENIEAHNIIAELIKDRIEQTN |
| Ga0194048_100791733 | 3300021519 | Anoxic Zone Freshwater | MRMSDIYINDQLSKAQALLWSGSLHEVDEAHNIVSNLIIDRLEQVSN |
| Ga0213921_10619051 | 3300021952 | Freshwater | MKMSDEYINDQLNKAQQLLWGGSETENIEAHNIISKLIRDRIEQVNLI |
| Ga0213921_10662892 | 3300021952 | Freshwater | MKMSDEYINDQLNTAQKLLWGGSETENIEAHNIIAKLIKDRVEQIS |
| Ga0213922_10543013 | 3300021956 | Freshwater | MKMSDQYVDEVLAKAQQLLWGGSETENIEAHNMIAKLIKDRSEQIKNS |
| Ga0213922_10979691 | 3300021956 | Freshwater | KMSDEYINDQLNTAQKLLWGGSETENIEAHNIIAKLIKDRVEQIS |
| Ga0222714_100216046 | 3300021961 | Estuarine Water | MRMSDQYINDQLSKAQALLWSGSLHEVDEAHNIIAKLIKDRVEQVSN |
| Ga0222714_100517559 | 3300021961 | Estuarine Water | MKMSDEYINEQLSKAQKLLWSGSLHEVDEAHNIVSNLIKDRVEQVSN |
| Ga0222714_100635446 | 3300021961 | Estuarine Water | MQQTDIYINDQLSKAQKLLWSGSLHEVDEAHNIIAKLIKDRMAEKEGQNV |
| Ga0222714_100722832 | 3300021961 | Estuarine Water | MKMSDKYLNDQLSTAQKLLWGGSETENIEAHNIIAKLIKDRIEQVEL |
| Ga0222714_100993734 | 3300021961 | Estuarine Water | MKMSDDYINDQLSKAQALLWGGSETENIEAHNIISKLIKDKVEQVGL |
| Ga0222714_101208586 | 3300021961 | Estuarine Water | MKMTDEFINDQLTKAQKLLWGGSETENIEAHNIIAKLIKDRMPNDKV |
| Ga0222714_101508913 | 3300021961 | Estuarine Water | MKMSDEYINDQLSTAQKLLWGGSETENIEAHNIISKLIKDRVEQASN |
| Ga0222714_101613165 | 3300021961 | Estuarine Water | MKMSDTYINDQLNKAQKLLWGGSETENIEAHNIISKLIKDRIEQTEGQ |
| Ga0222714_101844983 | 3300021961 | Estuarine Water | MKMSDEYINDQLSKAQKLLWGGSETENIEAHNIISKLIKDRVEQIN |
| Ga0222714_102376464 | 3300021961 | Estuarine Water | MQQTDIYIDQQLNKAQQLLWGGSETENIEAHNIIAKLIKDRMSDKGE |
| Ga0222714_103187672 | 3300021961 | Estuarine Water | MQQTDKYINEQLSKAQALLWSGSLHEQDEAHNIIAKLIKDRMGETEGQNV |
| Ga0222714_104757341 | 3300021961 | Estuarine Water | TDIYINDQLSKAQALLWSGSLHEVDEAHNIIAKLIKDRMAKKEGQNA |
| Ga0222714_105452591 | 3300021961 | Estuarine Water | KRMKGTKMKMSDVYINDQLNKAQKLLWSGSLHEQDEAHNIIAKLIKDREDLIQDS |
| Ga0222714_106313102 | 3300021961 | Estuarine Water | MTVSKEFINDKLNEAQQLLWGGSETENIAAHNIIAELIKDLQDEQ |
| Ga0222714_106856901 | 3300021961 | Estuarine Water | MKMSDTYINDQLNKAQKLLWGGSETENIEAHNIIAELIKDRIEQTN |
| Ga0222713_1001003420 | 3300021962 | Estuarine Water | MKMSDQYIDEVLAKAQQLLWGGSETENIEAHNLISKLIRDRMEDSESGAE |
| Ga0222713_100560264 | 3300021962 | Estuarine Water | MQQTDIYINDQLSKAQALLWSGSLHEVDEAHNIIAKLIKDRMAKKEGQNA |
| Ga0222713_100666326 | 3300021962 | Estuarine Water | MKMSDPYIDEQLNKAQKLLWGGSETENIEAHNIIAKLIKDRMSEQEGQND |
| Ga0222713_101059436 | 3300021962 | Estuarine Water | MKMSDTYINDQLNKAQKLLWGGSETENIEAHNIISKLIKDRMGETEGQNDSL |
| Ga0222713_101271213 | 3300021962 | Estuarine Water | MRMSDQYLNDQLSKAQALLWSGSLHEVDEAHNIVSNLIRDRLEQVSN |
| Ga0222713_101332427 | 3300021962 | Estuarine Water | MQQTDIYINDQLSKAQALLWSGSLHEVDEAHNIIAKLI |
| Ga0222713_102000343 | 3300021962 | Estuarine Water | MKMSDVYINDQLNKAQQLLWGGSETENIEAHNIISKLISDRMEQVNL |
| Ga0222713_103361893 | 3300021962 | Estuarine Water | MKMSDQYINDQLNKAQKLLWGGSETENIEAHNIIAKLIKDRVEQVNLI |
| Ga0222713_103703273 | 3300021962 | Estuarine Water | RRMKMKMSDTYINDQLNKAQKLLWGGSETENIEAHNIISKLIRDRIEQTEGQ |
| Ga0222713_104466411 | 3300021962 | Estuarine Water | MKMSDVYINDQLNKAQKLLWGGSETENIEAHNIIAELIKDRIEQTN |
| Ga0222713_104473083 | 3300021962 | Estuarine Water | MQQTDKYINEQLNKAQKLLWGGSETENIEAHNIIAKLIKDRMSGQEGTNE |
| Ga0222713_105552343 | 3300021962 | Estuarine Water | MKMSNEYLNDQLVIAQKLLWSGSLHEVDEAHNIIAKLIEDRIEQVGL |
| Ga0222713_105920491 | 3300021962 | Estuarine Water | MSDVYINDQLNKAQKLLWSGSLHEQDEAHNIIAKLIKDREDLI |
| Ga0222713_106949141 | 3300021962 | Estuarine Water | MKMSDSYINDQLNKAQKLLWGGSETENIEAHNIISKLIRDRVEQADLL |
| Ga0222713_107367421 | 3300021962 | Estuarine Water | MQQTDIYINDQLSKAQKLLWSGSLHEVDEAHNIISDLIRDRMSDKGN |
| Ga0222712_1001636514 | 3300021963 | Estuarine Water | MRMSDNYINDQLSTAQKLLWGGSETENIEAHNIIAKLIKDRIEQTD |
| Ga0222712_100488584 | 3300021963 | Estuarine Water | MKMSDKYINDQLSTAQKLLWGGSETENIEAHNIISKLIKDKIEQVEL |
| Ga0222712_100916456 | 3300021963 | Estuarine Water | MQQTDIYINDQLSKAQALLWSGSLHEVDEAHNIISDLIRDRMSDKGN |
| Ga0222712_101299897 | 3300021963 | Estuarine Water | MQQTDKYINEQLSKAQALLWSGSLHEQDEAHNIIAKLIKDRMSEQEGTNE |
| Ga0222712_101422743 | 3300021963 | Estuarine Water | MKMSDTYINDQLSKAQKLLWGGSETENIEAHNIIAKLIKDRVEQTEGQ |
| Ga0222712_103054481 | 3300021963 | Estuarine Water | ISSRKTKGTKMKMSDAYINDQLSTAQKLLWGGSETENIEAHNIIAKLIKDRVEQTNLI |
| Ga0222712_104334571 | 3300021963 | Estuarine Water | RRKKMQQTDIYINDQLSKAQALLWSGSLHEVDEAHNIIAKLIKDRMAKKEGQNA |
| Ga0222712_104832364 | 3300021963 | Estuarine Water | YINDQLNKAQKLLWGGSETENIEAHNIISKLIQDRMAWEEGTNV |
| Ga0222712_105378703 | 3300021963 | Estuarine Water | MKMSDPYIDEQLNKAQKLLWGGSETENIEAHNIISKLIRDRMSGDEGENE |
| Ga0222712_106661633 | 3300021963 | Estuarine Water | MKITDKYLNEQLDKAQKLLWGGSETENIEAHNIISKLIYDRIEQVNQ |
| Ga0222712_107489991 | 3300021963 | Estuarine Water | YLNDQLSRAQALLWGGSETENIEAHNIISKLIRDKIEQVEL |
| Ga0222712_108255272 | 3300021963 | Estuarine Water | MQQTDKYINEQLSKAQALLWSGSLHEQDEAHNIIAKLIKDRMGKSEGQNDSL |
| Ga0181354_11183112 | 3300022190 | Freshwater Lake | MRMSDIYINDQLSKAQALLWSGSLHEVDEAHNIVSNLIRDRLEQVSN |
| Ga0181354_12277532 | 3300022190 | Freshwater Lake | MQMSDPYINEQLNKAQKLLWGGSETENIEAHNIIAKLIKDRMSEQEGTNE |
| Ga0181351_10756124 | 3300022407 | Freshwater Lake | MKMSDKYLNDQLSTAQKLLWGGSETENIEAHNIIAKLIKDKIEQAEL |
| Ga0181351_10874583 | 3300022407 | Freshwater Lake | MQQTDHYINTELSKAQALLWSGSLHEVDEAHNIISNLIQDRMGKAEGTNV |
| Ga0181351_11012152 | 3300022407 | Freshwater Lake | MKMSDVYINDQLNKAQQLLWGGSETENIEAHNIIAKLIKDRIEQTDLL |
| Ga0212124_101283401 | 3300022553 | Freshwater | MKMTDKYLNEQLDTAQKLLWGGSETENIEAHNIISKLIYDKIE |
| Ga0212124_101316074 | 3300022553 | Freshwater | MKITDKYLNEQLDKAQKLLWGGSETENIEAHNIISKLIYDRIEQVHL |
| Ga0228702_11162463 | 3300022748 | Freshwater | MKMSDEYINDQLNKAQKLLWGGSETENIEAHNIISKLIRDRVEQIDL |
| Ga0214917_100060473 | 3300022752 | Freshwater | MKMSDVYINDQLNKAQQLLWGGSETENIEAHNIISKLISDRMEQVDL |
| Ga0214917_102827153 | 3300022752 | Freshwater | MKMSDAYLNDQLDKAQKLLWGGSETENIEAHNIIAKLIKDRMEQKDLS |
| Ga0214921_10000248117 | 3300023174 | Freshwater | MQMSDNYLNDQLNTAQKLLWGGSETENIEAHNIIAKLIKDRIEQTN |
| Ga0214921_1000113955 | 3300023174 | Freshwater | MQQTDNHINTELSKAQALLWSGSLHEVDEAHNIISNLIKDRMGKAEGTNV |
| Ga0214921_100051385 | 3300023174 | Freshwater | MKMTDTYLNDQLDKAQKLLWGGSETENIEAHNIIARLIKDREGLIKNS |
| Ga0214921_100705008 | 3300023174 | Freshwater | MKMSDAYINDVLNKAQKLLWGGSETENIEAHNMIAQLIKDRVEQTEGI |
| Ga0214921_101027694 | 3300023174 | Freshwater | MSDEYIDDQLNKAQKLLWGGSETENIEAHNIIAKLIKDRMQTIDQ |
| Ga0214921_101399935 | 3300023174 | Freshwater | MKMSDQYINDQLNKAQKLLWGGSETENIEAHNIIARLIKDREDLIENS |
| Ga0214921_102282822 | 3300023174 | Freshwater | MSDTYINDQLNKAQQLLWGGSETENIEAHNIISKLIRDRIEQADLS |
| Ga0214921_102424994 | 3300023174 | Freshwater | MKMSDEYLNTVLAKAQKLLWGGSETENIEAHNLISDLIKDRIEQVSN |
| Ga0214921_103165451 | 3300023174 | Freshwater | MKMSDAYLNDQLNTAQKLLWGGSETENIEAHNIIAKLIKDRIEQTN |
| Ga0214919_100009946 | 3300023184 | Freshwater | MKMSDAYLNAQLDTAQKLLWGGSETENIEAHNIISKLIYDRIEQTE |
| Ga0214919_1000593134 | 3300023184 | Freshwater | MEMTNEYINDRLNIAQQLLWGGSETENIEAHNIIAELIKDRTETIGAK |
| Ga0214919_101174065 | 3300023184 | Freshwater | MKMSDAYLNDQLDKAQKLLWGGSETENIEAHNIISKLIRDRIEQADLL |
| Ga0214919_102083973 | 3300023184 | Freshwater | MKMSDAYLNDQLNKAQKLLWGGSETENIEAHNIIAKLIRDRIEQTDLS |
| Ga0214919_102244774 | 3300023184 | Freshwater | MKMSDGYLNEQLDKAQKLLWGGSETENIEAHNIIAKLIKDRIEQTNLM |
| Ga0214919_106685472 | 3300023184 | Freshwater | MKMTDRYLNDQLDTAQKLLWGGSETENIEAHNIIAKLIKDREDLIEHS |
| Ga0255147_10510511 | 3300024289 | Freshwater | MKMSDNYINEQLSKAQQLLWGGSETENIEAHNIISKLIRD |
| Ga0255148_10709842 | 3300024306 | Freshwater | MKMSDSYINDQLSKAQKLLWGGSETENIEAHNIIAKLIKDRIEQTNNS |
| Ga0244777_100006304 | 3300024343 | Estuarine | MKMSDVYINDQLNKAQQLLWGGSETENIEAHNIIAKLIKDRIEQTDLT |
| Ga0244777_100021388 | 3300024343 | Estuarine | MRMSDNYINDQLNKAQKLLWGGSETENIEAHNIISKLIKDRVEQTDQI |
| Ga0244777_100026885 | 3300024343 | Estuarine | MKMSDDYINDQLNKAQKLLWGGSETENIEAHNIISRLIKDKIEQVS |
| Ga0244777_1001313212 | 3300024343 | Estuarine | MKMSDIYLNDQLDKAQKLLWGGSETENIEAHNIIAKLISDRIEQADLS |
| Ga0244777_103945843 | 3300024343 | Estuarine | MKMSDAYLNDQLNTAQKLLWGGSETENIEAHNIIAQLIKDRIEQADLL |
| Ga0244777_105574053 | 3300024343 | Estuarine | MTLKQKKRMRTKMKMSDEYLNDQLNIAQKLLWGGSETENIEAHNIISKLIKDRVEQI |
| Ga0244777_105931482 | 3300024343 | Estuarine | MSDRYVNDQLDKAQKLLWGGSETENIEAHNIIAKLIKDRIEQTNLT |
| Ga0244775_1000009255 | 3300024346 | Estuarine | MSDNYINDQLNKAQKLLWGGSETENIEAHNIISKLIKDRVEQTDQI |
| Ga0244775_10000125127 | 3300024346 | Estuarine | VNDQLDKAQKLLWGGSETENIEAHNIIAKLIKDRIEQTNLT |
| Ga0244775_1000088555 | 3300024346 | Estuarine | MMRRNQMKMSDIYLNDQLDKAQKLLWGGSETENIEAHNIIAKLISDRIEQADLS |
| Ga0244775_1000379831 | 3300024346 | Estuarine | MSDRYVNDQLDKAQKLLWGGSETENIEAHNIIAKLIKDREDLIEHS |
| Ga0244775_100225703 | 3300024346 | Estuarine | MKMSDRYVNDQLNKAQKLLWGGSETENIEAHNMIVQLIKDREDLIENS |
| Ga0244775_1002408914 | 3300024346 | Estuarine | MRMSDNYLNDQLNTAQKLLWGGSETENIEAHNIIAKLISDRIEQADLS |
| Ga0244775_100613039 | 3300024346 | Estuarine | MKMSDPYINDQLNKAQKLLWGGSETENIEAHNIIAKLIKDRMEGNEGENDSL |
| Ga0244775_100687123 | 3300024346 | Estuarine | MRMSDNYLNDQLNTAQKLLWGGSETENIEAHNIIAKLISDRIEQVDPS |
| Ga0244775_100948579 | 3300024346 | Estuarine | MKMSDEYLNDQLSKAQALLWGGSETENIEAHNIIAKLIKDKIEQVGL |
| Ga0244775_101243695 | 3300024346 | Estuarine | MQMSDIYINEQLNKAQKLLWGGSETENIEAHNIISKLIKDRMSEQEGTNE |
| Ga0244775_101992402 | 3300024346 | Estuarine | MEMSDIYINDQLNKAQKLLWGGSETENIEAHNIISKLIRDRMSGDEGTNESL |
| Ga0244775_102016215 | 3300024346 | Estuarine | MKMSDQYINDQLNKAQQLLWGGSETENIEAHNIISKLIKDRIEQVGDRG |
| Ga0244775_102162332 | 3300024346 | Estuarine | MKMSDKYLNDQLSKAQKLLWGGSETENIEAHNIISKLIKEKIEQVEL |
| Ga0244775_102358668 | 3300024346 | Estuarine | MKMSDAYLNDRLDKAQKLLWGGSETENIEAHNIIAELIKDRIE |
| Ga0244775_102369517 | 3300024346 | Estuarine | MKMSDEYINQILNRAQELLWGGSETENIEAHNLISKLIKDRVEQVSN |
| Ga0244775_102369824 | 3300024346 | Estuarine | MKMSDKYLNDQLSTAQKLLWGGSETENIEAHNIIAKLIKDKIEQVEL |
| Ga0244775_102530813 | 3300024346 | Estuarine | WIQCLKMMRRKKMKMSDEYINDQLSTAQKLLWGGSETENIEAHNIISKLIKDRVEQVSN |
| Ga0244775_102918123 | 3300024346 | Estuarine | MKMSDKYLNDQLSKAQALLWGGSETENIEAHNIISKLIRDKIEQVEL |
| Ga0244775_103464702 | 3300024346 | Estuarine | MEMTNEYINDRLNIAQQLLWGGSETENIEAHNIIAELIKDRIETVGAK |
| Ga0244775_103597995 | 3300024346 | Estuarine | MKMSDIYINDQLNKAQKLLWGGSETENIEAHNIISKLIRDRMERDEGTNDPL |
| Ga0244775_104077642 | 3300024346 | Estuarine | MKMSDEYLNDQLNIAQKLLWGGSETENIEAHNIISKLIKDRVEQI |
| Ga0244775_104155385 | 3300024346 | Estuarine | INERLNTAQKLLWGGSETENIEAHNIISKLIQDRNAWEEGTNE |
| Ga0244775_104548173 | 3300024346 | Estuarine | MKMSDEYINDQLNKAQTLLWGGSETENIEAHNIIAKLIKDRVEQTNLI |
| Ga0244775_104853213 | 3300024346 | Estuarine | MKMTDKYLNEQLDIAQKLLWGGSETENIEAHNIISKLIYDRIEQVNL |
| Ga0244775_105086152 | 3300024346 | Estuarine | MKMSDEYLNNQLSRAQELLWGGSETENIEAHNIIAKLIKDRIEQADLL |
| Ga0244775_106885233 | 3300024346 | Estuarine | MQQTDHYINTELSKAQALLWSGSLHEVDEAHNIISNLIKDRMGKTEGTNV |
| Ga0244775_107474203 | 3300024346 | Estuarine | MQQTDNYINEQLSKAQALLWSGSLHEQDEAHNIIAKLINDRMGKAEGQND |
| Ga0244775_107839761 | 3300024346 | Estuarine | MKMSDRYVNDQLNKAQKLLWGGSETENIEAHNIIAKLIKDREDLIEHS |
| Ga0244775_109502181 | 3300024346 | Estuarine | MKMSDEYINDQLNKAQKLLWGGSETENIEAHNIISKIIRDRMSGDEGTND |
| Ga0244775_109622531 | 3300024346 | Estuarine | TQCLKKRKRRKKMKMSDTYINDQLSKAQALLWSGSLHEVDEAHNIVSNLIQDRLGNE |
| Ga0244775_110821953 | 3300024346 | Estuarine | MKMSDIYINDQLNKAQKLLWGGSETENIEAHNIISKLIQDRN |
| Ga0244775_114991953 | 3300024346 | Estuarine | MKMSDVYINDQLNKAQKLLWGGSETENIEAHNIISKLIRDRIEQTEGQ |
| Ga0244776_1000111915 | 3300024348 | Estuarine | MMRRKKMKMSDVYINDQLNKAQQLLWGGSETENIEAHNIIAKLIKDRIEQTDLT |
| Ga0244776_100512152 | 3300024348 | Estuarine | MSDNYLNDQLNKAQKLLWGGSETENIEAHNIIAELIKDRIEQANLT |
| Ga0244776_100852621 | 3300024348 | Estuarine | MKMSDMYLNDQLNKAQKLLWGGSETENIEAHNIIAKLIKDRVEQTNLV |
| Ga0244776_100906237 | 3300024348 | Estuarine | MKMSDQYLNDQLNTAQKLLWGGSETENIEAHNIIAKLIKDRIEQADLL |
| Ga0244776_104057032 | 3300024348 | Estuarine | MKMSDEYLNERLNTAQKLLWGGSETENIEAHNIISKLIRDRMEGDEGQYDSL |
| Ga0244776_106416623 | 3300024348 | Estuarine | QALLKRCPKMMRRKKMKMSDQYINDQLNTAQKLLWGGSETENIEAHNIIAKLIKDRVEQTDLV |
| Ga0255224_10372843 | 3300024483 | Freshwater | MKMSDAYINDQLNKAQQLLWGGSETENIEAHNIISKLIKDRIEQVGDRG |
| Ga0255185_10281533 | 3300024490 | Freshwater | MQQTDKYINEQLSKAQALLWSGSLHEVDEAHNIIAKLINDRMGKAEGQNV |
| Ga0256299_10138086 | 3300024533 | Freshwater | LTQCLKKRKRRKKMKMSDTYINDQLSKAQALLWSGSLHEVDEAHNIVSNLIQDRLGNE |
| Ga0255225_10013599 | 3300024537 | Freshwater | MKMSDTYINDQLSKAQALLWSGSLHEVDEAHNIVSNLIQDRLEQVSN |
| Ga0255237_11091901 | 3300024564 | Freshwater | DQLSKAQALLWSGSLHEVDEAHSIVSNLIRDRLEQVSN |
| Ga0256302_10517564 | 3300024571 | Freshwater | MKMSDAYINDQLNKAQQLLWGGSETENIEAHNIIAKLIKDRIEQVGDRG |
| Ga0208546_10226304 | 3300025585 | Aqueous | MKMTDNYINERLNKAQQLLWGGSETENIEAHNIIAELIKDRIEQTEGI |
| Ga0208546_10367721 | 3300025585 | Aqueous | MKMSDNYINEQLSKAQQLLWGGSETENIEAHNIISKLIKDKVEQVEQ |
| Ga0208546_10564054 | 3300025585 | Aqueous | MKMSDTYINDQLNKAQKLLWGGSETENIEAHNIISKLIRDRIEQTEGQ |
| Ga0255245_10316003 | 3300025744 | Freshwater | KKKMKMSDIYINDQLSKAQALLWSGSLHEVDEAHNIVSNLIQDRLEQVSN |
| Ga0255160_10729471 | 3300026457 | Freshwater | DQLSKAQKLLWGGSETENIEAHNIIAKLIKDRIEQTNNS |
| Ga0209850_10205003 | 3300026931 | Sand | LKKRKRRKKMKMSDTYINDQLSKAQALLWSGSLHEVDEAHNIVSNLIQDRLGNE |
| Ga0208009_10328733 | 3300027114 | Deep Subsurface | MQMSDIYINEQLNKAQKLLWGGSETENIEAHNIIAKLIKDRMSEQEGTNE |
| Ga0208009_10504442 | 3300027114 | Deep Subsurface | MKMSDPYIDEQLNKAQKLLWGGSETENIEAHNIISKLIRDRMSGDEGTNGSL |
| Ga0255074_10112131 | 3300027121 | Freshwater | MQQTDKYINDQLSKAQALLWSGSLHEQDEAHNIIAKLINDRMEKDEGQND |
| Ga0255074_10261951 | 3300027121 | Freshwater | MKMSDNYLNDQLDRAQKLLWGGSETENIEAHNIISKLIKDRIDINGSV |
| Ga0255071_10030269 | 3300027127 | Freshwater | MKMSDAYINDQLNKAQQLLWGGSETENIEAHNIIAK |
| Ga0255071_10136091 | 3300027127 | Freshwater | MMKIKMSDVYINDQLNKAQALLWSGSLHEVDEAHNIISKLIQDR |
| Ga0255067_10550212 | 3300027129 | Freshwater | MQQTDKYINEQLSKAQALLWSGSLHEQDEAHNIIAKLIKDRMRETEGTNDSL |
| Ga0255066_10133672 | 3300027131 | Freshwater | MMKIKMSDVYINDQLNKAQALLWSGSLHEVDEAHNIISKLIQDRLGNG |
| Ga0255110_10529381 | 3300027132 | Freshwater | MRMSDQYINDQLSKAQALLWSGSLHEVDEAHNIVSNLI |
| Ga0255070_10051321 | 3300027133 | Freshwater | MKMSDAYINDQLNKAQQLLWGGSETENIEAHNIISKL |
| Ga0255064_10037578 | 3300027138 | Freshwater | MKMSDAYINDQLNKAQQLLWGGSETENIEAHNIIAKLIKDRIEQVGD |
| Ga0255082_10203995 | 3300027139 | Freshwater | MKMSDAYINDQLNKAQQLLWGGSETENIEAHNIIAKL |
| Ga0255080_10103041 | 3300027140 | Freshwater | MKMSDAYINDQLNKAQQLLWGGSETENIEAHNIISKLIK |
| Ga0255080_10261031 | 3300027140 | Freshwater | MRMSDIYINDQLSKAQALLWSGSLHEVDEAHNIVSNLIRDRL |
| Ga0255080_10641042 | 3300027140 | Freshwater | MQQTDKYINEQLSKAQALLWSGSLHEQDEAHNIIAKLINDRMEKVEGQNDSL |
| Ga0255065_10300004 | 3300027142 | Freshwater | AYLNDRLDKAQKLLWGGSETENIEAHNIIAELIKDRIEQTN |
| Ga0255112_10929691 | 3300027150 | Freshwater | NDQLSKAQALLWSGSLHEVDEAHNIVSKLIQDRMAWEEGTNV |
| Ga0255063_10135453 | 3300027151 | Freshwater | VGTLWTQRKKRKKTKMKMSDAYLNDRLDKAQKLLWGGSETENIEAHNIIAELIKDRIEQT |
| Ga0208921_10040928 | 3300027188 | Estuarine | MKMSDRYVNDQLDKAQKLLWGGSETENIEAHNIIAKLIKDRIEQTNLT |
| Ga0208800_10205423 | 3300027193 | Estuarine | LTGTSLMRSLKMMRRNQMKMSDIYLNDQLDKAQKLLWGGSETENIEAHNIIAKLIKDREDLIEHS |
| Ga0208925_1168951 | 3300027203 | Estuarine | MRMTDQYINDQLNTAQKLLWGGSETENIEAHNIIAKLIKDRIEQVNIS |
| Ga0208023_100018810 | 3300027206 | Estuarine | MRSLKMMRRNQMKMSDIYLNDQLDKAQKLLWGGSETENIEAHNIIAKLISDRIEQADLS |
| Ga0208554_10019026 | 3300027212 | Estuarine | MSDAYLNDQLNTAQKLLWGGSETENIEAHNIIAQLIKDRIEQADLL |
| Ga0208554_10655421 | 3300027212 | Estuarine | MKMSDRYVNDQLDKAQKLLWGGSETENIEAHNIIAKLIKDREDL |
| Ga0208166_10145503 | 3300027215 | Estuarine | RCPKMMRRKKMKMSDVYINDQLNKAQQLLWGGSETENIEAHNIIAKLIKDRIEQTDLT |
| Ga0208167_10770752 | 3300027219 | Estuarine | LLTQCLKKRKKRTKMRMSDIYINDQLSKAQALLWSGSLHEVDEAHNIVSNLIRDRLEQVS |
| Ga0208164_10545993 | 3300027224 | Estuarine | MRMSDIYINDQLSKAQALLWSGSLHEVDEAHNIVSN |
| Ga0208164_10676863 | 3300027224 | Estuarine | YINDQLNKAQQLLWGGSETENIEAHNIISKLISDRMEQVDL |
| Ga0208930_10425863 | 3300027237 | Estuarine | MRMSDNYINDQLNKAQKLLWGGSETENIEAHNIIAELIKDRIEQANLT |
| Ga0208808_10114823 | 3300027238 | Estuarine | STLSTQCLRRKRKKKKMKMSDQYVDAVLTEAQRLLWGGSETENIEAHNLISKLIRDRMEQKNLN |
| Ga0208807_10587242 | 3300027239 | Estuarine | MRMSDNYINDQLNKAQKLLWGGSETENIEAHNIISKLIKDRVEQI |
| Ga0208931_10126732 | 3300027246 | Estuarine | MSDVYINDQLNKAQKLLWGGSETENIEAHNIIAELIKDRIEQTN |
| Ga0208931_10390404 | 3300027246 | Estuarine | KTKMRMSDNYINDQLNKAQKLLWGGSETENIEAHNIISKLIKDRVEQTDQI |
| Ga0208679_10518981 | 3300027247 | Estuarine | KRTKMRMSDIYINDQLSKAQALLWSGSLHEVDEAHNIVSNLIRDRLEQVSN |
| Ga0208681_10393371 | 3300027255 | Estuarine | PKMMRRKKMKMSDVYINDQLNKAQQLLWGGSETENIEAHNIIAKLIKDRIEQTDLT |
| Ga0255132_11115151 | 3300027293 | Freshwater | TYINDQLNKAQQLLWGGSETENIEAHNIIAKLISDRIEQSDLL |
| Ga0255087_10488931 | 3300027337 | Freshwater | MKMSDQYINDQLNKAQQLLWGGSETENIEAHNIISKLIKDR |
| Ga0209300_10099468 | 3300027365 | Deep Subsurface | MKMSDQYIDEVLNKAQKLLWGGSETENIEAHNLISKLIKDRVEQVSN |
| Ga0208022_11317281 | 3300027418 | Estuarine | MSDTYINDQLSKAQALLWSGSLHEVDEAHNIVSNLIQDRLGNE |
| Ga0255084_10550561 | 3300027488 | Freshwater | MQQTDKYINEQLSKAQALLWSGSLHEQDEAHNIIAKLIKDRMR |
| Ga0255093_10511064 | 3300027492 | Freshwater | MKMSDAYINDQLNKAQQLLWGGSETENIEAHNIIA |
| Ga0208787_11568441 | 3300027518 | Deep Subsurface | IYINEQLNKAQKLLWGGSETENIEAHNIIAKLIKDRMSEQEGQNV |
| Ga0255077_10679842 | 3300027529 | Freshwater | MQQTDKYINDQLSKAQALLWSGSLHEQDEAHNIIAKLINDRMEKAEGQND |
| Ga0209552_100020934 | 3300027563 | Freshwater Lake | MSDNYLNDQLNTAQKLLWGGSETENIEAHNIIAKLINDRIEQADLS |
| Ga0209552_100347513 | 3300027563 | Freshwater Lake | MRMSDIYINDQLSKAQALLWSGSLHEVDEAHNIVSDLIRDRLEQVSN |
| Ga0209552_10372072 | 3300027563 | Freshwater Lake | MRISDNYLNDQLNTAQALLWSGSLHEVDEAHNIIAKLISDRIEQVDPS |
| Ga0209552_10393713 | 3300027563 | Freshwater Lake | MRMSDNYINDQLNTAQKLLWGGSETENIEAHNIIAKLISDRIEQVDPS |
| Ga0209552_10470763 | 3300027563 | Freshwater Lake | MRMSDQYINDQLSKAQALLWSGSLHEVDEAHNIVSNLIRDRLEQVSN |
| Ga0209552_11620322 | 3300027563 | Freshwater Lake | MRMSDNYLNDQLNTAQKLLWGGSETENIEAHNIIAKLISDRIEQADPS |
| Ga0209552_11831961 | 3300027563 | Freshwater Lake | LKKKRRTKMKMSDEYLNERLNTAQKLLWGGSETENIEAHNIISKLIQDRMAWEEGTNV |
| Ga0255075_10279311 | 3300027578 | Freshwater | KMRRRTKMRMSDIYINDQLSKAQALLWSGSLHEVDEAHNIVSNLIRDRLEQVSN |
| Ga0208966_10148139 | 3300027586 | Freshwater Lentic | MRMSDNYINDQLSTAQKLLWSGSETENIAAHNIISKLIQDRVEQADQN |
| Ga0208966_10181804 | 3300027586 | Freshwater Lentic | MKMSDEYLNDQLSKAQKLLWGGSETENIEAHNMIAQLIKDREDLIQHS |
| Ga0208966_10271003 | 3300027586 | Freshwater Lentic | MRMSDNYINDQLNTAQKLLWGGSETENIEAHNIIAKLISDRIEQQDQS |
| Ga0208966_11102762 | 3300027586 | Freshwater Lentic | MKMSDTYVNDQLSIAQALLWSGSLHEVDEAHNIISKLISDKVEQTEGQ |
| Ga0208974_10136991 | 3300027608 | Freshwater Lentic | MKMSDIYINDQLSKAQALLWSGSLHEVDEAHNIVSNLIRD |
| Ga0208974_10501066 | 3300027608 | Freshwater Lentic | MQQTDKYINEQLSKAQALLWSGSLHEQDEAHNIIAKLINDRMEKVEGQND |
| Ga0208974_10916071 | 3300027608 | Freshwater Lentic | MKMSDEYINEQLSKAQALLWSGSLHEQDEAHNIIAKLINDRMK |
| Ga0208974_11429463 | 3300027608 | Freshwater Lentic | MQQTDKYINEQLSKAQALLWSGSLHEVDEAHNIIAKLINDRLGNNE |
| Ga0208974_11716452 | 3300027608 | Freshwater Lentic | MEMSDIYINDQLNKAQKLLWGGSETENIEAHNIISKLIQDRMAWDEGTNV |
| Ga0208951_10004557 | 3300027621 | Freshwater Lentic | MSDKYLNDQLSTAQKLLWGGSETENIEAHNIIAKLIKDKIEQAEL |
| Ga0208951_11475603 | 3300027621 | Freshwater Lentic | KKTKMRMSDNYLNDQLNKAQELLWGGSETENIEAHNIIAKLISDRIVQVKNS |
| Ga0208942_10903303 | 3300027627 | Freshwater Lentic | KKRKRKKTKMRISDNYLNDQLNTAQALLWSGSLHEVDEAHNIIAKLISDRIEQVDPS |
| Ga0208133_100014453 | 3300027631 | Estuarine | MSDNYLNDQLNTAQKLLWGGSETENIEAHNIIAKLISDRIEQADLS |
| Ga0208133_10479432 | 3300027631 | Estuarine | MKMSDAYLNDQLNTAQKLLWGGSETENIEAHNIIAKLIKDRIEQADLL |
| Ga0208133_10910452 | 3300027631 | Estuarine | MKMSDKYLNEQLDIAQKLLWGGSETENIEAHNIISKLIYDRIEQVNL |
| Ga0209356_101281910 | 3300027644 | Freshwater Lake | SDNYLNDQLNTAQALLWSGSLHEVDEAHNIIAKLISDRIEQVDPS |
| Ga0209356_10655141 | 3300027644 | Freshwater Lake | RKKTKMKMSDTYINDQLNKAQQLLWGGSETENIEAHNIIAKLIKDRIEQTDLL |
| Ga0209356_10863134 | 3300027644 | Freshwater Lake | ITLLTLKKKRRRTKMKMSDKYLNDQLSKAQKLLWGGSETENIEAHNIISKLIKEKIEQVE |
| Ga0208960_11585732 | 3300027649 | Freshwater Lentic | MKMSDKYINDQLSTAQKLLWGGSETENIEAHNIIAKLIKDKIEQVEL |
| Ga0209357_11330503 | 3300027656 | Freshwater Lake | MKMSDNYLNDQLNKAQQLLWGGSETENIEAHNIIAKLISDRIEQSDLL |
| Ga0209357_11476762 | 3300027656 | Freshwater Lake | MKMSDIYINERLNTAQKLLWGGSETENIEAHNIISKLIQDRMAWEEGTNE |
| Ga0208975_10185311 | 3300027659 | Freshwater Lentic | MKMSDIYINEQLSKAQALLWSGSLHEQDEAHNIIAK |
| Ga0208975_10409451 | 3300027659 | Freshwater Lentic | YINEQLSKAQALLWSGSLHEVDEAHNIIAKLINDRMSEKEGTNV |
| Ga0208975_10432854 | 3300027659 | Freshwater Lentic | MKRRKKMKMSDRYVNDQLDKAQKLLWGGSETENIEAHNIIAKLIKDREDLIEHS |
| Ga0208975_10552721 | 3300027659 | Freshwater Lentic | MKMTKEFINLKLNEAQQLLWGGSETENIAAHNIIAELIKDLQDEQ |
| Ga0208975_10563111 | 3300027659 | Freshwater Lentic | MKMSDEYINEQLSKAQALLWSGSLHEQDEAHNIIAKLINDRMEKAEGQND |
| Ga0209769_10432635 | 3300027679 | Freshwater Lake | MKMSDEYLNERLNTAQKLLWGGSETENIEAHNIISKLIQDRMAWEEGTNE |
| Ga0209769_10814054 | 3300027679 | Freshwater Lake | MSDNYLNDQLNTAQKLLWGGSETENIEAHNIIAKLIKDRIEQADLS |
| Ga0209551_10253775 | 3300027689 | Freshwater Lake | MKMSDVYINDQLNKAQQLLWGGSETENIEAHNIIAKLIKDRIEQTDLS |
| Ga0209551_10322735 | 3300027689 | Freshwater Lake | MKMSDEYINDQLNTAQKLLWGGSETENIAAHNIISKLIKDRVEQTDLV |
| Ga0209551_10735101 | 3300027689 | Freshwater Lake | RKMMRTKMKMSDEYINDQLNKAQTLLWGGSETENIEAHNIIAKLIKDRVEQTNLI |
| Ga0209551_11495533 | 3300027689 | Freshwater Lake | MKMSDTYINDQLNKAQKLLWGGSETENIEAHNIISKLIKDRVEQTDQI |
| Ga0209551_11936983 | 3300027689 | Freshwater Lake | MKMSDTYINDQLNKAQKLLWGGSETENIEAHNIISKLIRDRMEGDEGQ |
| Ga0209033_10110741 | 3300027697 | Freshwater Lake | MKQTDKYINEQLSKAQALLWSGSLHEQDEAHNIIAKLINDRMG |
| Ga0209033_10276547 | 3300027697 | Freshwater Lake | MQQTDKYINEQLSKAQALLWSGSLHEQDEAHNIIAKLIKDRMSEREGTNE |
| Ga0209033_10282053 | 3300027697 | Freshwater Lake | MKMSDNYLNDQLNKAQKLLWSGSLHEQDEAHNIIAKLIKDRIEQADLT |
| Ga0209033_11192264 | 3300027697 | Freshwater Lake | INEQLSKAQALLWSGSLHEQDEAHNIIAKLINDRMGKAEGQND |
| Ga0209033_11738952 | 3300027697 | Freshwater Lake | MKMSDQYINEQLNKAQQLLWGGSETENIEAHNIISKLIRDRIEQVGDRG |
| Ga0209599_1000038766 | 3300027710 | Deep Subsurface | MKMSDNYLNDQLNTAQKLLWGGSETENIEAHNIIAKLIKDRIEQADLS |
| Ga0209599_1000095637 | 3300027710 | Deep Subsurface | MSDQYIDDVLNRAQKLLWGGSETENIEAHNMIAKLIKDRMSEKEGTNE |
| Ga0209599_100077162 | 3300027710 | Deep Subsurface | MRMSDAYINDQLNKAQKLLWGGSETENIEAHNIIAKLIKDRVEQVEQ |
| Ga0209599_100428792 | 3300027710 | Deep Subsurface | MKMSDEYINERLNTAQKLLWGGSETENIEAHNIISKLIKDRIEQVEG |
| Ga0209617_100216042 | 3300027720 | Freshwater And Sediment | MKMSDEYLNERLNTAQKLLWGGSETENIAAHNIISKLIQDRMSGDEGNND |
| Ga0209617_103314551 | 3300027720 | Freshwater And Sediment | MKMSDIYINDQLSKAQALLWSGSLHEVDEAHNIVSNLIK |
| Ga0209617_103462181 | 3300027720 | Freshwater And Sediment | EQLSKAQALLWSGSLHEQDEAHNIIAKLINDRMEKAEGQND |
| Ga0209442_13232321 | 3300027732 | Freshwater Lake | KMRRKKKMKMSDEYLNERLNTAQKLLWGGSETENIEAHNIISKLIQDRMAWEEGTNDSL |
| Ga0209297_1000035106 | 3300027733 | Freshwater Lake | MKMSDRYVNDQLNTAQKLLWGGSETENIEAHNIIAKLIKDREDLIENS |
| Ga0209297_100005314 | 3300027733 | Freshwater Lake | LSTQCLKKRKKTKMKMSDTYLNDQLNTAQKLLWGGSETENIEAHNIIAKLISDRIEQADL |
| Ga0209087_11113224 | 3300027734 | Freshwater Lake | MRMSDIYINDQLSKAQALLWSGSLHEVDEAHNIVSNLIRERIEQTDLA |
| Ga0209087_11329742 | 3300027734 | Freshwater Lake | MKMSDEYVDSVLAKAQKLLWGGSETENIEAHNIIAKLIKDRVEQIN |
| Ga0209085_100001550 | 3300027741 | Freshwater Lake | MRMSDQYINDQLNTAQKLLWGGSETENIEAHNIIAKLIKDRMELSDQN |
| Ga0209355_100008860 | 3300027744 | Freshwater Lake | MKKKRRTKMKMSDKYLNDQLSTAQKLLWGGSETENIEAHNIIAKLIKDKIEQAEL |
| Ga0208305_103587292 | 3300027753 | Estuarine | QLSKAQALLWSGSLHEVDEAHNIVSNLIRDRLEQVSN |
| Ga0209596_100114312 | 3300027754 | Freshwater Lake | MRMSDAYLNAQLDTAQKLLWGGSETENIEAHNIISKLIYDRIEQTE |
| Ga0209596_10076108 | 3300027754 | Freshwater Lake | MSDNYLNDQLDTAQKLLWGGSETENIEAHNIIAKLIKDRIEQTNLT |
| Ga0209596_10226943 | 3300027754 | Freshwater Lake | MRMSDNYLNDQLNKAQELLWGGSETENIEAHNIIAKLISDRIVQVKNS |
| Ga0209596_10376374 | 3300027754 | Freshwater Lake | MKITDKYLNEQLDIAQKLLWGGSETENIEAHNIISKLIYDRIEQVNP |
| Ga0209596_12205372 | 3300027754 | Freshwater Lake | MRMSDNYLNDQLDTAQKLLWGGSETENIEAHNIIAKLISDRIEQADLS |
| Ga0209444_100708774 | 3300027756 | Freshwater Lake | MKMSDRYVNDQLDTAQKLLWGGSETENIEAHNIIAKLIKDREDLIEHS |
| Ga0209444_100769813 | 3300027756 | Freshwater Lake | MKMSDTYINDQLNKAQQLLWGGSETENIEAHNIIAKLIKDRIEQADLL |
| Ga0209444_101293713 | 3300027756 | Freshwater Lake | MKMSDEYLNERLNTAQKLLWGGSETENIEAHNIISKLIQDRNAWEEGTNE |
| Ga0209296_100128513 | 3300027759 | Freshwater Lake | MTNEYINDQLNKAQKLLWSGSLHEQDEAHNIIAKLIKDREGLIQNS |
| Ga0209296_101028110 | 3300027759 | Freshwater Lake | MKMSDKYINEQLSKAQALLWSGSLHEQDEAHNIISKLIKDRVEQSEGQ |
| Ga0209296_10261162 | 3300027759 | Freshwater Lake | MKMSDEYLNERLNTAQKLLWGGSETENIEAHNIISKLIQDRMAWEEGTNDSL |
| Ga0209296_10476217 | 3300027759 | Freshwater Lake | MQQTDNHINTELSKAQALLWSGSLHEVDEAHNIISN |
| Ga0209296_10975773 | 3300027759 | Freshwater Lake | MKMSDTYLNDQLNTAQKLLWGGSETENIEAHNIIAKLISDRIEQADLL |
| Ga0209296_12126663 | 3300027759 | Freshwater Lake | MKMSDEYIDQILNRAQELLWGGSETENIEAHNLISKLIKDRVEQVSN |
| Ga0209296_12638142 | 3300027759 | Freshwater Lake | MQQTDNHINTELSKAQSLLWSGSLHEVDEAHNIISNLIKDRMGKAEGTNV |
| Ga0209598_1000289732 | 3300027760 | Freshwater Lake | MRMSDQYINDQLSKAQALLWSGSLHEVDEAHNIVSNLIRERVEQIDLE |
| Ga0209598_103563963 | 3300027760 | Freshwater Lake | MRMSDNYLNDQLNTAQKLLWGGSETENIEAHNIIAKLISDRIEQADLV |
| Ga0209598_103847791 | 3300027760 | Freshwater Lake | MKMSDEYLNDQLNTAQKLLWGGSETENIEAHNIIAKLISDRIEQADLV |
| Ga0209088_10000029159 | 3300027763 | Freshwater Lake | MSDKYLNDQLSKAQKLLWGGSETENIEAHNIIAKLIKEKIEQVEL |
| Ga0209088_100221303 | 3300027763 | Freshwater Lake | MKMSDEYLNDQLNTAQKLLWGGSETENIEAHNIIAKLIKDRMEQTDLS |
| Ga0209770_1000299012 | 3300027769 | Freshwater Lake | MSDTYINDQLNKAQQLLWGGSETENIEAHNIIAKLIKDRIEQTDLL |
| Ga0209770_100230178 | 3300027769 | Freshwater Lake | MRMSDNYINDQLSTAQKLLWGGSETENIEAHNIISKLIQDRVEQTDQI |
| Ga0209770_100303242 | 3300027769 | Freshwater Lake | MKMSDEYLNDQLSKAQKLLWGGSETENIEAHNIIAKLIKDKIEQVRL |
| Ga0209770_100556462 | 3300027769 | Freshwater Lake | MKMSDTYINDQLSTAQKLLWGGSETENIEAHNIISKLIRDRIEQTEGQ |
| Ga0209770_101258022 | 3300027769 | Freshwater Lake | MKTSDRYVNDQLSKAQALLWSGSLHEVDEAHNIISNLILDRIEQTDQI |
| Ga0209770_101542522 | 3300027769 | Freshwater Lake | MRMSDQYINDQLNTAQKLLWGGSETENIEAHNIIAKLIKDRIEQVDLS |
| Ga0209770_101586234 | 3300027769 | Freshwater Lake | MKMSDTYINDQLSKAQALLWSGSLHEVDEAHNIVSNLIRDRLEQVSN |
| Ga0209770_102785261 | 3300027769 | Freshwater Lake | MKMSDPYIDEQLNKAQKLLWGGSETENIEAHNIISKLIRDRMERDEGTNDSL |
| Ga0209770_102956782 | 3300027769 | Freshwater Lake | MKMSDIYINDQLNKAQKLLWGGSETENIEAHNIISKLIRDRMSGDEGTNESL |
| Ga0209086_100769613 | 3300027770 | Freshwater Lake | MKMSDNYLNDQLNTAQKLLWGGSETENIEAHNIIAELIKYRIEQTNLT |
| Ga0209500_101044971 | 3300027782 | Freshwater Lake | MKMSDKYINDQLSTAQKLLWGGSETENIEAHNIIAKLIKDKI |
| Ga0209500_104074332 | 3300027782 | Freshwater Lake | MKMSDKYLNDQLSKAQKLLWGGSETENIEAHNIISKLIRDKIEQVEL |
| Ga0209972_1000028377 | 3300027793 | Freshwater Lake | MKMSDDYINDQLNKAQKLLWGGSETENIEAHNIISKLIKDKIEQVS |
| Ga0209972_102997174 | 3300027793 | Freshwater Lake | SDIYINEQLNKAQKLLWGGSETENIEAHNIIAKLIKDRLGNDE |
| Ga0209972_103071953 | 3300027793 | Freshwater Lake | MKMSDTYINDQLNKAQQLLWGGSETENIEAHNIISKLIRDRVEQTE |
| Ga0209972_103883701 | 3300027793 | Freshwater Lake | MQQTDKYINEQLSKAQKLLWGGSETENIEAHNIISKLIKDRMSEQEGTNE |
| Ga0209107_100000993 | 3300027797 | Freshwater And Sediment | MSDNYINDQLNTAQKLLWGGSETENIEAHNIIAKLISDRIEQADLS |
| Ga0209107_100004747 | 3300027797 | Freshwater And Sediment | MSDNYINDQLSTAQKLLWSGSETENIAAHNIISKLIQDRVEQADQN |
| Ga0209107_100753973 | 3300027797 | Freshwater And Sediment | MKMSDDYINDQLSTAQRLLWGGSETENIEAHNIIAKLIKDRVEQTNLI |
| Ga0209107_101817005 | 3300027797 | Freshwater And Sediment | MRMSDQYINDQLSKAQALLWSGSLHEVDEAHNIVS |
| Ga0209107_101975184 | 3300027797 | Freshwater And Sediment | MQQSDIYINEQLNKAQKLLWGGSETENIEAHNIIAKLIKDRMPND |
| Ga0209107_103960183 | 3300027797 | Freshwater And Sediment | YINEQLSKAQALLWSGSLHEQDEAHNIIAKLINDRMEKAEGQND |
| Ga0209353_102042274 | 3300027798 | Freshwater Lake | VNDQLDTAQKLLWGGSETENIEAHNIIAKLIKDREDLIEHS |
| Ga0209353_103380373 | 3300027798 | Freshwater Lake | MKMSDEYINDQLNMAQQLLWGGSETENIAAHNIISKLIKDRVEQIDLV |
| Ga0209358_1000180547 | 3300027804 | Freshwater Lake | MKQTDKYINEQLSKAQALLWSGSLHEQDEAHNIIAKLINDRMGKAEGQND |
| Ga0209358_100654681 | 3300027804 | Freshwater Lake | MKMSDTYLNDQLNKAQQLLWGGSETENIEAHNIIAELIKDRIEQADLL |
| Ga0209229_1000203915 | 3300027805 | Freshwater And Sediment | MKMSDPYIDEQLSKAQKLLWGGSETENIEAHNIISKLIRDRMSEQEGQNV |
| Ga0209229_100212374 | 3300027805 | Freshwater And Sediment | MKMSDAYINDQLSQAQKLLWGGSETENIEAHNIIAKLIKDRIEQVGDRG |
| Ga0209229_100962062 | 3300027805 | Freshwater And Sediment | MKMSDEYINEQLSKAQKLLWSGSLHEVDEAHNIVSNLIKDRVEQISN |
| Ga0209229_103237742 | 3300027805 | Freshwater And Sediment | MKMSDAYINDQLNTAQKLLWGGSETENIEAHNIISKLIKDRVEQIDQI |
| Ga0209229_103673251 | 3300027805 | Freshwater And Sediment | INDQLNTAQKLLWGGSETENIAAHNIISKLIKDRVEQTDQI |
| Ga0209229_104949822 | 3300027805 | Freshwater And Sediment | VTTLWIQCLRKMRRTKMKMSDEYLNDQLSKAQALLWGGSETENIEAHNIIAKLIKDKVEQVGL |
| Ga0209990_102898753 | 3300027816 | Freshwater Lake | MKMSDPYIDEQLNKAQKLLWGGSETKNIEAHNIISKLIKDRMSEQEGTNE |
| Ga0209230_100127363 | 3300027836 | Freshwater And Sediment | MKMSDEYINDQLNKAQQLLWGGSETENIEAHNIISKLIKDRVEQVDLV |
| Ga0209550_100186361 | 3300027892 | Freshwater Lake | MRMSDEYINDQLSTAQKLLWGGSETENIEAHNIISKLIKDRVEQVYN |
| Ga0209550_1004183011 | 3300027892 | Freshwater Lake | MKMSDEYINDQLNKAQQLLWGGSETENIEAHNIIAKLIKDRVEQTNLI |
| Ga0209550_100608544 | 3300027892 | Freshwater Lake | MKMTDEYINDQLNKAQALLWGGSETENIEAHNIIARLIKDRVEQTNLV |
| Ga0209550_101179403 | 3300027892 | Freshwater Lake | MKMSDAYINDQLNTAQKLLWGGSETENIEAHNIIAKLIKDRIEQTDLI |
| Ga0209550_101805057 | 3300027892 | Freshwater Lake | MKMSDVYINDQLNKAQKLLWGGSETENIEAHNIIAKLIKDRIEQTDLS |
| Ga0209550_102018024 | 3300027892 | Freshwater Lake | MQMSDPYINEQLNKAQKLLWGGSETENIEAHNIIAKLIKDRMSEQEGQNV |
| Ga0209550_102661681 | 3300027892 | Freshwater Lake | INDQLNKAQQLLWGGSETENIEAHNIISKLIQDRIEQTDLA |
| Ga0209550_103950391 | 3300027892 | Freshwater Lake | MKMSDNYLNDQLNTAQKLLWGGSETENIEAHNIIAKLIKDR |
| Ga0209550_104003024 | 3300027892 | Freshwater Lake | MKMSDVYINDQLNTAQKLLWGGSETENIAAHNIISKLIKDIVEQIDQI |
| Ga0209550_104231553 | 3300027892 | Freshwater Lake | MKMSDEYINDQLNKAQKLLWGGSETENIEAHNIIAKLIKDRIEQTNLI |
| Ga0209550_106978122 | 3300027892 | Freshwater Lake | MKMSDIYINDQLSKAQALLWSGSLHEVDEAHNIISNLIRDRMSQKNLD |
| Ga0209191_100052411 | 3300027969 | Freshwater Lake | MKMSDPYIDEQLNKAQKLLWGGSETENIEAHNIIAKLIKDRMEAIDQ |
| Ga0209298_1000008263 | 3300027973 | Freshwater Lake | MKMSDKYLNDQLSKAQKLLWGGSETENIEAHNIIAKLIKEKIEQVEL |
| Ga0209299_10005113 | 3300027974 | Freshwater Lake | MSDEYLNDQLNTAQKLLWGGSETENIEAHNIIAKLIKDRMEQTDLS |
| (restricted) Ga0247834_100636316 | 3300027977 | Freshwater | MKRRMKMKTTDAYVDTVLAEAQRLLWGGSETENIEAHNIIAKLIKDRMEKTEGQNESL |
| Ga0247723_100057037 | 3300028025 | Deep Subsurface Sediment | MSDAYINDQLNKAQQLLWGGSETENIEAHNIISKLIRDRVEQTEGQ |
| Ga0247723_100398222 | 3300028025 | Deep Subsurface Sediment | MKMSDTYIDDQLNKAQKLLWGGSETENIEAHNIISKLIRDRMEGGEGQND |
| Ga0247723_10055535 | 3300028025 | Deep Subsurface Sediment | MKMSDTYINDQLDKAQKLLWGGSETENIEAHNIISKLIKDKVEQVS |
| Ga0247723_10134536 | 3300028025 | Deep Subsurface Sediment | MEMSDIYINDQLNKAQKLLWGGSETENIEAHNIISKLIRDRMSGDEGANESL |
| Ga0247723_10222898 | 3300028025 | Deep Subsurface Sediment | MKMSDPYINEQLNKAQKLLWGGSETENIEAHNIIAKLIKDRMSEQEGTNE |
| Ga0247723_10324013 | 3300028025 | Deep Subsurface Sediment | MKMSDNYINDQLNTAQKLLWGGSETENIEAHNIIAKLIKDRIEQADLL |
| Ga0247723_10379585 | 3300028025 | Deep Subsurface Sediment | MKMSDQYINDQLNKAQQLLWGGSETENIEAHNIIAKLIKDRIEQTEGL |
| Ga0247723_10386122 | 3300028025 | Deep Subsurface Sediment | MKMSDEYINDQLNKAQKLLWGGSETENIEAHNIISKLIQDRMAWEEGTND |
| Ga0247723_10524254 | 3300028025 | Deep Subsurface Sediment | MKRRTKMKMSDKYLNDQLSKAQKLLWGGSETENIEAHNIIAKLIKEKIEQVEL |
| Ga0247722_101387533 | 3300028027 | Deep Subsurface Sediment | TLWIQCLKKMRRKKMKMSDQHIDAVLTKAQKLLWGGSETENIEAHNLISKLIQDRMSEKNLD |
| Ga0255234_10197432 | 3300028113 | Freshwater | MRMSDIYINDQLSKAQALLWSGSLHEVDEAHNIVSNLIQDRLGNE |
| Ga0265593_10482952 | 3300028178 | Saline Water | MKMSDKYLNEQLDIAQKLLWGGSETENIEAHNIISKLIYDRIEQTE |
| Ga0315907_101237797 | 3300031758 | Freshwater | MQQTDIYINDQLSKAQALLWSGSLHEVDEAHNIIAKLINDRMGKAEGQNDSL |
| Ga0315907_102630437 | 3300031758 | Freshwater | MKMSDPYIDEQLNKAQKLLWGGSETENIEAHNIISKLIRDRMSGDEGTND |
| Ga0315907_105675412 | 3300031758 | Freshwater | MKMSDPYINEQLNKAQKLLWGGSETENIEAHNIISKLIRDRMSGDEGTNDSL |
| Ga0315907_110955402 | 3300031758 | Freshwater | MQQTDKYINEQLSKAQALLWSGSLHEVDEAHNIIAKLINDRMSEKEGTNV |
| Ga0315907_112191322 | 3300031758 | Freshwater | MQQTDRYINEQLSKAQALLWSGSLHEQDEAHNIIAKLINDRMGKAEGQND |
| Ga0315899_102427044 | 3300031784 | Freshwater | MQMSDIYINEQLNKAQKLLWGGSETENIEAHNIIAKLIKDRLGNDE |
| Ga0315899_103057055 | 3300031784 | Freshwater | MQMSDIYINEQLNKAQKLLWGGSETENIEAHNIIAKLIKDRMPDA |
| Ga0315899_106089045 | 3300031784 | Freshwater | KMKMSDAYINDQLNKAQQLLWGGSETENIEAHNIIAKLIKDRIEQTEGQ |
| Ga0315899_109222432 | 3300031784 | Freshwater | MKMSDVYINDQLNKAQQLLWGGSETENIEAHNIISKLIKDRVEQVNL |
| Ga0315899_117097721 | 3300031784 | Freshwater | KRTKMQMSDIYINEQLNKAQKLLWGGSETENIEAHNIIAKLIKDRMSEQEGQNV |
| Ga0315908_107684931 | 3300031786 | Freshwater | TPCLKMRRTKMKMSDAYINDQLNKAQQLLWGGSETENIEAHNIIAKLIKDRIEQTEGQ |
| Ga0315908_115786771 | 3300031786 | Freshwater | MQQTDKYINEQLSKAQALLWSGSLHEVDEAHNIIAKLINDRMGKSEGQNDSL |
| Ga0315900_103329225 | 3300031787 | Freshwater | YINDQLNKAQQLLWGGSETENIEAHNIISKLIRDRVEQTEGQ |
| Ga0315900_104175274 | 3300031787 | Freshwater | MKMSDAYINDQLNKAQELLWGGSETENIEAHNIISKLIRDRVEQTEGQ |
| Ga0315900_104180173 | 3300031787 | Freshwater | MKMSDTYINDQLSRAQELLWGGSETENIEAHNIISKLIRDRIEQVEG |
| Ga0315900_106762901 | 3300031787 | Freshwater | MKMSDTYINDQLNKAQQLLWGGSETENIEAHNIISKLIRDRVEQTEGQ |
| Ga0315909_101601963 | 3300031857 | Freshwater | MKMSDEYINDQLNKAQKLLWGGSETENIEAHNIIAKLIKDRVEQVNLI |
| Ga0315909_101872446 | 3300031857 | Freshwater | MKMSDPYIDEQLNKAQKLLWGGSETENIEAHNIISKLIRDRMSGDEGTNDSL |
| Ga0315909_102327664 | 3300031857 | Freshwater | MQQTDKYINEQLSKAQALLWSGSLHEQDEAHNIIAKLIKDRMEKTEGQNESL |
| Ga0315909_103826114 | 3300031857 | Freshwater | MKMSDEYINDQLNKAQKLLWGGSETENIEAHNIISKLIRDRMSGDEGTND |
| Ga0315909_104119564 | 3300031857 | Freshwater | MKMSDTYINDQLSKAQQLLWGGSETENIEAHNIISK |
| Ga0315904_104124061 | 3300031951 | Freshwater | MKMSDTYINDQLNKAQQLLWGGSETENIEAHNIISKLIRDRV |
| Ga0315904_106141534 | 3300031951 | Freshwater | MKMSDEYINDQLNKAQKLLWGGSETENIEAHNIISKLIRDRMS |
| Ga0315904_111223222 | 3300031951 | Freshwater | MKMSDPYIDEQLNKAQKLLWGGSETENIEAHNIIAKLIKDRMSEQEGTNE |
| Ga0315904_112827612 | 3300031951 | Freshwater | MKMSDPYIDEQLNKAQKLLWGGSETENIEAHNIISKLIKDRMSEQEGTNE |
| Ga0315904_113865123 | 3300031951 | Freshwater | MKMSDQYINDQLNKAQQLLWGGSETENIEAHNIISKLIRDRIEQVGDRG |
| Ga0315901_1005092313 | 3300031963 | Freshwater | MKMSDTYINDQLNKAQQLLWGGSETENIEAHNIISKLIRDR |
| Ga0315901_105808204 | 3300031963 | Freshwater | MKMSDAYINDQLNKAQELLWGGSETENIEAHNIISKLIRDR |
| Ga0315901_106900483 | 3300031963 | Freshwater | MQTTDIFLNQQLAKAQELLWGGSETENIEAHNIISSLIKHRMEKNS |
| Ga0315901_107159303 | 3300031963 | Freshwater | MQQTDKYINEQLSKAQALLWSGSLHEQDEAHNIIAKLINDRMGKAEGQ |
| Ga0315901_108190831 | 3300031963 | Freshwater | QALLWSGSLHEQDEAHNIIAKLINDRMGKAEGQND |
| Ga0315901_110623121 | 3300031963 | Freshwater | MKMSDTYINDQLSKAQELLWGGSETENIEAHNIISKLIRDRVEQTEGQ |
| Ga0315906_111272572 | 3300032050 | Freshwater | MKMSDEYINDQLNKAQKLLWGGSETENIEAHNIISKLIRDRMSGDKGTND |
| Ga0315905_100035013 | 3300032092 | Freshwater | MKMSDQYINEQLNKAQQLLWGGSETENIEAHNIIAKLIKDRVEQADLI |
| Ga0315905_100459415 | 3300032092 | Freshwater | MKMTDEYINDQLSTAQKLLWGGSETENIEAHNIIARLIKDRIEQTNLV |
| Ga0315905_1006806611 | 3300032092 | Freshwater | MRMSDNYLNDQLNKAQQLLWGGSETENIEAHNIIAKLISDRIEQQD |
| Ga0315905_101940921 | 3300032092 | Freshwater | QQTDKYINEQLSKAQALLWSGSLHEVDEAHNIIAKLINDRMGKSEGQNDSL |
| Ga0315905_102733196 | 3300032092 | Freshwater | MKMSDAYINDQLNKAQQLLWGGSETENIEAHNIIAKLIKDRIEQTEGL |
| Ga0315905_103346676 | 3300032092 | Freshwater | MKMSDDYLNDQLNKAQALLWGGSETENIEAHNIISKLIKDRVEQVGL |
| Ga0315905_112825843 | 3300032092 | Freshwater | MKMSDIYIDEQLNKAQKLLWGGSESENIEAHNIIAKLIKERMEDNEQV |
| Ga0315902_107033754 | 3300032093 | Freshwater | MQQTDKYINEQLSKAQALLWSGSLHEQDEAHNIIAKLINDR |
| Ga0315902_112323833 | 3300032093 | Freshwater | AQALLWSGSLHEQDEAHNIIAKLINDRMGKAEGQND |
| Ga0315903_100943992 | 3300032116 | Freshwater | MKMSDEYINDQLNKAQKLLWGGSETENIEAHNIISKLIRDRMSGDEGTNE |
| Ga0315903_106649971 | 3300032116 | Freshwater | MKMSDAYINDQLNKAQELLWGGSETENIEAHNIISKLIRDRIEQTEGQ |
| Ga0316627_1027598991 | 3300033482 | Soil | SDTYINDQLNKAQKLLWGGSETENIEAHNIISKLIRDRIEQTEGQ |
| Ga0316621_103053885 | 3300033488 | Soil | MSDTYINDQLNKAQKLLWGGSETENIEAHNIISKLIRDRIEQTEGQ |
| Ga0334980_0021473_1486_1623 | 3300033816 | Freshwater | MSDVYINDQLNKAQKLLWGGSETENIEAHNIISKLIKDRIEQVEG |
| Ga0334980_0026679_1000_1140 | 3300033816 | Freshwater | MKMSDQYINDQLNKAQQLLWGGSETENIEAHNIISKLIKDRVEQIS |
| Ga0334980_0217799_208_360 | 3300033816 | Freshwater | MQQTDKYINEQLSKAQALLWSGSLHEQDEAHNIIAKLINDRMGKTEGQNV |
| Ga0334980_0248203_243_386 | 3300033816 | Freshwater | MKMSDEYINDQLSKAQALLWGGSETENIEAHNIISKLIRDRVEQISN |
| Ga0334980_0259935_273_440 | 3300033816 | Freshwater | MRRKKMKMSDEYINDQLNKAQKLLWGGSETENIEAHNIISKLIRDRMEGDEGQND |
| Ga0334977_0060282_1067_1210 | 3300033978 | Freshwater | MQQTDQYINERLQAAQQLLWSGSLHEQDEAHNIIAKLIKDRMSDKGE |
| Ga0334977_0120725_1254_1382 | 3300033978 | Freshwater | NEQLSKAQALLWSGSLHEQDEAHNIIAKLINDRMGKAEGQND |
| Ga0334977_0127044_728_898 | 3300033978 | Freshwater | MMRRKKMKMSDEYINDQLNKAQKLLWGGSETENIEAHNIISKLIRDRMEGDEGQND |
| Ga0334981_0001307_14249_14383 | 3300033980 | Freshwater | MSDDYINDQLNKAQQLLWGGSETENIEAHNIISKLIKDRIEQVS |
| Ga0334981_0395332_152_292 | 3300033980 | Freshwater | MTDQYINDQLNTAQKLLWGGSETENIEAHNIIAKLIKDRIEQTDLL |
| Ga0334982_0246278_650_787 | 3300033981 | Freshwater | MSDDYINDQLSKAQALLWGGSETENIEAHNIISKLIKDKVEQVGL |
| Ga0334982_0290357_52_192 | 3300033981 | Freshwater | MTDQYINDQLNTAQKLLWGGSETENIEAHNIIAKLIKDRIEQVNLS |
| Ga0334992_0019658_2430_2591 | 3300033992 | Freshwater | MMRRKKMKMSDEYINDQLSKAQALLWGGSETENIEAHNIISKLIRDRVEQISN |
| Ga0334992_0027108_2456_2602 | 3300033992 | Freshwater | MKMSDMYLNDQLNKAQKLLWGGSETENIEAHNIIAELIKDRVEQTNLV |
| Ga0334992_0057201_1181_1345 | 3300033992 | Freshwater | MKKRRKKMKMSDDYINDQLSKAQALLWGGSETENIEAHNIISKLIKDKVEQVGL |
| Ga0334992_0060068_1751_1888 | 3300033992 | Freshwater | MSDKYLNDQLGKAQELLWGGSETENIEAHNIISKLIKDKIEQVEL |
| Ga0334992_0460747_61_207 | 3300033992 | Freshwater | MKMSDTYINDQLSRAQELLWGGSETENIEAHNIISKLIRDRIEQTEGQ |
| Ga0334994_0026266_1653_1793 | 3300033993 | Freshwater | MTDEYINDQLNTAQKLLWGGSETENIEAHNIIAKLIKDRVEQTNLV |
| Ga0334994_0063226_113_253 | 3300033993 | Freshwater | MTDEYINDQLNTAQKLLWGGSETENIEAHNIIARLIKDRVEQTNLV |
| Ga0334994_0077412_218_382 | 3300033993 | Freshwater | MKKRRTKMKMSDKYLNDQLSKAQALLWGGSETENIEAHNIIAKLIKDKIEQVEL |
| Ga0334994_0129866_6_167 | 3300033993 | Freshwater | MMRRTKMKMSDEYINDQLNKAQKLLWGGSETENIEAHNIIAKLIKDRVEQVGL |
| Ga0335003_0099587_648_812 | 3300033995 | Freshwater | MKRRRKKMKMSDKYLNDQLGKAQELLWGGSETENIEAHNIISKLIKDKIEQVEL |
| Ga0334979_0040823_2675_2821 | 3300033996 | Freshwater | MKMSDNYINDQLNTAQKLLWGGSETENIEAHNIIAKLISDRIEQADLT |
| Ga0334979_0269253_695_832 | 3300033996 | Freshwater | MSDTYINDQLSRAQELLWGGSETENIEAHNIISKLIRDRIEQVEG |
| Ga0334986_0258386_3_143 | 3300034012 | Freshwater | MKMSDEYINEQLSKAQALLWSGSLHEQDEAHNIIAKLINDRMGKAEG |
| Ga0334991_0000390_10321_10488 | 3300034013 | Freshwater | MKKKRRTKMKMSDKYLNDQLITAQKLLWGGSETENIEAHNIIAKLIKDKIEQVEL |
| Ga0334991_0003562_10762_10893 | 3300034013 | Freshwater | MYLNDQLNKAQKLLWGGSETENIEAHNIIAELIKDRVEQTNLV |
| Ga0334991_0388532_173_319 | 3300034013 | Freshwater | MSDEYINDQLNKAQKLLWGGSETENIEAHNIISKLIRDRMGKTEGQND |
| Ga0334985_0121158_1143_1286 | 3300034018 | Freshwater | MKMSDIYINDQLSKAQALLWGGSETENIEAHNIISKLIRDRVEQISN |
| Ga0334998_0297270_690_857 | 3300034019 | Freshwater | MRRKKMKMSDEYINDQLNKAQKLLWGGSETENIEAHNIISKLIRDRMERDEGQND |
| Ga0335005_0511538_426_566 | 3300034022 | Freshwater | MSDQYINDQLNTAQKLLWGGSETENIEAHNIIAKLIKDRIEQVNLS |
| Ga0335021_0374714_142_306 | 3300034023 | Freshwater | MKRRKKMKMSDRYVNDQLDKAQQLLWGGSETENIEAHNIIAKLIKDREDLIEHS |
| Ga0335023_0038021_1414_1551 | 3300034050 | Freshwater | MSDKYLNDQLSKAQALLWGGSETENIEAHNIIAKLIKDKIEQVEL |
| Ga0334983_0698901_308_451 | 3300034060 | Freshwater | MKMSDEYINDQLSKAQALLWSGSLHEVDEAHNIVSNLIRDRLEQVSN |
| Ga0334987_0094728_1027_1170 | 3300034061 | Freshwater | MKMSDVYINDQLNKAQKLLWGGSETENIEAHNIISKLIKDRIEQVEG |
| Ga0334987_0110430_1539_1673 | 3300034061 | Freshwater | MSDQYINDQLNKAQQLLWGGSETENIEAHNIISKLIKDRVEQIS |
| Ga0334995_0114110_607_744 | 3300034062 | Freshwater | MSDEYINDQLNKAQKLLWGGSETENIEAHNIIAKLIKDRVEQVGL |
| Ga0334995_0653223_492_599 | 3300034062 | Freshwater | KAQALLWSGSLHEVDEAHNIISNLIKDRIEQTDLS |
| Ga0334995_0739197_4_147 | 3300034062 | Freshwater | MKMSDKYLNDQLGKAQELLWGGSETENIEAHNIISKLIKDKVEQVGL |
| Ga0335001_0478265_520_660 | 3300034064 | Freshwater | MKMSDEYINDQLNKAQKLLWGGSETENIEAHNIISKLIKDRVEQIS |
| Ga0335019_0371631_305_445 | 3300034066 | Freshwater | MSDEYINDQLNKAQKLLWGGSETENIEAHNIIAKLIKDRIEQTNLI |
| Ga0335019_0466077_637_759 | 3300034066 | Freshwater | QLSKAQALLWSGSLHEQDEAHNIIAKLINDRMEKAEGQND |
| Ga0334990_0002792_834_980 | 3300034068 | Freshwater | MKMSDQYINDQLNTAQKLLWGGSETENIEAHNIIAKLIKDRIEQVNLS |
| Ga0334990_0385796_603_755 | 3300034068 | Freshwater | RKMKTSDRYVDDQLSKAQALLWSGSLHEVDEAHNIISNLIKDRIEQTDLS |
| Ga0335028_0000074_73849_73986 | 3300034071 | Freshwater | MSDDYINDQLNKAQKLLWGGSETENIEAHNIISKLIKDRVEQINL |
| Ga0335028_0303686_695_835 | 3300034071 | Freshwater | MSDAYINDQLNKAQKLLWGGSETENIEAHNIIAKLIKDRIEQTEGQ |
| Ga0335028_0326573_790_900 | 3300034071 | Freshwater | MQQTDKYINEQLSKAQALLWSGSLHEQDEAHNIIAKL |
| Ga0335028_0514508_3_128 | 3300034071 | Freshwater | INDQLNTAQKLLWGGSETENIEAHNIIAKLIKDRIEQVNLS |
| Ga0335028_0674801_2_148 | 3300034071 | Freshwater | QTDKYINEQLSKAQALLWSGSLHEQDEAHNIIAKLINDRMGKTEGQND |
| Ga0335020_0019934_3019_3165 | 3300034082 | Freshwater | MKTSDRYVDDQLSKAQALLWSGSLHEVDEAHNIISNLIKDRIEQTDLS |
| Ga0335020_0082961_82_231 | 3300034082 | Freshwater | MEILMKLSKVYIENKLAEAQTLLWGGSETENISAHNIIVKLITDLEEQE |
| Ga0335020_0102162_706_849 | 3300034082 | Freshwater | MKMSDEYLNDQLSKAQALLWGGSETENIEAHNIISKLIRDKIEQVGL |
| Ga0335010_0329882_1_132 | 3300034092 | Freshwater | RYVDDQLSKAQALLWSGSLHEVDEAHNIISNLILDRMEQTDLA |
| Ga0335012_0082369_218_358 | 3300034093 | Freshwater | MSDAYINDQLNKAQELLWGGSETENIEAHNIISKLIRDRVEQTEGQ |
| Ga0335012_0266129_127_294 | 3300034093 | Freshwater | LRKRRKKMKMSDRYVNDQLDKAQKLLWGGSETENIEAHNIIAKLIKDREDLIEHS |
| Ga0335012_0407812_426_593 | 3300034093 | Freshwater | MRRKKMKMSDEYINTELNKAQKLLWGGSETENIEAHNIISRLIKERMAWKEGNNE |
| Ga0335022_0209277_1017_1157 | 3300034095 | Freshwater | MRMSDEYINDQLNKAQKLLWGGSETENIEAHNIISKLIKDRVEQIS |
| Ga0335027_0777857_444_557 | 3300034101 | Freshwater | MKMSDEYLNDQLSKAQKLLWGGSETENIEAHNIIAKLI |
| Ga0335029_0003158_11315_11461 | 3300034102 | Freshwater | MKMSDEYINDQLNRAQQLLWGGSETENIEAHNIIAKLIKDRVEQINLI |
| Ga0335030_0003480_10194_10337 | 3300034103 | Freshwater | MKMSDKYLNDQLSKAQKLLWGGSETENIEAHNIISKLIKDKIEQVEL |
| Ga0335036_0605140_2_121 | 3300034106 | Freshwater | LSKAQALLWSGSLHEQDEAHNIIAKLINDRMGKAEEQND |
| Ga0335050_0367072_1_135 | 3300034108 | Freshwater | MKRRKKMKMSDRYVNDQLDKAQKLLWGGSETENIEAHNIIAKLIK |
| Ga0335051_0123055_911_1054 | 3300034109 | Freshwater | MKMSDQYINDQLSKAQALLWSGSLHEVDEAHNIVSNLIRDRVEQISN |
| Ga0335051_0135365_3_122 | 3300034109 | Freshwater | NDQLSKAQALLWSGSLHEVDEAHNIVSNLIRDRLEQVSN |
| Ga0335055_0072388_400_525 | 3300034110 | Freshwater | VNDQLNKAQKLLWGGSETENIEAHNMIAQLIKDREDLIEHS |
| Ga0335063_0015270_4621_4764 | 3300034111 | Freshwater | MKMSDSYLNDQLSKAQALLWGGSETENIEAHNIISKLIKDKIEQVEL |
| Ga0335066_0626314_315_455 | 3300034112 | Freshwater | MSDTYINDQLSRAQELLWGGSETENIEAHNIISKLIRDRIEQTEGQ |
| Ga0335068_0000147_563_700 | 3300034116 | Freshwater | MSDKYLNDQLITAQKLLWGGSETENIEAHNIIAKLIKDKIEQVEL |
| Ga0335053_0171544_1300_1446 | 3300034118 | Freshwater | QTDKYINEQLSKAQALLWSGSLHEQDEAHNIIAKLINDRMEKAEGQND |
| Ga0335053_0504656_3_110 | 3300034118 | Freshwater | MQQTDKYINEQLSKAQALLWSGSLHEQDEAHNIIAK |
| Ga0335056_0048894_2645_2773 | 3300034120 | Freshwater | KYLNDQLSKAQALLWGGSETENIEAHNIIAKLIKDKIEQVEL |
| Ga0335058_0108268_1_132 | 3300034121 | Freshwater | MKMSDEYLNDQLSKAQALLWGGSETENIEAHNIIAKLIKDKVEQ |
| Ga0335060_0610316_2_115 | 3300034122 | Freshwater | KAQALLWSGSLHEQDEAHNIIAKLINDRMGKTEGQNV |
| Ga0335016_0007798_9379_9510 | 3300034166 | Freshwater | MQQTDKYINEQLSKAQALLWSGSLHEQDEAHNIIAKLINDRMGK |
| Ga0335016_0109067_2_148 | 3300034166 | Freshwater | QTDKYINEQLSKAQALLWSGSLHEQDEAHNIIAKLINDRMGKAEGQND |
| Ga0335017_0121267_930_1067 | 3300034167 | Freshwater | MKLSKVYIENKLAEAQTLLWGGSETENISAHNIIVKLITDLEEQE |
| Ga0335061_0000014_3_152 | 3300034168 | Freshwater | KMKTSDRYVDDQLSKAQALLWSGSLHEVDEAHNIISNLIKDRIEQTDLS |
| Ga0335061_0422231_518_667 | 3300034168 | Freshwater | MMKMSDTYINDQLNKAQQLLWGGSETENIEAHNIIAKLIKDRIEQTDLL |
| Ga0335065_0010115_5104_5247 | 3300034200 | Freshwater | MKMSDEYINDQLSKAQTLLWGGSETENIEAHNIISKLIRDRVEQVGL |
| Ga0335049_0011111_6497_6634 | 3300034272 | Freshwater | MSDKYLNDQLSKAQKLLWGGSETENIEAHNIIAKLIKDKIEQVEL |
| Ga0335049_0196203_914_1060 | 3300034272 | Freshwater | MKMSDAYINEQLNKAQQLLWGGSETENIEAHNIISKLIRDRVQQTEGL |
| Ga0335049_0842590_321_461 | 3300034272 | Freshwater | MSDEYINDQLNKAQALLWGGSETENIEAHNIIAKLIKDRVEQTNLV |
| Ga0335052_0360265_2_133 | 3300034279 | Freshwater | MKMSDEYINEQLSKAQALLWSGSLHEQDEAHNIIAKLINDRMGK |
| Ga0334997_0723034_271_423 | 3300034280 | Freshwater | MKMSDECINERLNTAQKLLWGGSETENIAAHNIISKLIKDRMQHSQPGAE |
| Ga0334997_0724818_1_117 | 3300034280 | Freshwater | MQMTNEYINDQLNKAQKLLWGGSETENIEAHNIIARLIK |
| Ga0335007_0000033_87101_87265 | 3300034283 | Freshwater | MKKRRTKMKMSDKYLNDQLSKAQKLLWGGSETENIEAHNIIAKLIKDKIEQVEL |
| Ga0335007_0251846_222_380 | 3300034283 | Freshwater | MKMSDPYIDEQLNKAQKLLWGGSETENIEAHNIISKLIKDRMSGDEGTNESL |
| Ga0335013_0144493_1438_1617 | 3300034284 | Freshwater | LRKRRKKMKMSDEYLNERLNKAQKLLWGGSETENIEAHNIISKLIKDRIEGDEGQYDSL |
| Ga0335013_0570855_1_132 | 3300034284 | Freshwater | DQYINDQLSKAQALLWGGSETENIEAHNIISKLIRDRVEQISN |
| Ga0335013_0598566_526_642 | 3300034284 | Freshwater | MKMSDIYINDQLSKAQALLWSGSLHEVDEAHNIVSNLIR |
| Ga0335013_0746594_260_400 | 3300034284 | Freshwater | MKMSDEYINDQLNKAQKLLWGGSETENIEAHNIISKLIRDRVEQIS |
| Ga0335013_0816825_407_520 | 3300034284 | Freshwater | MQQTDQYINERLQAAQQLLWSGSLHEQDEAHNIIAKLI |
| ⦗Top⦘ |