NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300033498

3300033498: Microbial mat bacterial communities from Middle Island sinkhole, Lake Huron, Michigan, United States - MIS.2017.111B



Overview

Basic Information
IMG/M Taxon OID3300033498 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0129088 | Gp0344146 | Ga0316610
Sample NameMicrobial mat bacterial communities from Middle Island sinkhole, Lake Huron, Michigan, United States - MIS.2017.111B
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size281178297
Sequencing Scaffolds21
Novel Protein Genes23
Associated Families13

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Perkinsozoa → Perkinsea → Perkinsida → Perkinsidae → Perkinsus → Perkinsus marinus1
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → Anaerolinea → Anaerolinea thermolimosa1
All Organisms → cellular organisms → Bacteria3
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea1
Not Available5
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → unclassified Ignavibacteria → Ignavibacteria bacterium3
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi2
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales → Pseudanabaenaceae → Pseudanabaena → unclassified Pseudanabaena → Pseudanabaena sp.1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameMicrobial Communities From Sediments And Microbial Mats In Various Locations
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Freshwater → Lake → Sediment → Microbial Mat → Microbial Communities From Sediments And Microbial Mats In Various Locations

Alternative Ecosystem Assignments
Environment Ontology (ENVO)freshwater lake biome → sinkhole → microbial mat material
Earth Microbiome Project Ontology (EMPO)Unclassified

Location Information
LocationUSA: Michigan
CoordinatesLat. (o)45.1993Long. (o)-83.3279Alt. (m)N/ADepth (m)185
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000237Metagenome / Metatranscriptome1498Y
F002525Metagenome / Metatranscriptome552Y
F020197Metagenome / Metatranscriptome225Y
F036727Metagenome / Metatranscriptome169Y
F044511Metagenome / Metatranscriptome154Y
F045770Metagenome / Metatranscriptome152Y
F057919Metagenome / Metatranscriptome135Y
F064355Metagenome / Metatranscriptome128Y
F080961Metagenome / Metatranscriptome114Y
F081921Metagenome / Metatranscriptome114Y
F084884Metagenome / Metatranscriptome112Y
F085743Metagenome / Metatranscriptome111Y
F091749Metagenome / Metatranscriptome107Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0316610_1006742All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium2785Open in IMG/M
Ga0316610_1013420All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Perkinsozoa → Perkinsea → Perkinsida → Perkinsidae → Perkinsus → Perkinsus marinus2016Open in IMG/M
Ga0316610_1024056All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1498Open in IMG/M
Ga0316610_1032357All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → Anaerolinea → Anaerolinea thermolimosa1279Open in IMG/M
Ga0316610_1041841All Organisms → cellular organisms → Bacteria1106Open in IMG/M
Ga0316610_1050843All Organisms → cellular organisms → Bacteria987Open in IMG/M
Ga0316610_1050848All Organisms → cellular organisms → Bacteria987Open in IMG/M
Ga0316610_1053080All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea962Open in IMG/M
Ga0316610_1060710Not Available885Open in IMG/M
Ga0316610_1061874All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → unclassified Ignavibacteria → Ignavibacteria bacterium875Open in IMG/M
Ga0316610_1063330All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi862Open in IMG/M
Ga0316610_1068303Not Available823Open in IMG/M
Ga0316610_1074995All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → unclassified Ignavibacteria → Ignavibacteria bacterium777Open in IMG/M
Ga0316610_1075252All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium775Open in IMG/M
Ga0316610_1076697Not Available766Open in IMG/M
Ga0316610_1084553All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea720Open in IMG/M
Ga0316610_1094407All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → unclassified Ignavibacteria → Ignavibacteria bacterium672Open in IMG/M
Ga0316610_1097986Not Available656Open in IMG/M
Ga0316610_1104596All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi629Open in IMG/M
Ga0316610_1111161Not Available605Open in IMG/M
Ga0316610_1114906All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales → Pseudanabaenaceae → Pseudanabaena → unclassified Pseudanabaena → Pseudanabaena sp.592Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0316610_1006742Ga0316610_10067421F020197MAEENDLNSKPFSMGYVLRTTAKHMRKSVDISIRKTFERIAEFEEDKEKSKEIFETLSVLHGMRKQIDDFQLENQLKFKGA
Ga0316610_1013420Ga0316610_10134201F085743KDLLMKVMTHLXDVKMIKDKTFSEIDPMKLTVVLLKKHGVSPEEDLLIDLENMKTRLVEVSENALGPVKEQILPLQKI
Ga0316610_1024056Ga0316610_10240561F084884LGILARFQAFFYALAFFQSDGVPPPAPARVTQTVRPPLAKLVFYNK
Ga0316610_1032357Ga0316610_10323571F084884VHPTLGILARFQAFFYASAFPQSDGVPPPDPARVTQTV
Ga0316610_1041841Ga0316610_10418414F064355MSTKNKFSIFNSKFFKYLKQLFTNEYPDSKPDVEKRKVAVENNLRWQDDGGPVVENTRPIVQAAENDPTKPGDVTGNDPDKRR
Ga0316610_1050843Ga0316610_10508431F084884LARFQAFFYALSFFQLDGVPPPAPARVTQTVRQIFGEIDL
Ga0316610_1050848Ga0316610_10508481F044511LKAKSKPTKRAPDAGDSGAIPSIFLRLSLFPVGRRPAARPSAGNANRWV
Ga0316610_1053080Ga0316610_10530801F057919MHEIFSLFGFFTFLTIAIQLLSGTMLSFSLVPEPMLIPLIREEEDLEDLYTDDFF
Ga0316610_1060710Ga0316610_10607101F045770MADLTANAPIRILGQEFTEEFTLDNSAAQTVYKGQPMIIDQSEDTVYLRGFVGATVVDPADIFCGIAAEGAISVATTDTETANKCKLWVFPTIVGFKSTVFTDADLGDTVYMSDSATISATAADNPMLGKLHRVLDGYAYVQISSPTICAGA
Ga0316610_1061874Ga0316610_10618743F044511GCLTKRAPDAGDSGAIPSIFLRLSIFPVGRRPAARPSAGNANRWAVGK
Ga0316610_1063330Ga0316610_10633303F002525VWVGVDNVWEQEKPEARKMLVNRAESHTSGARFVGWLCARLAD
Ga0316610_1068303Ga0316610_10683031F080961MQLNKLILSKRKQVMKKKYTQVIEQIITYSPLAGIVGASLLNLTKFQNQLLMLFLLIWASAFFLYKSWAT
Ga0316610_1074995Ga0316610_10749951F084884TLGILARFQAFFYASAFFQSDGVPPPAPARVTQTVSP
Ga0316610_1075252Ga0316610_10752523F084884VHPTLGILARFQAFFYASAFSQSDGVPPPAPARVTQTVGRFLA
Ga0316610_1076697Ga0316610_10766972F044511LTLPPDAGDSGAIPSLFLRLILFPVGRRPAARPSAGNANR
Ga0316610_1084553Ga0316610_10845532F036727MEVCPDFVLEGLREKKKWFLRAQVIDNATYRRGMAVSSYNQGRSLSELTPKTWTHGTKRFMRPDSYWA
Ga0316610_1093212Ga0316610_10932121F002525VWEQEKLEARKMLENAAESHTSGARFVGRLFTRRLLCD
Ga0316610_1094407Ga0316610_10944071F044511RAPDAGDSGAIPSIFPRLSIFPVGRRSAARPSAGNANRWADTL
Ga0316610_1097986Ga0316610_10979861F081921MNTLPQSEQKEIYLQERAGETITDDSLPAAQVIEDQKNNAEQNNTPR
Ga0316610_1104596Ga0316610_11045961F002525VWAGVDSAWEQEKLEARKMLENAAESHTSGARFVGRRFASE
Ga0316610_1111161Ga0316610_11111611F091749IKSDNKSNAQSWELEVTCKNKEYLNKVIKTILKHGMINFEVEIVDYLHGKYTVFMWSSWFNNLATISKDLAKIEKLLDK
Ga0316610_1112320Ga0316610_11123201F000237LYLIQLHVLFCHESXDSDSGEATYEDKSGSYISXFYDAFLKEIQDAXYXTMFVFMYFXLHHFNPSTVNYFFFERXNISELDEIRFYGVAPHXYFRPLMGLLVISPTHYEGLMXMGLFFVLLAFLPIFYNXYNVYNKHIPTIPMQNSLIQTFAFIVFMLSMFCSASMLPCGRYYYEPEGGYVGNPXVKFSYQYIYLYLAXF
Ga0316610_1114906Ga0316610_11149061F084884LARFQAFFYALAFFQSDGVPPPDPARVTQTVSPPLAKGGIK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.