NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300031489

3300031489: Metatranscriptome of soil surface biofilm microbial communities from soil inoculated with nitrogen-fixing consortium DG1, State College, Pennsylvania, United States - STER_R2 (Metagenome Metatranscriptome)



Overview

Basic Information
IMG/M Taxon OID3300031489 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0132857 | Gp0330673 | Ga0314811
Sample NameMetatranscriptome of soil surface biofilm microbial communities from soil inoculated with nitrogen-fixing consortium DG1, State College, Pennsylvania, United States - STER_R2 (Metagenome Metatranscriptome)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size13722610
Sequencing Scaffolds4
Novel Protein Genes4
Associated Families4

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available1
All Organisms → cellular organisms → Eukaryota1
All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff2

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameSoil Surface Biofilm Microbial Communities From Soil Inoculated With Nitrogen-fixing Consortium Dg1, State College, Pennsylvania, United States
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil → Soil Surface Biofilm Microbial Communities From Soil Inoculated With Nitrogen-fixing Consortium Dg1, State College, Pennsylvania, United States

Alternative Ecosystem Assignments
Environment Ontology (ENVO)terrestrial biomelandbiofilm material
Earth Microbiome Project Ontology (EMPO)Unclassified

Location Information
LocationUSA: Pennsylvania
CoordinatesLat. (o)40.7997Long. (o)-77.8629Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F022207Metagenome / Metatranscriptome215Y
F042676Metagenome / Metatranscriptome157N
F054606Metagenome / Metatranscriptome139Y
F098404Metagenome / Metatranscriptome103N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0314811_103754Not Available701Open in IMG/M
Ga0314811_104019All Organisms → cellular organisms → Eukaryota661Open in IMG/M
Ga0314811_104359All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff620Open in IMG/M
Ga0314811_104644All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff590Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0314811_103754Ga0314811_1037541F022207TFEGRTALGGIALQPVRLVLLLLVGPREGENDFLEFPSVEEAVAYARELYGERRFQLEGIEDRSGRSVVSYDVLHDRCRAPDRIQERRFG
Ga0314811_104019Ga0314811_1040191F054606SSPMGGNDNGEFESFITHPWRKYCTTRWEFLPRFIPLFTFAFTILVMVLVLDGKLKVHAGVYQRTSVNGYSSLEQAGSSERVRNILKAWSQTQRLTAAFSSGLHFLFTFLYVSVLTMACCWGANHSPLKTLGDVLAWLQLFGGFFDVILQSCCAYMTIHGPTTGLPELALACVVIHLIILILGALYFVICRIGHWLFWSDISRRGPFDDKVY
Ga0314811_104359Ga0314811_1043591F042676RLSRTHKTHHKMAQQEYSIGGMITFPQLTASYGLISGVIGAASLINPHLCYDLVGQPSRWVPMLESSSGLYTLRLFGLQTVALAAVSLHAAVNVKEPAKRQQLSNVLAALNIGNGLIAAWMYKEGILNPLGVSIHSGLSMALGLGFLVYGLREDRRTGAGEPARD
Ga0314811_104644Ga0314811_1046441F098404AMRSFLVCVVLALAISCAAAQQTRPKLSETFESKGFVQIKHNGTLFFGEGWYHVSQPDGKALEAYAFGGAEHLNVYELQRFDKGKAFEVIHAGHDKTPICHTKSLTGKMPQLWDWVEKADYVRNFTANGSKFDLWGYKTAGITLEVAVPVGYPDILAYFGRFSAGNEFSYYIEQWKTDKPHSTWFEIPRECHLGPK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.