NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300031477

3300031477: Metatranscriptome of soil surface biofilm microbial communities from soil inoculated with nitrogen-fixing consortium DG1, State College, Pennsylvania, United States - STER_R3 (Metagenome Metatranscriptome)



Overview

Basic Information
IMG/M Taxon OID3300031477 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0132857 | Gp0330674 | Ga0314812
Sample NameMetatranscriptome of soil surface biofilm microbial communities from soil inoculated with nitrogen-fixing consortium DG1, State College, Pennsylvania, United States - STER_R3 (Metagenome Metatranscriptome)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size19788102
Sequencing Scaffolds8
Novel Protein Genes8
Associated Families8

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas1
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi2
All Organisms → cellular organisms → Bacteria1
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD00571
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. SE2201
All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff1
All Organisms → cellular organisms → Eukaryota → Amoebozoa1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameSoil Surface Biofilm Microbial Communities From Soil Inoculated With Nitrogen-fixing Consortium Dg1, State College, Pennsylvania, United States
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil → Soil Surface Biofilm Microbial Communities From Soil Inoculated With Nitrogen-fixing Consortium Dg1, State College, Pennsylvania, United States

Alternative Ecosystem Assignments
Environment Ontology (ENVO)terrestrial biome → land → biofilm material
Earth Microbiome Project Ontology (EMPO)Unclassified

Location Information
LocationUSA: Pennsylvania
CoordinatesLat. (o)40.7997Long. (o)-77.8629Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F022207Metagenome / Metatranscriptome215Y
F042676Metagenome / Metatranscriptome157N
F051771Metagenome / Metatranscriptome143Y
F057344Metagenome / Metatranscriptome136N
F061570Metagenome / Metatranscriptome131Y
F062141Metagenome / Metatranscriptome131Y
F077752Metagenome / Metatranscriptome117Y
F089547Metagenome / Metatranscriptome109Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0314812_100697All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas3993Open in IMG/M
Ga0314812_101152All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi2531Open in IMG/M
Ga0314812_102968All Organisms → cellular organisms → Bacteria1227Open in IMG/M
Ga0314812_102998All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi1216Open in IMG/M
Ga0314812_103077All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD00571196Open in IMG/M
Ga0314812_104465All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. SE220914Open in IMG/M
Ga0314812_107801All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff608Open in IMG/M
Ga0314812_108653All Organisms → cellular organisms → Eukaryota → Amoebozoa563Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0314812_100697Ga0314812_1006974F051771MQGNMTDGPSHLEPVDDQAVPKPGRRWTWDRLGPHASRVALELFIVFVGVSAAFAVENYRDARQQDLRRLAVYRALDRELTQMAETHGPVFQRQMTEQLTVWDQAVAKGEHPLPPTFRMPRAERPPTGVWDAAVATGSIELIDPELFFELARLYNRAESAGDLYQRYATSAQADVWARLDEGPGAFWQPDGKLRPEIKAHVQRLRDFQDLQGQRVNEAREIRAKLRQAAAN
Ga0314812_101152Ga0314812_1011521F062141VTMPRGLIFLILVILLLVAGVYFLSQSADEVPVQTIESDITANAATN
Ga0314812_102968Ga0314812_1029681F022207TTFEGRTALGGIALQPVRLVLLLLVGPREGENDFLEFPSVEEAVAYARELYGERRFQLEGIEDRSGRSVVSYDVLHDRCRAPDRIQERRFG
Ga0314812_102998Ga0314812_1029984F077752FEKGRFEMTFSFVDSRQIATSLAAALITSLLFVSAATSLPIA
Ga0314812_103077Ga0314812_1030772F089547ERVEIALTALSVALTSSIHVSTYVCLDDTVFALSTSDQMAIVRFKDREYRLPRRQSSIAIKYATEEATLYLDGDFAAFVAEDRWPPGCQRLESGESRSP
Ga0314812_104465Ga0314812_1044652F057344MTSKRAHFFTACGPLFLAIAACQPASENMEDSEAELLMSNAGKGGAPGFTPQGWGWKPGSSVEISLFNEPDSQGKPNPSWKKILDEKVDTSTMFGFSADAPFYPVRRTLCGNPAPRQFMLAMAKDTKTGRTRMRPLPVDLYFTFQPCPHSGAPIPQAAPPPQQPMQ
Ga0314812_107801Ga0314812_1078011F042676THKTHHKMAQQEYSIGGMITFPQLTASYGLISGVIGAASLINPHLCYDLVGQPSRWVPMLESSSGLYTLRLFGLQTVALAAVSLHAAVNVKEPAKRQQLSNVLAALNIGNGLIAAWMYKEGILNPLGVSIHSGLSMALGLGFLVYGLREDRRTGAGEPARD
Ga0314812_108653Ga0314812_1086531F061570LAALLLVAIVVADAHKAQNLQKVGFCSATIRGSTYDLTAASHNGTTDWTYTGYDGKKYFLNVCNNLVSTNPCGNDSPAYEFDPSTGDCTRLGLLEAEWWGNSYFDTQGQGDGVVVMYNEGDSCSGSARAKVSMLFHCNHTVSATTLTSVVGIGMYCHWVAHFESPLGCQLSL
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.