NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300030713

3300030713: Metatranscriptome of soil microbial communities from Risofladan, Vaasa, Finland - TR-1 (Metagenome Metatranscriptome)



Overview

Basic Information
IMG/M Taxon OID3300030713 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0135150 | Gp0323843 | Ga0307922
Sample NameMetatranscriptome of soil microbial communities from Risofladan, Vaasa, Finland - TR-1 (Metagenome Metatranscriptome)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size18344297
Sequencing Scaffolds3
Novel Protein Genes3
Associated Families3

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available2
All Organisms → cellular organisms → Eukaryota → Amoebozoa → Amoebozoa incertae sedis → Stereomyxa → Stereomyxa ramosa1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameSoil Microbial Communities From Risofladan, Vaasa, Finland
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Soil → Clay → Unclassified → Soil → Soil Microbial Communities From Risofladan, Vaasa, Finland

Alternative Ecosystem Assignments
Environment Ontology (ENVO)terrestrial biomelandsoil
Earth Microbiome Project Ontology (EMPO)Unclassified

Location Information
LocationFinland: Risofladan, Vaasa
CoordinatesLat. (o)63.0472Long. (o)21.7116Alt. (m)N/ADepth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003861Metagenome / Metatranscriptome464Y
F008512Metagenome / Metatranscriptome332Y
F058155Metagenome / Metatranscriptome135Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0307922_105131Not Available803Open in IMG/M
Ga0307922_107339All Organisms → cellular organisms → Eukaryota → Amoebozoa → Amoebozoa incertae sedis → Stereomyxa → Stereomyxa ramosa661Open in IMG/M
Ga0307922_111577Not Available502Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0307922_105131Ga0307922_1051311F008512LLLCISTVRTTLAGLNKIETAQRKTPKGGQKERTYREEHGNSAGSVKNFQAPAMLKTTPLDCEIKSNLREKRRDPWPRANAPSKAVADPEPVVKTRGKSQTCLDLVCRPVAQPPAEAS
Ga0307922_107339Ga0307922_1073391F003861TYTPDMKAVLVVLLVCSIAVALSLPLKPIWPKAFSSTIIVGRSRDPIPGFYRWFWDEGKQKDRVDGVVRFADELYFATRIFDHSKGIEYHVFYQESTAVCFTSNISTTLPKPNFSKLQYVGKALIDYEPVYHWYEEDKVRDLTFQVYDRQDNREVLRIDFDNGRRERAESWTFVELDVGTQGAEIFQVPTNIISQCTPFPNNMELPKYGF
Ga0307922_111577Ga0307922_1115772F058155FTLRLHFHHSPAVPFLTSPTLGSFSRGLPSLRVLPGADAHFVPPFGVFRLADLRFDA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.