NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300030710

3300030710: Metatranscriptome of soil microbial communities from Risofladan, Vaasa, Finland - TR-2 (Metagenome Metatranscriptome)



Overview

Basic Information
IMG/M Taxon OID3300030710 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0135150 | Gp0323844 | Ga0307923
Sample NameMetatranscriptome of soil microbial communities from Risofladan, Vaasa, Finland - TR-2 (Metagenome Metatranscriptome)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size9451667
Sequencing Scaffolds1
Novel Protein Genes1
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameSoil Microbial Communities From Risofladan, Vaasa, Finland
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Soil → Clay → Unclassified → Soil → Soil Microbial Communities From Risofladan, Vaasa, Finland

Alternative Ecosystem Assignments
Environment Ontology (ENVO)terrestrial biomelandsoil
Earth Microbiome Project Ontology (EMPO)Unclassified

Location Information
LocationFinland: Risofladan, Vaasa
CoordinatesLat. (o)63.0472Long. (o)21.7116Alt. (m)N/ADepth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001346Metagenome / Metatranscriptome718Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0307923_102647Not Available811Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0307923_102647Ga0307923_1026472F001346VKTFRASAMTRTVTAELWTKGNLREKRRDPWHRANAPPKAVADPALIGQDAEKKSQACLDLVRKPVVQTLAEAS

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.