Basic Information | |
---|---|
IMG/M Taxon OID | 3300030710 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0135150 | Gp0323844 | Ga0307923 |
Sample Name | Metatranscriptome of soil microbial communities from Risofladan, Vaasa, Finland - TR-2 (Metagenome Metatranscriptome) |
Sequencing Status | Permanent Draft |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Published? | N |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 9451667 |
Sequencing Scaffolds | 1 |
Novel Protein Genes | 1 |
Associated Families | 1 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
Not Available | 1 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Soil Microbial Communities From Risofladan, Vaasa, Finland |
Type | Environmental |
Taxonomy | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil → Soil Microbial Communities From Risofladan, Vaasa, Finland |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | terrestrial biome → land → soil |
Earth Microbiome Project Ontology (EMPO) | Unclassified |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | Finland: Risofladan, Vaasa | |||||||
Coordinates | Lat. (o) | 63.0472 | Long. (o) | 21.7116 | Alt. (m) | N/A | Depth (m) | 1 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F001346 | Metagenome / Metatranscriptome | 718 | Y |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
Ga0307923_102647 | Not Available | 811 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
Ga0307923_102647 | Ga0307923_1026472 | F001346 | VKTFRASAMTRTVTAELWTKGNLREKRRDPWHRANAPPKAVADPALIGQDAEKKSQACLDLVRKPVVQTLAEAS |
⦗Top⦘ |