NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300029687

3300029687: Metatranscriptome of saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2013_6_6_36m (Metagenome Metatranscriptome)



Overview

Basic Information
IMG/M Taxon OID3300029687 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0114292 | Gp0306345 | Ga0265602
Sample NameMetatranscriptome of saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2013_6_6_36m (Metagenome Metatranscriptome)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size92164520
Sequencing Scaffolds12
Novel Protein Genes12
Associated Families9

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available6
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia1
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei1
All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila1
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameMarine Microbial Communities From The Southern Atlantic Ocean Transect To Study Dissolved Organic Matter And Carbon Cycling
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From The Southern Atlantic Ocean Transect To Study Dissolved Organic Matter And Carbon Cycling

Alternative Ecosystem Assignments
Environment Ontology (ENVO)aquatic biome → lake → saline water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationCanada: Sakinaw lake, British Columbia
CoordinatesLat. (o)49.68Long. (o)-124.009Alt. (m)N/ADepth (m)36
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000344Metagenome / Metatranscriptome1257Y
F001024Metagenome / Metatranscriptome803Y
F025295Metagenome / Metatranscriptome202Y
F027190Metagenome / Metatranscriptome195Y
F038530Metagenome / Metatranscriptome165Y
F045555Metagenome / Metatranscriptome152Y
F082705Metagenome / Metatranscriptome113Y
F087194Metagenome / Metatranscriptome110Y
F088111Metagenome / Metatranscriptome109Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0265602_1018086Not Available988Open in IMG/M
Ga0265602_1021481All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium894Open in IMG/M
Ga0265602_1023298Not Available854Open in IMG/M
Ga0265602_1023990Not Available838Open in IMG/M
Ga0265602_1024623All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia825Open in IMG/M
Ga0265602_1025012All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei817Open in IMG/M
Ga0265602_1026217All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium795Open in IMG/M
Ga0265602_1032731All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila697Open in IMG/M
Ga0265602_1032993All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage694Open in IMG/M
Ga0265602_1040038Not Available619Open in IMG/M
Ga0265602_1050697Not Available538Open in IMG/M
Ga0265602_1051364Not Available534Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0265602_1018086Ga0265602_10180861F025295RPHEIMVTGPGEATELLRRREVLIPEKLKFITRKSNLQKQI
Ga0265602_1021481Ga0265602_10214812F088111YLTQNTIPAGLGGNIDSTQMSWLETQVSQTTATHKFLFIHTSYYYISDDPEEPSSANQSYTALWAFLAANKFDFYACGHSHLFSRKTIDSIVLPNPQTIPATLPWQNNVVQLLNGTCGAGPSTGTIDPAIKASWNVYNDAKTYYFSVIDISGNTVTVNSYKGFTGDYSVFDTFSIYK
Ga0265602_1023298Ga0265602_10232981F025295EIMVTGPGEAIKLLRRREELNPNKQKSFTRKRKLQS
Ga0265602_1023990Ga0265602_10239901F027190MSALVRLRAHLNRRVKVPDLAITLGPVTESNCAGAIPPGGKQLEENEQSVTRLDTQRQVNSIRSAVLASLRAKRRSPNEIVRPALREWIASGREPQMVGDGMFGSSSDVNQGTTAGGERASRGQSPRSSEEAGNDRGAKGDRGVVLDDVGIPSHKGPSSAARLCAWLPRNNGAWDTTAN
Ga0265602_1024623Ga0265602_10246232F000344MRPRHPHAAESGVGKHTARESESAQACAAGKERVANAHSHKLA
Ga0265602_1025012Ga0265602_10250121F000344MRPKHPHAAESGVGKHTARESERAQACANGKERVANAHSH
Ga0265602_1026217Ga0265602_10262171F088111FLFIHTPYYYVSNDSAEPSTVSQSFTRLWAFLDSTRFDIYACGHSHLFSRRTVDSTVPPNPQTIPQTPAWKNNVVQLLNGTCGAGGGGGYVDPTVKTAWNVHNDPKTYYFSVIDISGNTVTVNSYQGNLGTYSIFDTFTITR
Ga0265602_1032731Ga0265602_10327312F038530MRPIASHAAVSSVGKHTARESEAPNAVRMGKSAWRAPTPDFG
Ga0265602_1032993Ga0265602_10329931F045555TQMTTSIFIVRAENGGAPESIIYGVYPTKELAMKRVTFLEEDDDYGYEFVWYDEVNVGPNGADCQLFNR
Ga0265602_1040038Ga0265602_10400381F001024MRPETPLAVENSVGKPAATERLMSAWERERGELPP
Ga0265602_1050697Ga0265602_10506971F082705LLTKQKLNNMSDNNTLTTDQKVKELFLSVQAKKLAIEQAERPCWKTSGNFGYSANSAHDRTNVQTLTDTRKIVDMFSFLIDREEKSAKAAQELGVDYKFSWLGFSTEEWKSDFLTRVNQLSIQEKRKELATIESRLNAIISPELKAQMELEAISELLKG
Ga0265602_1051364Ga0265602_10513642F087194MNLDEYKQLVEAQRLASLAVALEALTKSNDIAKEMNK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.