NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300029518

3300029518: Human fecal microbial communities from Shanghai Jiao Tong University, China - RSZAXPI005362-18



Overview

Basic Information
IMG/M Taxon OID3300029518 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0133130 | Gp0283418 | Ga0244795
Sample NameHuman fecal microbial communities from Shanghai Jiao Tong University, China - RSZAXPI005362-18
Sequencing StatusPermanent Draft
Sequencing CenterBeijing Genomics Institute (BGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size169493774
Sequencing Scaffolds3
Novel Protein Genes5
Associated Families5

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides1
All Organisms → cellular organisms → Bacteria1
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter calcoaceticus/baumannii complex → Acinetobacter baumannii1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameHuman Fecal Microbial Communities From Shanghai Jiao Tong University, China
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From Shanghai Jiao Tong University, China

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Host-associated → Animal → Animal distal gut

Location Information
LocationChina: Shanghai
CoordinatesLat. (o)31.2123446Long. (o)121.4684853Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F032312Metagenome / Metatranscriptome180N
F044555Metagenome / Metatranscriptome154N
F060985Metagenome / Metatranscriptome132N
F064817Metagenome128N
F099451Metagenome103N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0244795_104135All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides6309Open in IMG/M
Ga0244795_104232All Organisms → cellular organisms → Bacteria6148Open in IMG/M
Ga0244795_104579All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter calcoaceticus/baumannii complex → Acinetobacter baumannii5649Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0244795_104135Ga0244795_10413515F099451MEVKNVGQLRKIIENLPDDFEIEMRIRRKLTDEELKNCRYPYPYDTEYLTLEFDDIGVFDKVLCL
Ga0244795_104232Ga0244795_1042324F032312MARIKDYDEDLSAPKLLRERARDSKGRFIKKDLPPYLGAEQVLKPKNYYHFDSHGNYNGSSMNFDALVCLGFTWFKLLGVALMMLLWPIVFIYALNDGIEGYPFKKYAIPYIFILVAWFIIFLYGLVS
Ga0244795_104232Ga0244795_1042325F060985MSNIDEKVKNNFTIEMRIFENYEKVKYEIIKVIDFLRHAETNLGMCRIFDNQNHEFWHSVIKPWFQPERFGITHLRFPXXXXXXXXXHTIRGNRWLKTPIDKIDRENRIFGYWFPPYKKYIPHRLKVLKLALKDLERIKEEYGKD
Ga0244795_104579Ga0244795_1045791F044555MKTTNPSSRITISQNGNQILSCKVYKEPNYILSMSNEEILELISGLDYIGNLPTVPDLGKPIEIQVSTTRQIPLEQNKEVQTKIKEIIYNNLYDTLIDELKNTISRFQAQYNIQE
Ga0244795_104579Ga0244795_1045798F064817MNIKNLFNRFRKREPELSYSLNLIYLEDTKVVFNQNIQCAKDLENYLSAYMRLFGMYSDKPYVLIYQEYKNRYWVYDKEPYLLYYKVPLIVNLSRKLSGKSDMVITKEKYQAAKALVPAHEVSDRFKIPEYITGVFTDIWYKCQGYMDTDHVGLEEILELMQHNWLKEFELLVFKRNYDTDMLFLNHSLTYILDQTEEEGRRICIQNIIERNINQENQDENETV

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.