NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300029314

3300029314: Activated sludge microbial communities from Sewage Treatment Plant in Aalborg, Denmark - MBR_Gel1



Overview

Basic Information
IMG/M Taxon OID3300029314 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0132982 | Gp0275462 | Ga0239302
Sample NameActivated sludge microbial communities from Sewage Treatment Plant in Aalborg, Denmark - MBR_Gel1
Sequencing StatusPermanent Draft
Sequencing CenterAalborg University
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size110368799
Sequencing Scaffolds9
Novel Protein Genes9
Associated Families8

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2
All Organisms → cellular organisms → Bacteria → Proteobacteria1
Not Available1
All Organisms → cellular organisms → Bacteria1
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → Methylotenera → unclassified Methylotenera → Methylotenera sp.1
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Nitriliruptoria → Salsipaludibacterales → Salsipaludibacteraceae → Salsipaludibacter → Salsipaludibacter albus1
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameComammox Microbial Communities From Various Environments And Locations In Europe
TypeEngineered
TaxonomyEngineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge → Comammox Microbial Communities From Various Environments And Locations In Europe

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Water (non-saline)

Location Information
LocationDenmark: Aalberg
CoordinatesLat. (o)57.049957Long. (o)9.865377Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F006745Metagenome365Y
F015419Metagenome / Metatranscriptome255Y
F022276Metagenome / Metatranscriptome215Y
F029377Metagenome / Metatranscriptome188Y
F033108Metagenome / Metatranscriptome178Y
F054974Metagenome139Y
F078309Metagenome / Metatranscriptome116Y
F085731Metagenome111Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0239302_100041All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria129927Open in IMG/M
Ga0239302_100582All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria26490Open in IMG/M
Ga0239302_100944All Organisms → cellular organisms → Bacteria → Proteobacteria19054Open in IMG/M
Ga0239302_102018Not Available9814Open in IMG/M
Ga0239302_103076All Organisms → cellular organisms → Bacteria6217Open in IMG/M
Ga0239302_105577All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → Methylotenera → unclassified Methylotenera → Methylotenera sp.3082Open in IMG/M
Ga0239302_112726All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1171Open in IMG/M
Ga0239302_114071All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Nitriliruptoria → Salsipaludibacterales → Salsipaludibacteraceae → Salsipaludibacter → Salsipaludibacter albus1036Open in IMG/M
Ga0239302_114661All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium990Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0239302_100041Ga0239302_10004124F006745MRTSRRSERASSALAIYIIILVAFQVFLLTVAVEAFMSDDESLAWASAIISVALAGGSALLFRYLKP
Ga0239302_100582Ga0239302_10058227F006745MRTSQRDTRASSAVAVYVIILVAFQVFLLTVAVEAFATDDESLAWATAGVSIALAAGSAVLLRYLRP
Ga0239302_100944Ga0239302_10094410F022276LGELLVVAIAFGIIFGARKFCDLIGAPIWFAKFLFICVSLVATYFLAEASIPEYNKPWGVWIAMVCASFGIIAVGFILFQQIEKEENDRKARLSRDTHHF
Ga0239302_102018Ga0239302_1020182F085731MSQQLFPLLVRVHVMVQMACRNLRVRTRDAWLSRHEEDGVDEAVTKMIWLAVGIVVAIAATSFFTAKFNQARDNVPDPVAP
Ga0239302_103076Ga0239302_1030766F054974MNTTRWNPSRLIVGTVLVLVAALLFLFGDGNFSTAGIVAIAVLGLISIAISRKT
Ga0239302_105577Ga0239302_10557710F015419MKYELKITDEHGNEHLYNVVRSSSDEPKNLNDFILEALSISEDKRQLPFITQCPNGLEVFPSIKMKFENYGSPLAIS
Ga0239302_112726Ga0239302_1127262F029377MKERTHSLPSFSAWLNKGFDLRAHASQMADARTDPEISPSSIFLAVFHSFVFRLPSFQQLDSELSHSHLQRWIGAERAFGDDTLRYSLCGFDLGPLEAMLVDVNRRLKRGKXXXXXXX
Ga0239302_114071Ga0239302_1140712F033108VQTSRVSADDSSIDPVPDAVVLTLDEVFRVLEGLEDARLELRERGAAPGLQDELATVIRVLHGKLGLDEGGVP
Ga0239302_114661Ga0239302_1146613F078309MTLPLRIELAMTFKAVFPDILAPARSGQGRPGAVEAVSGCNILILPLDASNLRP
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.