Sample 3300029148

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300029148

3300029148: Aquariaum water viral communities from Chicago, USA - Great Lakes - GLB1

Overview

Basic Information
IMG/M Taxon OID	3300029148 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0127413 \| Gp0192421 \| Ga0168035
Sample Name	Aquariaum water viral communities from Chicago, USA - Great Lakes - GLB1
Sequencing Status	Permanent Draft
Sequencing Center	Michigan State University
Published?	N
Use Policy	Open

Dataset Contents
Total Genome Size	8886791
Sequencing Scaffolds	2
Novel Protein Genes	2
Associated Families	2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → Viruses → Riboviria → Orthornavirae → Lenarviricota → Leviviricetes	1
Not Available	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Aquariaum Water Viral Communities From Chicago, Usa
Type	Environmental
Taxonomy	Environmental → Aquatic → Aquaculture → Unclassified → Unclassified → Aquarium Water → Aquariaum Water Viral Communities From Chicago, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	Unclassified
Earth Microbiome Project Ontology (EMPO)	na → na → na

Location Information
Location	USA: Chicago
Coordinates	Lat. (^o)	41.87	Long. (^o)	-87.61	Alt. (m)	N/A	Depth (m)	N/A
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F018726	Metagenome / Metatranscriptome	233	Y
F085808	Metagenome	111	Y

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
Ga0168035_100934	All Organisms → Viruses → Riboviria → Orthornavirae → Lenarviricota → Leviviricetes	1285	Open in IMG/M
Ga0168035_105896	Not Available	638	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0168035_100934	Ga0168035_1009343	F018726	MLPDPVTIAAAAPTPALVFTTVKSDGYGSERVDTGGNGYTVIINHTRPKGGGDKHYVQMLQTVNATDPYSGLVKKQVASVSLTISRPSFGFTDAAMVALAKALTDFRDDSEVTTAKLLQFQS
Ga0168035_105896	Ga0168035_1058962	F085808	MAGENAALWEVQASAADGTEATATSTHTVLFNSTTKVISDGAYISDILVDFRRSAPENESVNTDNNEIQDMGIDGLDITIEGLIGNSNNDTSTNSINKLIKWLKDGNTTTLFTKGRFGLRLDNAPQWNVVPTSTYGYHIRDLKMQYLGEKKDTVKFTVRLSLGGDVASAI

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.