NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300028400

3300028400: Hydrothermal vent microbial communities from Lau Basin, Pacific Ocean - 134-614



Overview

Basic Information
IMG/M Taxon OID3300028400 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0046784 | Gp0296297 | Ga0256832
Sample NameHydrothermal vent microbial communities from Lau Basin, Pacific Ocean - 134-614
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size762786935
Sequencing Scaffolds1
Novel Protein Genes1
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameMarine Microbial Communities From Hydrothermal Vents In The Atlantic And Pacific Ocean
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vents → Marine Microbial Communities From Hydrothermal Vents In The Atlantic And Pacific Ocean

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine hydrothermal vent biomemarine hydrothermal ventrock
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Subsurface (non-saline)

Location Information
LocationPacific Ocean: Lau Basin
CoordinatesLat. (o)-21.9879Long. (o)-176.5676Alt. (m)N/ADepth (m)1894
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F039145Metagenome / Metatranscriptome164Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0256832_1005461All Organisms → cellular organisms → Bacteria8601Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0256832_1005461Ga0256832_10054617F039145MKNFLTSVLVSLTLLTGCGQQPVNTPAELSPFIEKLKENGVDGTLLVRAPFNEDMEYVAEYEIARYASTRVISLFKFRDAEKAQENLQEALKNKKLSGQARNGSFIIAATFYPPDEEAVEKIKALFLAQKFE

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.