Basic Information | |
---|---|
IMG/M Taxon OID | 3300027653 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0114436 | Gp0119790 | Ga0209487 |
Sample Name | Agricultural soil microbial communities from Georgia to study Nitrogen management - Poultry litter 2012 (SPAdes) |
Sequencing Status | Permanent Draft |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Published? | N |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 542634336 |
Sequencing Scaffolds | 2 |
Novel Protein Genes | 2 |
Associated Families | 2 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
All Organisms → cellular organisms → Bacteria | 2 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Agricultural Soil Microbial Communities From Utah And Georgia To Study Nitrogen Management |
Type | Environmental |
Taxonomy | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Agricultural Soil → Agricultural Soil Microbial Communities From Utah And Georgia To Study Nitrogen Management |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | terrestrial biome → agricultural field → poultry litter |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | USA: Georgia | |||||||
Coordinates | Lat. (o) | 33.8834 | Long. (o) | -83.4195 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F036417 | Metagenome / Metatranscriptome | 170 | Y |
F098955 | Metagenome / Metatranscriptome | 103 | Y |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
Ga0209487_1000015 | All Organisms → cellular organisms → Bacteria | 203625 | Open in IMG/M |
Ga0209487_1000127 | All Organisms → cellular organisms → Bacteria | 69491 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
Ga0209487_1000015 | Ga0209487_100001519 | F036417 | MAVYTRLTLRSLIPTVIVRLITDDGEITFRARWKDSALDLQRNILFRLRQGSPLIFEDEWGRTISFPAERISGAMVDGR |
Ga0209487_1000127 | Ga0209487_100012734 | F098955 | MDPSAIPVFLAGPFPVLHTARVSEIDAEVELDIGLLIGGLPTILAATAFPLDETWERVDAALASGDARLGVAGTMYEEESIVGTFDVVPTAYVGLECANGERLILAHIKSPDPDADPERYAHDVMTALLNGQTPADLGQLIEE |
⦗Top⦘ |