| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300027653 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0114436 | Gp0119790 | Ga0209487 |
| Sample Name | Agricultural soil microbial communities from Georgia to study Nitrogen management - Poultry litter 2012 (SPAdes) |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 542634336 |
| Sequencing Scaffolds | 2 |
| Novel Protein Genes | 2 |
| Associated Families | 2 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria | 2 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Agricultural Soil Microbial Communities From Utah And Georgia To Study Nitrogen Management |
| Type | Environmental |
| Taxonomy | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Agricultural Soil → Agricultural Soil Microbial Communities From Utah And Georgia To Study Nitrogen Management |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | terrestrial biome → agricultural field → poultry litter |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | USA: Georgia | |||||||
| Coordinates | Lat. (o) | 33.8834 | Long. (o) | -83.4195 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F036417 | Metagenome / Metatranscriptome | 170 | Y |
| F098955 | Metagenome / Metatranscriptome | 103 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0209487_1000015 | All Organisms → cellular organisms → Bacteria | 203625 | Open in IMG/M |
| Ga0209487_1000127 | All Organisms → cellular organisms → Bacteria | 69491 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0209487_1000015 | Ga0209487_100001519 | F036417 | MAVYTRLTLRSLIPTVIVRLITDDGEITFRARWKDSALDLQRNILFRLRQGSPLIFEDEWGRTISFPAERISGAMVDGR |
| Ga0209487_1000127 | Ga0209487_100012734 | F098955 | MDPSAIPVFLAGPFPVLHTARVSEIDAEVELDIGLLIGGLPTILAATAFPLDETWERVDAALASGDARLGVAGTMYEEESIVGTFDVVPTAYVGLECANGERLILAHIKSPDPDADPERYAHDVMTALLNGQTPADLGQLIEE |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |