NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300027319

3300027319: Cellulose-adapted microbial communities from the Joint BioEnergy Institute, USA - Passage3 60B (SPAdes)



Overview

Basic Information
IMG/M Taxon OID3300027319 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0110122 | Gp0111032 | Ga0207870
Sample NameCellulose-adapted microbial communities from the Joint BioEnergy Institute, USA - Passage3 60B (SPAdes)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size60224795
Sequencing Scaffolds1
Novel Protein Genes1
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameMesophilic And Thermophilic Cellulose-Adapted Microbial Communities From The Joint Bioenergy Institute, California, Usa
TypeEngineered
TaxonomyEngineered → Lab Enrichment → Defined Media → Unclassified → Unclassified → Cellulose-Adapted → Mesophilic And Thermophilic Cellulose-Adapted Microbial Communities From The Joint Bioenergy Institute, California, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Soil (non-saline)

Location Information
LocationUSA: California
CoordinatesLat. (o)37.8406114Long. (o)-122.2923487Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F021083Metagenome / Metatranscriptome220Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0207870_105008Not Available967Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0207870_105008Ga0207870_1050082F021083MVKKGQLAVSKMDSPRQGERRDPHGEKPKRSRGSRSQTRARPPSEGSSSEG

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.