Basic Information | |
---|---|
IMG/M Taxon OID | 3300027319 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0110122 | Gp0111032 | Ga0207870 |
Sample Name | Cellulose-adapted microbial communities from the Joint BioEnergy Institute, USA - Passage3 60B (SPAdes) |
Sequencing Status | Permanent Draft |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Published? | N |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 60224795 |
Sequencing Scaffolds | 1 |
Novel Protein Genes | 1 |
Associated Families | 1 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
Not Available | 1 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Mesophilic And Thermophilic Cellulose-Adapted Microbial Communities From The Joint Bioenergy Institute, California, Usa |
Type | Engineered |
Taxonomy | Engineered → Lab Enrichment → Defined Media → Unclassified → Unclassified → Cellulose-Adapted → Mesophilic And Thermophilic Cellulose-Adapted Microbial Communities From The Joint Bioenergy Institute, California, Usa |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | Unclassified |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | USA: California | |||||||
Coordinates | Lat. (o) | 37.8406114 | Long. (o) | -122.2923487 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F021083 | Metagenome / Metatranscriptome | 220 | Y |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
Ga0207870_105008 | Not Available | 967 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
Ga0207870_105008 | Ga0207870_1050082 | F021083 | MVKKGQLAVSKMDSPRQGERRDPHGEKPKRSRGSRSQTRARPPSEGSSSEG |
⦗Top⦘ |