NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300027120

3300027120: Metatranscriptome of enriched soil aggregate microbial communities from Iowa State University, Ames, United States - MC6-MC0491-MT (Metagenome Metatranscriptome)



Overview

Basic Information
IMG/M Taxon OID3300027120 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0114432 | Gp0296259 | Ga0256883
Sample NameMetatranscriptome of enriched soil aggregate microbial communities from Iowa State University, Ames, United States - MC6-MC0491-MT (Metagenome Metatranscriptome)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size223847613
Sequencing Scaffolds2
Novel Protein Genes2
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available1
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameEnriched Soil Aggregate Microbial Communities From Iowa State University To Study Microbial Drivers Of Carbon Cycling
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Enriched Soil Aggregate → Enriched Soil Aggregate Microbial Communities From Iowa State University To Study Microbial Drivers Of Carbon Cycling

Alternative Ecosystem Assignments
Environment Ontology (ENVO)terrestrial biome → research facility → soil
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Soil (non-saline)

Location Information
LocationUSA: Iowa
CoordinatesLat. (o)42.0Long. (o)-93.0Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F034190Metagenome / Metatranscriptome175Y
F041209Metagenome / Metatranscriptome160Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0256883_1066043Not Available844Open in IMG/M
Ga0256883_1072172All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria794Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0256883_1066043Ga0256883_10660431F034190ARYRTPADKHSRAAGQQPLLTIPPERIVPTPLHLFLGISNRIILDAFSELLGKERVEAAVKSITTVHSAGCSGAADLHDLNGPEISKWIKKECSATLLSAAKASSLVPAATAASHSILSRWLQQLQHCLLRSGDWSSDEIEAWRSVVSDIHQHWCAETSQAAFPKLHMLHHSVDFAERHRFLGRASEAQIESFHASFNALFHKQHRNQAGNTAERLRRSLADASLRAVQPFALPPSSASSTLS
Ga0256883_1072172Ga0256883_10721721F041209LRLSAAPSHTIVLPGEQAYVLATETSAYAKRYDMIAVCAGDRVLLPKIFSPKERAGAEVKGINRSMLLQFIDDVLAQAVEGLDRYPLTLVLDRATIHMDLDAIRQAFRDRGSEAISDILLMPPNAAKRLSPLDNSLFHDWKEECRRHCPATAKTIERIMSDAWEKLKPGPHYLHCGLTRSKDVYFDCPAPAKHKHAS
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.