NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300026633

3300026633: Grasslands soil microbial communities from Nunn, Colorado, USA, that are Nitrogen fertilized - NN1101 (SPAdes)



Overview

Basic Information
IMG/M Taxon OID3300026633 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0053063 | Gp0055346 | Ga0208845
Sample NameGrasslands soil microbial communities from Nunn, Colorado, USA, that are Nitrogen fertilized - NN1101 (SPAdes)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size51413162
Sequencing Scaffolds0
Novel Protein Genes1
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameUrban Prokaryotic And Eukaryotic Communities From The Subway And Surrounding Areas In New York, Usa
TypeEngineered
TaxonomyEngineered → Built Environment → City → Subway → Unclassified → City Subway Metal/Plastic → Urban Prokaryotic And Eukaryotic Communities From The Subway And Surrounding Areas In New York, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)grassland biomelandfertilized soil
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Soil (non-saline)

Location Information
LocationNunn, Colorado, USA
CoordinatesLat. (o)40.84Long. (o)-104.76667Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F014397Metagenome / Metatranscriptome263Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link

Sequences

Scaffold IDProtein IDFamilySequence
Ga0208845_10033Ga0208845_100331F014397GTRIWSLTQLERQLRPEAFRRRRGGYLDRRRIPAADA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.