| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300026533 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0046784 | Gp0296291 | Ga0256826 |
| Sample Name | Hydrothermal vent microbial communities from East Pacific Rise, Pacific Ocean - CV79 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 612734278 |
| Sequencing Scaffolds | 2 |
| Novel Protein Genes | 2 |
| Associated Families | 2 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → Viruses → Predicted Viral | 1 |
| Not Available | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Marine Microbial Communities From Hydrothermal Vents In The Atlantic And Pacific Ocean |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vents → Marine Microbial Communities From Hydrothermal Vents In The Atlantic And Pacific Ocean |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Subsurface (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Pacific Ocean: East Pacific Rise | |||||||
| Coordinates | Lat. (o) | 9.8472 | Long. (o) | -104.2975 | Alt. (m) | N/A | Depth (m) | 2514 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F025922 | Metagenome / Metatranscriptome | 199 | Y |
| F069354 | Metagenome | 124 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0256826_1031959 | All Organisms → Viruses → Predicted Viral | 2407 | Open in IMG/M |
| Ga0256826_1266604 | Not Available | 556 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0256826_1031959 | Ga0256826_10319595 | F069354 | MKEFNLTRLMDSCCITINEEVYDELFDYLIEIDVDLNTLNIDDLVVNSLSYIDKDEGIDEDNVYVLKEADDGFYILE |
| Ga0256826_1266604 | Ga0256826_12666041 | F025922 | RVQTLGSTASFTSEDIFELGSLDIIDAVDDTPNVSVTLNTNDFGDLGTLATLAQLSPAKKAMDATADATNANLQVVDAALAATGTFLHGACLSDFAVTCGSLTGVTLWAPVQDECSIGSLANNIDQTLFMDEVYVNSLEFSYSSGANATENYGAETDNKMWLLNDGRFVNYDKYVLDAGAVGDG |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |