Basic Information | |
---|---|
IMG/M Taxon OID | 3300026239 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0110167 | Gp0085219 | Ga0209029 |
Sample Name | Upper troposphere microbial communities - SEAC4RS-RF8-008 (SPAdes) |
Sequencing Status | Permanent Draft |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Published? | N |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 10107530 |
Sequencing Scaffolds | 3 |
Novel Protein Genes | 3 |
Associated Families | 3 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dependentiae → unclassified Candidatus Dependentiae → Candidatus Dependentiae bacterium ADurb.Bin331 | 1 |
All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dependentiae → unclassified Candidatus Dependentiae → Candidatus Dependentiae bacterium | 1 |
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Chromobacteriaceae → Chromobacterium group → Chromobacterium → Chromobacterium phragmitis | 1 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Upper Troposphere Microbial Communities Above Oceans And Continental Usa That Affect Ice Or Cloud Condensation Nuclei |
Type | Environmental |
Taxonomy | Environmental → Air → Outdoor Air → Unclassified → Unclassified → Upper Troposphere → Upper Troposphere Microbial Communities Above Oceans And Continental Usa That Affect Ice Or Cloud Condensation Nuclei |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | Unclassified |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Aerosol (non-saline) |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | USA and various oceans | |||||||
Coordinates | Lat. (o) | N/A | Long. (o) | N/A | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F043390 | Metagenome / Metatranscriptome | 156 | N |
F055725 | Metagenome / Metatranscriptome | 138 | Y |
F076004 | Metagenome / Metatranscriptome | 118 | N |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
Ga0209029_100057 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dependentiae → unclassified Candidatus Dependentiae → Candidatus Dependentiae bacterium ADurb.Bin331 | 1123 | Open in IMG/M |
Ga0209029_100148 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dependentiae → unclassified Candidatus Dependentiae → Candidatus Dependentiae bacterium | 884 | Open in IMG/M |
Ga0209029_100355 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Chromobacteriaceae → Chromobacterium group → Chromobacterium → Chromobacterium phragmitis | 675 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
Ga0209029_100057 | Ga0209029_1000573 | F055725 | CGINLKTITELAAQGLSLNSMSKMTGHSKNGIKAALERNNIPYTMGIRECFITVDGVLTSLGDACNAQGFSRESMYAWRVKRGLNEQDGFDAYIIYQQSKRTIDKPILTFKNTTVIYKKERYTLDAISDKLKLNKQRFEVFMRHNRYGQNAFERYCWTRGL |
Ga0209029_100148 | Ga0209029_1001482 | F043390 | MSYQVKTEDLQKVISLTLTAEQLETIAGALELYCIGLAEHNDPHLKYAADAQDAIIDVLESIFSVEE |
Ga0209029_100355 | Ga0209029_1003552 | F076004 | MDTENTVALSNRNGIQTFVQNVEFDRDGRHYDEPCLLMCRGFMGVKNMFVFPLCDAWTVREPDFFKATMQDAAATLFVSPTKNDEHVVGDMILHDIDTIIAWRPDDDATNDHALMKKEVERTGMF |
⦗Top⦘ |