Basic Information | |
---|---|
IMG/M Taxon OID | 3300026229 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0110167 | Gp0085193 | Ga0209243 |
Sample Name | Upper troposphere microbial communities from Maryland, USA - DAQMD-024 (SPAdes) |
Sequencing Status | Permanent Draft |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Published? | N |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 50563251 |
Sequencing Scaffolds | 3 |
Novel Protein Genes | 3 |
Associated Families | 3 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Caldimonas → Caldimonas tepidiphila | 1 |
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Streptococcaceae → Streptococcus → Streptococcus pneumoniae | 1 |
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Staphylococcaceae → Staphylococcus → Staphylococcus aureus | 1 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Upper Troposphere Microbial Communities Above Oceans And Continental Usa That Affect Ice Or Cloud Condensation Nuclei |
Type | Environmental |
Taxonomy | Environmental → Air → Outdoor Air → Unclassified → Unclassified → Upper Troposphere → Upper Troposphere Microbial Communities Above Oceans And Continental Usa That Affect Ice Or Cloud Condensation Nuclei |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | Unclassified |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Aerosol (non-saline) |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | USA: Maryland, Virginia | |||||||
Coordinates | Lat. (o) | N/A | Long. (o) | N/A | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F019998 | Metagenome / Metatranscriptome | 226 | N |
F021533 | Metagenome / Metatranscriptome | 218 | Y |
F048174 | Metagenome / Metatranscriptome | 148 | Y |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
Ga0209243_105409 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Caldimonas → Caldimonas tepidiphila | 781 | Open in IMG/M |
Ga0209243_107002 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Streptococcaceae → Streptococcus → Streptococcus pneumoniae | 668 | Open in IMG/M |
Ga0209243_110771 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Staphylococcaceae → Staphylococcus → Staphylococcus aureus | 521 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
Ga0209243_105409 | Ga0209243_1054092 | F021533 | MKTIAATVINEVITPAEPLPTAAKMILFNGTEYLIYEDGDELPVIEYLLNR |
Ga0209243_107002 | Ga0209243_1070021 | F048174 | MNDKGQSNNKDVQTGSNIVTGALNGEIARLKDDLDRLHRERDSFQRQCSVMAEEMTDWEAESKRLDWMVKNRGRIEWEFGGNCYVTFIHKNEFKATLGSDDTRVE |
Ga0209243_110771 | Ga0209243_1107711 | F019998 | SLSYAASIDAIVVGFTTLVWQPLRIIEARRKDLSSDIEVPLMIVGKFDYERIPNKAMSSIPLWLYAQTMIAETQVFVWPPTAYANWAIGYSFERRYQDVDSGIKSMDFPPEAYESLRYGLAARLGDEFPIDPQRQAMLEQKAAGYFTAMRQASSGNASVKFGVRG |
⦗Top⦘ |