NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300025493

3300025493: Serpentinite rock and fluid subsurface biosphere microbial communities from McLaughlin Reserve, California, USA - CR11Jul_8A2 (SPAdes)



Overview

Basic Information
IMG/M Taxon OID3300025493 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0053062 | Gp0055492 | Ga0208610
Sample NameSerpentinite rock and fluid subsurface biosphere microbial communities from McLaughlin Reserve, California, USA - CR11Jul_8A2 (SPAdes)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size61753590
Sequencing Scaffolds3
Novel Protein Genes3
Associated Families3

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria1
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae1
Not Available1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameSerpentinite Rock And Fluid Microbial Communities From Tablelands Ophiolite (Newfoundland), Coast Range Ophiolite (California) And Ligurian Springs (Italy)
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Serpentinite Rock And Fluid → Serpentinite Rock And Fluid Microbial Communities From Tablelands Ophiolite (Newfoundland), Coast Range Ophiolite (California) And Ligurian Springs (Italy)

Alternative Ecosystem Assignments
Environment Ontology (ENVO)terrestrial biome → planetary subsurface zone → rock
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Subsurface (non-saline)

Location Information
LocationUSA: California, McLaughlin Reserve
CoordinatesLat. (o)38.8739528Long. (o)-122.4391613Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F009579Metagenome / Metatranscriptome316Y
F022826Metagenome / Metatranscriptome212Y
F090615Metagenome / Metatranscriptome108N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0208610_100346All Organisms → cellular organisms → Bacteria → Proteobacteria17330Open in IMG/M
Ga0208610_107053All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae1381Open in IMG/M
Ga0208610_118460Not Available625Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0208610_100346Ga0208610_1003461F090615EKLAQMRALQLAAPEPTDPALIAALRVRKGWLRPDSSIVDKAAVEGLKKLGVLLCPPPDADKRSATVKQINEVATEYLKAVPQARLLIEEAASELQAFWDPDKVYVERTDADIHEKMVTAIKMANADRLRAAEAKAAAGS
Ga0208610_107053Ga0208610_1070533F022826ADLYAAARSVIGTAARRGIDAFQAIRAILQGNSILAPG
Ga0208610_118460Ga0208610_1184601F009579MSEVELVLAFLSGVAMGIALDRWLLPPLVDAWIDRLSRHGR
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.