Sample 3300025354

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300025354

3300025354: Hypersaline microbial mat communities from Hot Lake, Washington, USA - Section #1 (SPAdes)

Overview

Basic Information
IMG/M Taxon OID	3300025354 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0067861 \| Gp0054361 \| Ga0208477
Sample Name	Hypersaline microbial mat communities from Hot Lake, Washington, USA - Section #1 (SPAdes)
Sequencing Status	Permanent Draft
Sequencing Center	DOE Joint Genome Institute (JGI)
Published?	N
Use Policy	Open

Dataset Contents
Total Genome Size	73447272
Sequencing Scaffolds	1
Novel Protein Genes	1
Associated Families	1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico
Type	Environmental
Taxonomy	Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Microbial Mats → Hypersaline Mat → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	aquatic biome → hypersaline lake → microbial mat material
Earth Microbiome Project Ontology (EMPO)	Free-living → Saline → Water (saline)

Location Information
Location	Hot Lake, Oroville, Washington, USA
Coordinates	Lat. (^o)	48.973481	Long. (^o)	-119.476345	Alt. (m)	N/A	Depth (m)	.35
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F034767	Metagenome / Metatranscriptome	174	Y

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
Ga0208477_107503	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta	1253	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0208477_107503	Ga0208477_1075034	F034767	KSTKIHSDKMVKKLFQTSYDIARGINATVWGGVEGAEKTSKIIKTGLSGTDVIIGTSHAFEDAACGDYVCTTIDVIGSVSSAAGLVLGNIPTTKHLTLVTGSVTVCCRTVRWYCKNYGTFWGCTVAAGHGLKAGGKFIINKINY

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.