Basic Information | |
---|---|
IMG/M Taxon OID | 3300025196 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0053074 | Gp0054618 | Ga0207918 |
Sample Name | Marine microbial communities from the Deep Atlantic Ocean - MP0440 (SPAdes) |
Sequencing Status | Permanent Draft |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Published? | N |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 66769410 |
Sequencing Scaffolds | 3 |
Novel Protein Genes | 3 |
Associated Families | 2 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
Not Available | 2 |
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 1 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Deep Ocean Microbial Communities From The Global Malaspina Expedition |
Type | Environmental |
Taxonomy | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | marine biome → marine water body → sea water |
Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | East of Rio de Janeiro, Brazil, South Atlantic Ocean | |||||||
Coordinates | Lat. (o) | -22.97 | Long. (o) | -36.95 | Alt. (m) | N/A | Depth (m) | 3906.8 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F045360 | Metagenome | 153 | Y |
F094378 | Metagenome / Metatranscriptome | 106 | Y |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
Ga0207918_105497 | Not Available | 1621 | Open in IMG/M |
Ga0207918_116974 | Not Available | 850 | Open in IMG/M |
Ga0207918_134418 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 533 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
Ga0207918_105497 | Ga0207918_1054971 | F094378 | WRRRSNHPGNSQAKGPYIITLERRRSLTEGAKLSGNKTDGVF |
Ga0207918_116974 | Ga0207918_1169741 | F045360 | EKGNIKNASSKAKPKXIALAGKPLNIPILNQNGNGDAYQSXNKDQIIAIVKTIFKCNPVRFLVGDKSSXILLSIFVSVFXFIYERYFTIKKRPNKYIGPF |
Ga0207918_134418 | Ga0207918_1344181 | F094378 | ENSQRRRSNHLGNFQAKGPYIITLERRLSLTEGVNLSGNKTEGVY |
⦗Top⦘ |