| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300025090 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0111485 | Gp0127791 | Ga0209080 |
| Sample Name | Hot spring microbial communities from Jinze hot spring, China to study Microbial Dark Matter (Phase II) - JNZ 110809A (SPAdes) |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 159721048 |
| Sequencing Scaffolds | 4 |
| Novel Protein Genes | 4 |
| Associated Families | 3 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 3 |
| All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Aenigmarchaeota → unclassified Aenigmarchaeota → Candidatus Aenigmarchaeota archaeon | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii) |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Hot Spring → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii) |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | aquatic biome → hot spring → sediment |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Baoshan, Yunnan, China | |||||||
| Coordinates | Lat. (o) | 25.4413 | Long. (o) | 98.46 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F020112 | Metagenome | 226 | Y |
| F025877 | Metagenome | 200 | Y |
| F091320 | Metagenome | 107 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0209080_1007871 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 3386 | Open in IMG/M |
| Ga0209080_1012798 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 2292 | Open in IMG/M |
| Ga0209080_1023230 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Aenigmarchaeota → unclassified Aenigmarchaeota → Candidatus Aenigmarchaeota archaeon | 1343 | Open in IMG/M |
| Ga0209080_1049604 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 625 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0209080_1007871 | Ga0209080_10078712 | F020112 | MEKEAPKTRIKGELQMISRAFRKCVELVEEMLGRGYRLQIPSTEVERLIKIGVGADKRTVQKYMRMLTEDLGFLKTAAKNPLGVVIYRIDVEAIEQFVGEHLKDKLRQLKLSDIRLEQNSIEEEVKTEKI |
| Ga0209080_1012798 | Ga0209080_10127985 | F091320 | VVLDETRLLKAKNLVYCINELGKRGVGFLLITQYSTSIPAEVRNVGTYFIMSAMSETEIQRFKEITLHPSSKLITRMPKAMSYVFSPYWYPEPFFVKHRKLV |
| Ga0209080_1023230 | Ga0209080_10232301 | F091320 | GKVDISNNLERIYEEASNWPETNELRLLIVLDETRLLKAKNLVYCVNELGKRGVGFLLITQYSTSIPPEIRNVGTYFIMSAMSETEIQRFKEITLHPSSKLITRLPKAVSYVFSPYWYPEPFFIKNRKVGR |
| Ga0209080_1049604 | Ga0209080_10496042 | F025877 | MPGLDETENTFRYRVQNPDKFDRFRVKEITHGVKITLGRVKGTSRWEIQNYIFDKKLFRTREQVQKWLEKHLKSEVKTLLDFNAWNEHRKRLL |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |