Sample 3300025062

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300025062

3300025062: Marine viral communities from Cariaco Basin, Caribbean Sea - 25_WHOI_OMZ (SPAdes)

Overview

Basic Information
IMG/M Taxon OID	3300025062 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0067852 \| Gp0122833 \| Ga0208014
Sample Name	Marine viral communities from Cariaco Basin, Caribbean Sea - 25_WHOI_OMZ (SPAdes)
Sequencing Status	Permanent Draft
Sequencing Center	DOE Joint Genome Institute (JGI)
Published?	N
Use Policy	Open

Dataset Contents
Total Genome Size	118621493
Sequencing Scaffolds	2
Novel Protein Genes	2
Associated Families	2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	2

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico
Type	Environmental
Taxonomy	Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	marine biome → marine water body → sea water
Earth Microbiome Project Ontology (EMPO)	Free-living → Saline → Water (saline)

Location Information
Location	Caribbean Sea: Cariaco Basin
Coordinates	Lat. (^o)	10.847	Long. (^o)	-65.114	Alt. (m)	N/A	Depth (m)	247
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F044724	Metagenome	154	N
F052647	Metagenome	142	N

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
Ga0208014_1044043	Not Available	558	Open in IMG/M
Ga0208014_1045129	Not Available	544	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0208014_1044043	Ga0208014_10440431	F052647	IMEILDFMPLIYISVGLTATYFIGKLILGHMTQLKKVKRGIEVQKEKKSFENGLEDLIDNSPEMYVKVMQELEHLKTNGADEKQMSSLQRKADLLKMVVENQEIINLAGKPLFRVLGKFVGNIGRXNGSYTRFNVSSARYKTSS
Ga0208014_1045129	Ga0208014_10451291	F044724	YLTKCIIESNSINLLPKVFQVPPILGGLGVFTNSLTPMLDAVECNTPLQLGATQQFRIYGQNFIANTVANRLGLGLHYSESVTNMKEKFYDMPTNETNTGTAATSVAGENVTINDGVFLEDIMPTVVSGVVTLSESYIGYMSVTSNDFGNSMPLNVPVQPISTALGTTTSVGMAKQPHYT

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.