| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300025053 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0053054 | Gp0055715 | Ga0208374 |
| Sample Name | Groundwater microbial communities from Rifle, Colorado - Rifle Oxygen_injection C3 (SPAdes) |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | Y |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 187662623 |
| Sequencing Scaffolds | 3 |
| Novel Protein Genes | 3 |
| Associated Families | 3 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria | 1 |
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1 |
| Not Available | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Soil Microbial Communities From Rifle, Colorado, Usa |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater → Soil Microbial Communities From Rifle, Colorado, Usa |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Subsurface (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Rifle, Colorado, USA | |||||||
| Coordinates | Lat. (o) | 39.534762 | Long. (o) | -107.782602 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F017253 | Metagenome | 242 | Y |
| F050966 | Metagenome / Metatranscriptome | 144 | Y |
| F100657 | Metagenome / Metatranscriptome | 102 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0208374_1000066 | All Organisms → cellular organisms → Bacteria | 74715 | Open in IMG/M |
| Ga0208374_1003458 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 3910 | Open in IMG/M |
| Ga0208374_1051095 | Not Available | 841 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0208374_1000066 | Ga0208374_100006648 | F100657 | MIYFINSHKEIMIMTQITISYTTSVFTPAGWRNETVTATVEVISPKRGRVLCVQDIGGNGNSGYGSRTGAKRQAYHVGGIAMREQGKIKNLSACCIL |
| Ga0208374_1003458 | Ga0208374_10034586 | F017253 | MNIMLVRLRHSLAPNVGSYTQGRIAGDFLSSRKAARAERYTPKTT |
| Ga0208374_1051095 | Ga0208374_10510951 | F050966 | MRENLMSGSRWQGMKTRHGDGTEALSEEMESNGSATPKSRRHPL |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |