NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300024943

3300024943: Metatranscriptome of anaerobic ammonium oxidizing microbial communities from anammox membrane bioreactor (MBR) in UC Berkley, California, United States - LAC_MetaT_11 (Metagenome Metatranscriptome)



Overview

Basic Information
IMG/M Taxon OID3300024943 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0132838 | Gp0267160 | Ga0232067
Sample NameMetatranscriptome of anaerobic ammonium oxidizing microbial communities from anammox membrane bioreactor (MBR) in UC Berkley, California, United States - LAC_MetaT_11 (Metagenome Metatranscriptome)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size68192670
Sequencing Scaffolds1
Novel Protein Genes1
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameAnaerobic Ammonium Oxidizing Microbial Communities From Anammox Membrane Bioreactor (Mbr) In Uc Berkley, California, United States
TypeEngineered
TaxonomyEngineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Anaerobic Bioreactor Biomass → Anaerobic Ammonium Oxidizing Microbial Communities From Anammox Membrane Bioreactor (Mbr) In Uc Berkley, California, United States

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)na → na → na

Location Information
LocationUSA: California
CoordinatesLat. (o)37.8719Long. (o)-122.2585Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F071537Metagenome / Metatranscriptome122Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0232067_129301All Organisms → cellular organisms → Bacteria573Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0232067_129301Ga0232067_1293012F071537MKDRTHSLPSFAAWLNKGFDLRKHAAEMRDARVAPEISPASVFLALFHAF

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.