NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300023291

3300023291: Food waste and fibre mixture microbial community, University of Toronto, Ontario, Canada. Combined Assembly of Gp0242115, Gp0242119



Overview

Basic Information
IMG/M Taxon OID3300023291 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0130338 | Gp0242115 | Ga0256703
Sample NameFood waste and fibre mixture microbial community, University of Toronto, Ontario, Canada. Combined Assembly of Gp0242115, Gp0242119
Sequencing StatusPermanent Draft
Sequencing CenterUniversity of Toronto
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size1661191719
Sequencing Scaffolds869
Novel Protein Genes964
Associated Families82

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum11
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum116
All Organisms → cellular organisms → Eukaryota → Opisthokonta82
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae50
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Morganellaceae → Proteus → Proteus mirabilis25
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata14
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter calcoaceticus/baumannii complex → Acinetobacter baumannii2
Not Available217
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-7835
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae108
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae38
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum urartu16
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis4
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae11
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → Bacteroides uniformis3
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus47
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays14
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Pavo → Pavo cristatus2
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Charadriiformes → Scolopacidae → Limosa → Limosa lapponica → Limosa lapponica baueri3
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei7
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Lactobacillus1
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Staphylococcaceae → Staphylococcus → Staphylococcus aureus1
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Numididae → Numida → Numida meleagris4
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Salmonella → unclassified Salmonella → Salmonella sp. hn-f51
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii3
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Passeriformes → Sylvioidea → Hirundinidae → Hirundo → Hirundo rustica → Hirundo rustica rustica1
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Meleagridinae → Meleagris → Meleagris gallopavo5
All Organisms → cellular organisms → Eukaryota4
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae1
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Brassiceae → Brassica → Brassica cretica1
All Organisms → Viruses → Predicted Viral1
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea glauca1
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae1
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes2
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia triticina → Puccinia triticina 1-1 BBBD Race 15
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Anseriformes → Anatidae → Anatinae → Anas → Anas platyrhynchos1
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea abies1
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Coetzeevirus → Lactobacillus virus phiJL11
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves4
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora → Bovidae → Bovinae → Bos1
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea2
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Clostridiaceae → Clostridium → unclassified Clostridium → Clostridium sp.3
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Lactiplantibacillus → Lactiplantibacillus plantarum1
All Organisms → cellular organisms → Bacteria1
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Lamiales → Lamiaceae → Nepetoideae → Mentheae → Salviinae → Salvia1
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Hordeinae → Hordeum → Hordeum vulgare → Hordeum vulgare subsp. vulgare1
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Sapindales → Anacardiaceae → Pistacia → Pistacia vera1
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Passeriformes → Sylvioidea → Zosteropidae → Zosterops → Zosterops borbonicus1
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Perdicinae → Coturnix → Coturnix japonica2
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata1
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Perdicinae → Bambusicola → Bambusicola thoracicus2
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Companilactobacillus1
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora3
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Odontophoridae → Odontophorus → Odontophorus gujanensis1
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Odontophoridae → Callipepla → Callipepla squamata1
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameMetagenomes From Anaerobic Digester Of Solid Waste
TypeEngineered
TaxonomyEngineered → Bioreactor → Aerobic → Unclassified → Unclassified → Food Waste → Metagenomes From Anaerobic Digester Of Solid Waste

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Water (non-saline)

Location Information
LocationUniversity of Toronto, Toronto, Ontario, Canada
CoordinatesLat. (o)43.6629Long. (o)-79.3957Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000305Metagenome1333Y
F001445Metagenome692Y
F001813Metagenome630Y
F002002Metagenome / Metatranscriptome605Y
F002471Metagenome / Metatranscriptome556Y
F002994Metagenome / Metatranscriptome514Y
F004001Metagenome457Y
F004815Metagenome422Y
F005658Metagenome393Y
F006329Metagenome / Metatranscriptome376Y
F006835Metagenome363Y
F007409Metagenome / Metatranscriptome351Y
F007510Metagenome / Metatranscriptome349Y
F009131Metagenome / Metatranscriptome322Y
F010678Metagenome / Metatranscriptome300Y
F011632Metagenome288Y
F011735Metagenome / Metatranscriptome287Y
F012765Metagenome / Metatranscriptome277Y
F013050Metagenome / Metatranscriptome275Y
F013401Metagenome / Metatranscriptome271Y
F014346Metagenome / Metatranscriptome263Y
F015450Metagenome / Metatranscriptome254N
F017089Metagenome242Y
F018877Metagenome / Metatranscriptome232Y
F020289Metagenome224Y
F020492Metagenome223Y
F020637Metagenome222Y
F020828Metagenome / Metatranscriptome221Y
F023843Metagenome / Metatranscriptome208Y
F027342Metagenome195Y
F028669Metagenome190Y
F028713Metagenome / Metatranscriptome190Y
F028765Metagenome / Metatranscriptome190Y
F032472Metagenome / Metatranscriptome180Y
F033854Metagenome176Y
F034384Metagenome175Y
F035108Metagenome173Y
F035626Metagenome / Metatranscriptome171Y
F037171Metagenome / Metatranscriptome168N
F038003Metagenome / Metatranscriptome167Y
F038012Metagenome166Y
F038084Metagenome / Metatranscriptome166Y
F038489Metagenome165Y
F038985Metagenome / Metatranscriptome164Y
F043815Metagenome / Metatranscriptome155Y
F046965Metagenome / Metatranscriptome150Y
F048299Metagenome / Metatranscriptome148Y
F050219Metagenome / Metatranscriptome145Y
F051243Metagenome144Y
F052316Metagenome142Y
F053764Metagenome / Metatranscriptome140Y
F057793Metagenome135Y
F059631Metagenome133Y
F062313Metagenome130Y
F063479Metagenome / Metatranscriptome129Y
F065281Metagenome127Y
F065766Metagenome / Metatranscriptome127Y
F067310Metagenome / Metatranscriptome125Y
F068298Metagenome124Y
F068986Metagenome124Y
F071823Metagenome121Y
F073390Metagenome / Metatranscriptome120Y
F076748Metagenome117Y
F076912Metagenome117Y
F079404Metagenome115Y
F081962Metagenome113Y
F082256Metagenome113Y
F083289Metagenome113Y
F086390Metagenome110Y
F092835Metagenome / Metatranscriptome107Y
F093003Metagenome106Y
F093243Metagenome / Metatranscriptome106Y
F094706Metagenome105Y
F096316Metagenome104Y
F096317Metagenome104Y
F096850Metagenome / Metatranscriptome104N
F098130Metagenome / Metatranscriptome104Y
F099086Metagenome / Metatranscriptome103N
F100750Metagenome / Metatranscriptome102Y
F103019Metagenome / Metatranscriptome101Y
F104139Metagenome100Y
F105149Metagenome / Metatranscriptome100Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0256703_10001258All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum661Open in IMG/M
Ga0256703_10003836All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum845Open in IMG/M
Ga0256703_10005113All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum531Open in IMG/M
Ga0256703_10005669All Organisms → cellular organisms → Eukaryota → Opisthokonta544Open in IMG/M
Ga0256703_10006314All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae968Open in IMG/M
Ga0256703_10010910All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Morganellaceae → Proteus → Proteus mirabilis539Open in IMG/M
Ga0256703_10011012All Organisms → cellular organisms → Eukaryota → Opisthokonta2807Open in IMG/M
Ga0256703_10012513All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata526Open in IMG/M
Ga0256703_10013464All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter calcoaceticus/baumannii complex → Acinetobacter baumannii570Open in IMG/M
Ga0256703_10016773Not Available508Open in IMG/M
Ga0256703_10017101Not Available4577Open in IMG/M
Ga0256703_10027785All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78616Open in IMG/M
Ga0256703_10027804All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum732Open in IMG/M
Ga0256703_10027986All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae4754Open in IMG/M
Ga0256703_10028392All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum587Open in IMG/M
Ga0256703_10028551Not Available1658Open in IMG/M
Ga0256703_10029956Not Available1221Open in IMG/M
Ga0256703_10031649Not Available2877Open in IMG/M
Ga0256703_10032130All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum548Open in IMG/M
Ga0256703_10035010All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae2196Open in IMG/M
Ga0256703_10035821All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae886Open in IMG/M
Ga0256703_10039008All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae4211Open in IMG/M
Ga0256703_10040882All Organisms → cellular organisms → Eukaryota → Opisthokonta1459Open in IMG/M
Ga0256703_10041093All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae724Open in IMG/M
Ga0256703_10042939Not Available1859Open in IMG/M
Ga0256703_10044543Not Available502Open in IMG/M
Ga0256703_10045421All Organisms → cellular organisms → Eukaryota → Opisthokonta934Open in IMG/M
Ga0256703_10045912All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum urartu533Open in IMG/M
Ga0256703_10046545Not Available2490Open in IMG/M
Ga0256703_10047793All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78505Open in IMG/M
Ga0256703_10049008All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae756Open in IMG/M
Ga0256703_10050585All Organisms → cellular organisms → Eukaryota → Opisthokonta518Open in IMG/M
Ga0256703_10051945All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum501Open in IMG/M
Ga0256703_10053887All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum urartu819Open in IMG/M
Ga0256703_10055560All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis542Open in IMG/M
Ga0256703_10057985All Organisms → cellular organisms → Eukaryota → Opisthokonta625Open in IMG/M
Ga0256703_10059864All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum736Open in IMG/M
Ga0256703_10061860All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae520Open in IMG/M
Ga0256703_10062104All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Morganellaceae → Proteus → Proteus mirabilis548Open in IMG/M
Ga0256703_10065183All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78619Open in IMG/M
Ga0256703_10072948All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae5103Open in IMG/M
Ga0256703_10074470All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae3296Open in IMG/M
Ga0256703_10074648All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae580Open in IMG/M
Ga0256703_10076845All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae2671Open in IMG/M
Ga0256703_10078277All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum665Open in IMG/M
Ga0256703_10078468Not Available552Open in IMG/M
Ga0256703_10079013All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae1317Open in IMG/M
Ga0256703_10079158All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae522Open in IMG/M
Ga0256703_10080233All Organisms → cellular organisms → Eukaryota → Opisthokonta5813Open in IMG/M
Ga0256703_10082180Not Available1404Open in IMG/M
Ga0256703_10083414All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae2024Open in IMG/M
Ga0256703_10083883All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae559Open in IMG/M
Ga0256703_10086684Not Available1029Open in IMG/M
Ga0256703_10087642All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Morganellaceae → Proteus → Proteus mirabilis614Open in IMG/M
Ga0256703_10087656All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Morganellaceae → Proteus → Proteus mirabilis689Open in IMG/M
Ga0256703_10087994Not Available954Open in IMG/M
Ga0256703_10090422All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae803Open in IMG/M
Ga0256703_10094883All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78618Open in IMG/M
Ga0256703_10095058All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78522Open in IMG/M
Ga0256703_10095462Not Available1056Open in IMG/M
Ga0256703_10103294All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae1325Open in IMG/M
Ga0256703_10103563All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae1774Open in IMG/M
Ga0256703_10104919Not Available541Open in IMG/M
Ga0256703_10106797All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis963Open in IMG/M
Ga0256703_10107621All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → Bacteroides uniformis1211Open in IMG/M
Ga0256703_10108652All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae677Open in IMG/M
Ga0256703_10109585All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Morganellaceae → Proteus → Proteus mirabilis577Open in IMG/M
Ga0256703_10109841All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus1006Open in IMG/M
Ga0256703_10112489All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae506Open in IMG/M
Ga0256703_10113728All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum510Open in IMG/M
Ga0256703_10116588All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays746Open in IMG/M
Ga0256703_10116612All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis892Open in IMG/M
Ga0256703_10119400All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum529Open in IMG/M
Ga0256703_10128471All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae5207Open in IMG/M
Ga0256703_10128512Not Available662Open in IMG/M
Ga0256703_10130414All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Pavo → Pavo cristatus2927Open in IMG/M
Ga0256703_10130530All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Morganellaceae → Proteus → Proteus mirabilis590Open in IMG/M
Ga0256703_10130567All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78602Open in IMG/M
Ga0256703_10134642All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus1423Open in IMG/M
Ga0256703_10137456All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae509Open in IMG/M
Ga0256703_10137913All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae1817Open in IMG/M
Ga0256703_10137983All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae795Open in IMG/M
Ga0256703_10138054All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum508Open in IMG/M
Ga0256703_10139289Not Available531Open in IMG/M
Ga0256703_10141318All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae1931Open in IMG/M
Ga0256703_10142628Not Available539Open in IMG/M
Ga0256703_10143960All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus859Open in IMG/M
Ga0256703_10146215All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum1086Open in IMG/M
Ga0256703_10147387All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Charadriiformes → Scolopacidae → Limosa → Limosa lapponica → Limosa lapponica baueri2191Open in IMG/M
Ga0256703_10149411Not Available1504Open in IMG/M
Ga0256703_10150297All Organisms → cellular organisms → Eukaryota → Opisthokonta749Open in IMG/M
Ga0256703_10151835Not Available547Open in IMG/M
Ga0256703_10153967All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei644Open in IMG/M
Ga0256703_10154276All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum677Open in IMG/M
Ga0256703_10157960All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Lactobacillus1035Open in IMG/M
Ga0256703_10158555All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Staphylococcaceae → Staphylococcus → Staphylococcus aureus644Open in IMG/M
Ga0256703_10162303All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum576Open in IMG/M
Ga0256703_10166863All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum592Open in IMG/M
Ga0256703_10168158All Organisms → cellular organisms → Eukaryota → Opisthokonta3200Open in IMG/M
Ga0256703_10168381All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum902Open in IMG/M
Ga0256703_10173135All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae901Open in IMG/M
Ga0256703_10173732All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Numididae → Numida → Numida meleagris853Open in IMG/M
Ga0256703_10180339All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Salmonella → unclassified Salmonella → Salmonella sp. hn-f5613Open in IMG/M
Ga0256703_10182705All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays622Open in IMG/M
Ga0256703_10183270Not Available962Open in IMG/M
Ga0256703_10184516All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae1103Open in IMG/M
Ga0256703_10186080All Organisms → cellular organisms → Eukaryota → Opisthokonta629Open in IMG/M
Ga0256703_10189983All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum828Open in IMG/M
Ga0256703_10193216Not Available1674Open in IMG/M
Ga0256703_10197317All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae1222Open in IMG/M
Ga0256703_10199668All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae1918Open in IMG/M
Ga0256703_10205134All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae633Open in IMG/M
Ga0256703_10205740All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum538Open in IMG/M
Ga0256703_10211708All Organisms → cellular organisms → Eukaryota → Opisthokonta528Open in IMG/M
Ga0256703_10215888Not Available539Open in IMG/M
Ga0256703_10215902Not Available993Open in IMG/M
Ga0256703_10215986All Organisms → cellular organisms → Eukaryota → Opisthokonta1591Open in IMG/M
Ga0256703_10218168Not Available1023Open in IMG/M
Ga0256703_10219960All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae2440Open in IMG/M
Ga0256703_10221159All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae907Open in IMG/M
Ga0256703_10221328All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae504Open in IMG/M
Ga0256703_10222557Not Available1122Open in IMG/M
Ga0256703_10223079All Organisms → cellular organisms → Eukaryota → Opisthokonta1967Open in IMG/M
Ga0256703_10223706Not Available827Open in IMG/M
Ga0256703_10225847Not Available1272Open in IMG/M
Ga0256703_10229055Not Available629Open in IMG/M
Ga0256703_10230897Not Available1541Open in IMG/M
Ga0256703_10233804Not Available873Open in IMG/M
Ga0256703_10235913All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Pavo → Pavo cristatus1170Open in IMG/M
Ga0256703_10236801All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum1229Open in IMG/M
Ga0256703_10240498Not Available954Open in IMG/M
Ga0256703_10241155All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae697Open in IMG/M
Ga0256703_10242978All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum594Open in IMG/M
Ga0256703_10250770All Organisms → cellular organisms → Eukaryota → Opisthokonta2374Open in IMG/M
Ga0256703_10250991Not Available714Open in IMG/M
Ga0256703_10251460All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus1817Open in IMG/M
Ga0256703_10253936All Organisms → cellular organisms → Eukaryota → Opisthokonta8856Open in IMG/M
Ga0256703_10255430All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78625Open in IMG/M
Ga0256703_10255515Not Available1743Open in IMG/M
Ga0256703_10256465All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae3265Open in IMG/M
Ga0256703_10256699All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus746Open in IMG/M
Ga0256703_10258194All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum535Open in IMG/M
Ga0256703_10258233All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii586Open in IMG/M
Ga0256703_10264615Not Available1085Open in IMG/M
Ga0256703_10270809All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Morganellaceae → Proteus → Proteus mirabilis520Open in IMG/M
Ga0256703_10274166All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae509Open in IMG/M
Ga0256703_10280559Not Available890Open in IMG/M
Ga0256703_10281460All Organisms → cellular organisms → Eukaryota → Opisthokonta1665Open in IMG/M
Ga0256703_10287142All Organisms → cellular organisms → Eukaryota → Opisthokonta512Open in IMG/M
Ga0256703_10290158All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae699Open in IMG/M
Ga0256703_10291517All Organisms → cellular organisms → Eukaryota → Opisthokonta1130Open in IMG/M
Ga0256703_10291695All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Passeriformes → Sylvioidea → Hirundinidae → Hirundo → Hirundo rustica → Hirundo rustica rustica1429Open in IMG/M
Ga0256703_10293605Not Available807Open in IMG/M
Ga0256703_10294668All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum977Open in IMG/M
Ga0256703_10297511All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum674Open in IMG/M
Ga0256703_10297751All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum630Open in IMG/M
Ga0256703_10298000All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum660Open in IMG/M
Ga0256703_10300783All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae650Open in IMG/M
Ga0256703_10304195All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae764Open in IMG/M
Ga0256703_10308136Not Available524Open in IMG/M
Ga0256703_10308403All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae1613Open in IMG/M
Ga0256703_10309382All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae855Open in IMG/M
Ga0256703_10309594All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum514Open in IMG/M
Ga0256703_10310897All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Morganellaceae → Proteus → Proteus mirabilis759Open in IMG/M
Ga0256703_10311208Not Available502Open in IMG/M
Ga0256703_10313933All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78605Open in IMG/M
Ga0256703_10317753All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae864Open in IMG/M
Ga0256703_10323915All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum573Open in IMG/M
Ga0256703_10325057All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum641Open in IMG/M
Ga0256703_10325855All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Morganellaceae → Proteus → Proteus mirabilis712Open in IMG/M
Ga0256703_10328521All Organisms → cellular organisms → Eukaryota → Opisthokonta2923Open in IMG/M
Ga0256703_10329143Not Available671Open in IMG/M
Ga0256703_10329493All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum urartu782Open in IMG/M
Ga0256703_10335219Not Available1367Open in IMG/M
Ga0256703_10339503Not Available1584Open in IMG/M
Ga0256703_10343096All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus1328Open in IMG/M
Ga0256703_10343582All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum582Open in IMG/M
Ga0256703_10343602All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae626Open in IMG/M
Ga0256703_10343708All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Meleagridinae → Meleagris → Meleagris gallopavo5545Open in IMG/M
Ga0256703_10349184All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum509Open in IMG/M
Ga0256703_10349656All Organisms → cellular organisms → Eukaryota → Opisthokonta3724Open in IMG/M
Ga0256703_10351552Not Available2117Open in IMG/M
Ga0256703_10351634Not Available532Open in IMG/M
Ga0256703_10352239All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Meleagridinae → Meleagris → Meleagris gallopavo3095Open in IMG/M
Ga0256703_10353804All Organisms → cellular organisms → Eukaryota642Open in IMG/M
Ga0256703_10354448All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum643Open in IMG/M
Ga0256703_10354785All Organisms → cellular organisms → Eukaryota → Opisthokonta593Open in IMG/M
Ga0256703_10361762All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae1703Open in IMG/M
Ga0256703_10363794All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae550Open in IMG/M
Ga0256703_10366289All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus1238Open in IMG/M
Ga0256703_10366600All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum542Open in IMG/M
Ga0256703_10366718Not Available672Open in IMG/M
Ga0256703_10367914All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae665Open in IMG/M
Ga0256703_10368612Not Available1051Open in IMG/M
Ga0256703_10369066All Organisms → cellular organisms → Eukaryota → Opisthokonta552Open in IMG/M
Ga0256703_10371595All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae931Open in IMG/M
Ga0256703_10371684Not Available886Open in IMG/M
Ga0256703_10372562Not Available611Open in IMG/M
Ga0256703_10373134All Organisms → cellular organisms → Eukaryota → Opisthokonta1813Open in IMG/M
Ga0256703_10374120All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata681Open in IMG/M
Ga0256703_10375370All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum704Open in IMG/M
Ga0256703_10378760All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae1376Open in IMG/M
Ga0256703_10382102Not Available1202Open in IMG/M
Ga0256703_10384167All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → Bacteroides uniformis609Open in IMG/M
Ga0256703_10390118All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae2385Open in IMG/M
Ga0256703_10391820All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae1022Open in IMG/M
Ga0256703_10395950All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Charadriiformes → Scolopacidae → Limosa → Limosa lapponica → Limosa lapponica baueri929Open in IMG/M
Ga0256703_10400286All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae1531Open in IMG/M
Ga0256703_10401221Not Available521Open in IMG/M
Ga0256703_10401677Not Available515Open in IMG/M
Ga0256703_10403784All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae1981Open in IMG/M
Ga0256703_10406265All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum632Open in IMG/M
Ga0256703_10408172All Organisms → cellular organisms → Eukaryota → Opisthokonta609Open in IMG/M
Ga0256703_10408321Not Available652Open in IMG/M
Ga0256703_10411104All Organisms → cellular organisms → Eukaryota → Opisthokonta918Open in IMG/M
Ga0256703_10412118All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae2688Open in IMG/M
Ga0256703_10414109All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae2775Open in IMG/M
Ga0256703_10416853Not Available525Open in IMG/M
Ga0256703_10418362All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum597Open in IMG/M
Ga0256703_10420845All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae687Open in IMG/M
Ga0256703_10424656All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum urartu841Open in IMG/M
Ga0256703_10427549All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae1161Open in IMG/M
Ga0256703_10428145All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae1217Open in IMG/M
Ga0256703_10429310Not Available598Open in IMG/M
Ga0256703_10429970All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays864Open in IMG/M
Ga0256703_10432731All Organisms → cellular organisms → Eukaryota → Opisthokonta550Open in IMG/M
Ga0256703_10434179All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae1331Open in IMG/M
Ga0256703_10437024All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Morganellaceae → Proteus → Proteus mirabilis699Open in IMG/M
Ga0256703_10440559All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae3410Open in IMG/M
Ga0256703_10441427All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae1527Open in IMG/M
Ga0256703_10442138Not Available609Open in IMG/M
Ga0256703_10445759All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae1259Open in IMG/M
Ga0256703_10446785Not Available2910Open in IMG/M
Ga0256703_10448005Not Available1037Open in IMG/M
Ga0256703_10452323All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus568Open in IMG/M
Ga0256703_10452957All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae1145Open in IMG/M
Ga0256703_10453378All Organisms → cellular organisms → Eukaryota → Opisthokonta2950Open in IMG/M
Ga0256703_10453535All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae706Open in IMG/M
Ga0256703_10455433All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum582Open in IMG/M
Ga0256703_10460277Not Available2828Open in IMG/M
Ga0256703_10460435All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae2940Open in IMG/M
Ga0256703_10461208Not Available1402Open in IMG/M
Ga0256703_10461958All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae1719Open in IMG/M
Ga0256703_10461974Not Available1216Open in IMG/M
Ga0256703_10462532All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78521Open in IMG/M
Ga0256703_10466654All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Brassiceae → Brassica → Brassica cretica519Open in IMG/M
Ga0256703_10468692Not Available1246Open in IMG/M
Ga0256703_10470144All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus1180Open in IMG/M
Ga0256703_10475625Not Available5964Open in IMG/M
Ga0256703_10477032All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae943Open in IMG/M
Ga0256703_10478908All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum535Open in IMG/M
Ga0256703_10482375All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus582Open in IMG/M
Ga0256703_10483207All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum578Open in IMG/M
Ga0256703_10483676All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum urartu630Open in IMG/M
Ga0256703_10485475All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae735Open in IMG/M
Ga0256703_10489118Not Available799Open in IMG/M
Ga0256703_10492530All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae657Open in IMG/M
Ga0256703_10498819All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum691Open in IMG/M
Ga0256703_10503360All Organisms → cellular organisms → Eukaryota → Opisthokonta3219Open in IMG/M
Ga0256703_10504718Not Available1207Open in IMG/M
Ga0256703_10505111All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus650Open in IMG/M
Ga0256703_10510033All Organisms → cellular organisms → Eukaryota797Open in IMG/M
Ga0256703_10512959All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae777Open in IMG/M
Ga0256703_10516506Not Available1065Open in IMG/M
Ga0256703_10518248All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus1036Open in IMG/M
Ga0256703_10519197All Organisms → Viruses → Predicted Viral3438Open in IMG/M
Ga0256703_10521373All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum735Open in IMG/M
Ga0256703_10525371All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78594Open in IMG/M
Ga0256703_10529280All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae501Open in IMG/M
Ga0256703_10532042All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum753Open in IMG/M
Ga0256703_10537662Not Available514Open in IMG/M
Ga0256703_10538419All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae5895Open in IMG/M
Ga0256703_10542252All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum597Open in IMG/M
Ga0256703_10543183All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum692Open in IMG/M
Ga0256703_10546851Not Available1088Open in IMG/M
Ga0256703_10547516All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum598Open in IMG/M
Ga0256703_10549533All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae2729Open in IMG/M
Ga0256703_10551477All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae1649Open in IMG/M
Ga0256703_10555855All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78530Open in IMG/M
Ga0256703_10559148All Organisms → cellular organisms → Eukaryota → Opisthokonta3923Open in IMG/M
Ga0256703_10559281All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus1438Open in IMG/M
Ga0256703_10559402Not Available655Open in IMG/M
Ga0256703_10560239All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum712Open in IMG/M
Ga0256703_10563777All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae6492Open in IMG/M
Ga0256703_10566682All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea glauca591Open in IMG/M
Ga0256703_10567189All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae1972Open in IMG/M
Ga0256703_10567323Not Available1103Open in IMG/M
Ga0256703_10572208Not Available3561Open in IMG/M
Ga0256703_10573740All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae725Open in IMG/M
Ga0256703_10574007All Organisms → cellular organisms → Eukaryota → Opisthokonta1013Open in IMG/M
Ga0256703_10577903All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum913Open in IMG/M
Ga0256703_10578395Not Available506Open in IMG/M
Ga0256703_10582383Not Available2117Open in IMG/M
Ga0256703_10582738All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum745Open in IMG/M
Ga0256703_10584256All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum576Open in IMG/M
Ga0256703_10584361All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae527Open in IMG/M
Ga0256703_10587005All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum663Open in IMG/M
Ga0256703_10590414All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78547Open in IMG/M
Ga0256703_10590649All Organisms → cellular organisms → Eukaryota → Opisthokonta503Open in IMG/M
Ga0256703_10591271All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae877Open in IMG/M
Ga0256703_10592921All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Morganellaceae → Proteus → Proteus mirabilis531Open in IMG/M
Ga0256703_10593665Not Available1858Open in IMG/M
Ga0256703_10595110All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum792Open in IMG/M
Ga0256703_10595860Not Available751Open in IMG/M
Ga0256703_10596805All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum603Open in IMG/M
Ga0256703_10598580All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae1536Open in IMG/M
Ga0256703_10600361Not Available860Open in IMG/M
Ga0256703_10601303Not Available3468Open in IMG/M
Ga0256703_10601538All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum573Open in IMG/M
Ga0256703_10602094All Organisms → cellular organisms → Eukaryota → Opisthokonta948Open in IMG/M
Ga0256703_10603094All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae763Open in IMG/M
Ga0256703_10605446Not Available898Open in IMG/M
Ga0256703_10606543All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae613Open in IMG/M
Ga0256703_10614371All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus1143Open in IMG/M
Ga0256703_10614521All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum668Open in IMG/M
Ga0256703_10615026Not Available527Open in IMG/M
Ga0256703_10616543All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78590Open in IMG/M
Ga0256703_10618445All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae1979Open in IMG/M
Ga0256703_10619293All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae754Open in IMG/M
Ga0256703_10627995All Organisms → cellular organisms → Eukaryota → Opisthokonta2724Open in IMG/M
Ga0256703_10631417All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae3184Open in IMG/M
Ga0256703_10635107Not Available535Open in IMG/M
Ga0256703_10637092All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae1319Open in IMG/M
Ga0256703_10637669All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Morganellaceae → Proteus → Proteus mirabilis713Open in IMG/M
Ga0256703_10637835All Organisms → cellular organisms → Eukaryota → Opisthokonta796Open in IMG/M
Ga0256703_10639226Not Available822Open in IMG/M
Ga0256703_10640103All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae549Open in IMG/M
Ga0256703_10640294Not Available708Open in IMG/M
Ga0256703_10641752All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei792Open in IMG/M
Ga0256703_10642499Not Available7131Open in IMG/M
Ga0256703_10648724All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae1265Open in IMG/M
Ga0256703_10649197All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae735Open in IMG/M
Ga0256703_10651272All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus3629Open in IMG/M
Ga0256703_10654592All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum1015Open in IMG/M
Ga0256703_10654648All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae1107Open in IMG/M
Ga0256703_10656112All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae1711Open in IMG/M
Ga0256703_10656386All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum1060Open in IMG/M
Ga0256703_10656779All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus1585Open in IMG/M
Ga0256703_10658807All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum516Open in IMG/M
Ga0256703_10660018All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae588Open in IMG/M
Ga0256703_10664138All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae4694Open in IMG/M
Ga0256703_10664780All Organisms → cellular organisms → Eukaryota → Opisthokonta533Open in IMG/M
Ga0256703_10666873All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78627Open in IMG/M
Ga0256703_10668671All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes6324Open in IMG/M
Ga0256703_10669122All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum665Open in IMG/M
Ga0256703_10670868Not Available3314Open in IMG/M
Ga0256703_10674233All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum urartu837Open in IMG/M
Ga0256703_10676050All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata634Open in IMG/M
Ga0256703_10676299All Organisms → cellular organisms → Eukaryota → Opisthokonta1256Open in IMG/M
Ga0256703_10676466All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum597Open in IMG/M
Ga0256703_10677764Not Available736Open in IMG/M
Ga0256703_10678135All Organisms → cellular organisms → Eukaryota → Opisthokonta1338Open in IMG/M
Ga0256703_10678534Not Available579Open in IMG/M
Ga0256703_10681429Not Available805Open in IMG/M
Ga0256703_10682270Not Available1649Open in IMG/M
Ga0256703_10682610All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → Bacteroides uniformis601Open in IMG/M
Ga0256703_10684235Not Available658Open in IMG/M
Ga0256703_10686229All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia triticina → Puccinia triticina 1-1 BBBD Race 1576Open in IMG/M
Ga0256703_10690361All Organisms → cellular organisms → Eukaryota → Opisthokonta720Open in IMG/M
Ga0256703_10694424All Organisms → cellular organisms → Eukaryota → Opisthokonta2986Open in IMG/M
Ga0256703_10696467All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Anseriformes → Anatidae → Anatinae → Anas → Anas platyrhynchos3299Open in IMG/M
Ga0256703_10696733All Organisms → cellular organisms → Eukaryota → Opisthokonta2004Open in IMG/M
Ga0256703_10696739Not Available538Open in IMG/M
Ga0256703_10698727All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata707Open in IMG/M
Ga0256703_10708689All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii660Open in IMG/M
Ga0256703_10709381All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae834Open in IMG/M
Ga0256703_10709776All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae1535Open in IMG/M
Ga0256703_10714538Not Available593Open in IMG/M
Ga0256703_10716439Not Available751Open in IMG/M
Ga0256703_10717897All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Morganellaceae → Proteus → Proteus mirabilis645Open in IMG/M
Ga0256703_10721236All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae918Open in IMG/M
Ga0256703_10721374All Organisms → cellular organisms → Eukaryota → Opisthokonta516Open in IMG/M
Ga0256703_10722800Not Available601Open in IMG/M
Ga0256703_10723025All Organisms → cellular organisms → Eukaryota → Opisthokonta1098Open in IMG/M
Ga0256703_10724834All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum673Open in IMG/M
Ga0256703_10724879All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Meleagridinae → Meleagris → Meleagris gallopavo1184Open in IMG/M
Ga0256703_10726247Not Available530Open in IMG/M
Ga0256703_10736506Not Available598Open in IMG/M
Ga0256703_10741403All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum668Open in IMG/M
Ga0256703_10744158All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea abies535Open in IMG/M
Ga0256703_10744824All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae819Open in IMG/M
Ga0256703_10747053All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays890Open in IMG/M
Ga0256703_10748089All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum522Open in IMG/M
Ga0256703_10748957All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae1421Open in IMG/M
Ga0256703_10749615All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae2151Open in IMG/M
Ga0256703_10752244All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum684Open in IMG/M
Ga0256703_10755760All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum638Open in IMG/M
Ga0256703_10756996Not Available649Open in IMG/M
Ga0256703_10757565All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae512Open in IMG/M
Ga0256703_10758187All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays553Open in IMG/M
Ga0256703_10759395All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum559Open in IMG/M
Ga0256703_10762412All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum634Open in IMG/M
Ga0256703_10762742All Organisms → cellular organisms → Eukaryota → Opisthokonta3305Open in IMG/M
Ga0256703_10765095Not Available644Open in IMG/M
Ga0256703_10767079All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus669Open in IMG/M
Ga0256703_10769811All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum697Open in IMG/M
Ga0256703_10770377All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus1280Open in IMG/M
Ga0256703_10770946All Organisms → cellular organisms → Eukaryota → Opisthokonta1690Open in IMG/M
Ga0256703_10772444All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus638Open in IMG/M
Ga0256703_10773281All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae623Open in IMG/M
Ga0256703_10773831Not Available1206Open in IMG/M
Ga0256703_10776918All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae2330Open in IMG/M
Ga0256703_10777385Not Available1458Open in IMG/M
Ga0256703_10778896All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum1016Open in IMG/M
Ga0256703_10779380Not Available1969Open in IMG/M
Ga0256703_10783946Not Available3000Open in IMG/M
Ga0256703_10786479Not Available705Open in IMG/M
Ga0256703_10787518All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus741Open in IMG/M
Ga0256703_10789479Not Available687Open in IMG/M
Ga0256703_10790597All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum616Open in IMG/M
Ga0256703_10790819All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78656Open in IMG/M
Ga0256703_10792492Not Available689Open in IMG/M
Ga0256703_10799845Not Available561Open in IMG/M
Ga0256703_10805277Not Available1381Open in IMG/M
Ga0256703_10810206Not Available651Open in IMG/M
Ga0256703_10810500Not Available1681Open in IMG/M
Ga0256703_10812856All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae669Open in IMG/M
Ga0256703_10814622Not Available520Open in IMG/M
Ga0256703_10818468Not Available1666Open in IMG/M
Ga0256703_10818636Not Available586Open in IMG/M
Ga0256703_10819104All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae514Open in IMG/M
Ga0256703_10820409All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum639Open in IMG/M
Ga0256703_10820652All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae1354Open in IMG/M
Ga0256703_10823836All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum urartu622Open in IMG/M
Ga0256703_10826413All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum602Open in IMG/M
Ga0256703_10828798All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae2297Open in IMG/M
Ga0256703_10836146All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Coetzeevirus → Lactobacillus virus phiJL1829Open in IMG/M
Ga0256703_10839935All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum832Open in IMG/M
Ga0256703_10842319All Organisms → cellular organisms → Eukaryota → Opisthokonta2415Open in IMG/M
Ga0256703_10844195All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves1268Open in IMG/M
Ga0256703_10845595All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum750Open in IMG/M
Ga0256703_10846408Not Available1569Open in IMG/M
Ga0256703_10846975All Organisms → cellular organisms → Eukaryota → Opisthokonta580Open in IMG/M
Ga0256703_10851097All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78545Open in IMG/M
Ga0256703_10853678All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae2356Open in IMG/M
Ga0256703_10854688All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae890Open in IMG/M
Ga0256703_10857189All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum599Open in IMG/M
Ga0256703_10857797All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae785Open in IMG/M
Ga0256703_10859192All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum690Open in IMG/M
Ga0256703_10862420All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae1375Open in IMG/M
Ga0256703_10864794All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays870Open in IMG/M
Ga0256703_10866439Not Available1047Open in IMG/M
Ga0256703_10867648All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae1053Open in IMG/M
Ga0256703_10869799All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae1343Open in IMG/M
Ga0256703_10872127Not Available602Open in IMG/M
Ga0256703_10873056All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum620Open in IMG/M
Ga0256703_10873512All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae811Open in IMG/M
Ga0256703_10873679All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum607Open in IMG/M
Ga0256703_10873941All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum urartu1829Open in IMG/M
Ga0256703_10875492All Organisms → cellular organisms → Eukaryota → Opisthokonta3819Open in IMG/M
Ga0256703_10883790Not Available816Open in IMG/M
Ga0256703_10887717All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae803Open in IMG/M
Ga0256703_10889493Not Available597Open in IMG/M
Ga0256703_10890003All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae594Open in IMG/M
Ga0256703_10890696All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae1073Open in IMG/M
Ga0256703_10892238All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum615Open in IMG/M
Ga0256703_10892668All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum833Open in IMG/M
Ga0256703_10893781Not Available1220Open in IMG/M
Ga0256703_10894765All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78605Open in IMG/M
Ga0256703_10894791All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus2073Open in IMG/M
Ga0256703_10896692All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum603Open in IMG/M
Ga0256703_10899746All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum793Open in IMG/M
Ga0256703_10902795All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae4663Open in IMG/M
Ga0256703_10905691All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae585Open in IMG/M
Ga0256703_10908092All Organisms → cellular organisms → Eukaryota → Opisthokonta833Open in IMG/M
Ga0256703_10908444All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae2882Open in IMG/M
Ga0256703_10908773All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum urartu567Open in IMG/M
Ga0256703_10908802All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum urartu557Open in IMG/M
Ga0256703_10910860Not Available660Open in IMG/M
Ga0256703_10911618Not Available799Open in IMG/M
Ga0256703_10911906All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii675Open in IMG/M
Ga0256703_10912018All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Morganellaceae → Proteus → Proteus mirabilis806Open in IMG/M
Ga0256703_10913960All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter calcoaceticus/baumannii complex → Acinetobacter baumannii567Open in IMG/M
Ga0256703_10916709All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Charadriiformes → Scolopacidae → Limosa → Limosa lapponica → Limosa lapponica baueri5558Open in IMG/M
Ga0256703_10917510All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae2243Open in IMG/M
Ga0256703_10918410Not Available522Open in IMG/M
Ga0256703_10921912All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus2072Open in IMG/M
Ga0256703_10922243All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae1953Open in IMG/M
Ga0256703_10923280All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae2871Open in IMG/M
Ga0256703_10924146All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus1744Open in IMG/M
Ga0256703_10927896All Organisms → cellular organisms → Eukaryota732Open in IMG/M
Ga0256703_10928876Not Available661Open in IMG/M
Ga0256703_10929576All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae1227Open in IMG/M
Ga0256703_10929644Not Available924Open in IMG/M
Ga0256703_10929774Not Available890Open in IMG/M
Ga0256703_10929983All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora → Bovidae → Bovinae → Bos660Open in IMG/M
Ga0256703_10931022All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus2505Open in IMG/M
Ga0256703_10931232All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae601Open in IMG/M
Ga0256703_10931961All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria879Open in IMG/M
Ga0256703_10933750All Organisms → cellular organisms → Eukaryota → Opisthokonta547Open in IMG/M
Ga0256703_10938685All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae1110Open in IMG/M
Ga0256703_10940184All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae1568Open in IMG/M
Ga0256703_10940421All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus635Open in IMG/M
Ga0256703_10940465All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum635Open in IMG/M
Ga0256703_10943214Not Available1547Open in IMG/M
Ga0256703_10945665All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae833Open in IMG/M
Ga0256703_10946236All Organisms → cellular organisms → Eukaryota → Opisthokonta830Open in IMG/M
Ga0256703_10947590All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae5971Open in IMG/M
Ga0256703_10949003Not Available1137Open in IMG/M
Ga0256703_10949374Not Available972Open in IMG/M
Ga0256703_10951241Not Available1559Open in IMG/M
Ga0256703_10954949Not Available529Open in IMG/M
Ga0256703_10957190All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus677Open in IMG/M
Ga0256703_10957556All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum urartu560Open in IMG/M
Ga0256703_10957953All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum urartu747Open in IMG/M
Ga0256703_10959003Not Available1017Open in IMG/M
Ga0256703_10961735All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea669Open in IMG/M
Ga0256703_10967994Not Available1047Open in IMG/M
Ga0256703_10970237All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae859Open in IMG/M
Ga0256703_10972528All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum799Open in IMG/M
Ga0256703_10975172All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei525Open in IMG/M
Ga0256703_10976217All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves1016Open in IMG/M
Ga0256703_10980393All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum522Open in IMG/M
Ga0256703_10985815All Organisms → cellular organisms → Eukaryota → Opisthokonta1567Open in IMG/M
Ga0256703_10989673All Organisms → cellular organisms → Eukaryota → Opisthokonta2082Open in IMG/M
Ga0256703_10989706Not Available544Open in IMG/M
Ga0256703_10991969All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae1399Open in IMG/M
Ga0256703_10993723All Organisms → cellular organisms → Eukaryota635Open in IMG/M
Ga0256703_10996780Not Available3128Open in IMG/M
Ga0256703_10997347All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78632Open in IMG/M
Ga0256703_10997753All Organisms → cellular organisms → Eukaryota → Opisthokonta3785Open in IMG/M
Ga0256703_10997947All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae1083Open in IMG/M
Ga0256703_10999785All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia triticina → Puccinia triticina 1-1 BBBD Race 1520Open in IMG/M
Ga0256703_11000838All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus779Open in IMG/M
Ga0256703_11001191All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae1622Open in IMG/M
Ga0256703_11003979All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus2848Open in IMG/M
Ga0256703_11006396All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus1341Open in IMG/M
Ga0256703_11006975All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus520Open in IMG/M
Ga0256703_11008067All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae617Open in IMG/M
Ga0256703_11008158All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum1349Open in IMG/M
Ga0256703_11008528Not Available1480Open in IMG/M
Ga0256703_11013523Not Available660Open in IMG/M
Ga0256703_11013891All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae1017Open in IMG/M
Ga0256703_11017271All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Clostridiaceae → Clostridium → unclassified Clostridium → Clostridium sp.818Open in IMG/M
Ga0256703_11018000All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus3113Open in IMG/M
Ga0256703_11019635All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae4529Open in IMG/M
Ga0256703_11022123All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum607Open in IMG/M
Ga0256703_11026217Not Available2449Open in IMG/M
Ga0256703_11032349Not Available757Open in IMG/M
Ga0256703_11033006Not Available1052Open in IMG/M
Ga0256703_11033711Not Available555Open in IMG/M
Ga0256703_11033765All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum657Open in IMG/M
Ga0256703_11036179All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Meleagridinae → Meleagris → Meleagris gallopavo668Open in IMG/M
Ga0256703_11038232All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae541Open in IMG/M
Ga0256703_11042663Not Available2620Open in IMG/M
Ga0256703_11045798Not Available682Open in IMG/M
Ga0256703_11046155All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Morganellaceae → Proteus → Proteus mirabilis695Open in IMG/M
Ga0256703_11047820All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae1765Open in IMG/M
Ga0256703_11048194All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Lactiplantibacillus → Lactiplantibacillus plantarum1623Open in IMG/M
Ga0256703_11048558All Organisms → cellular organisms → Eukaryota → Opisthokonta1181Open in IMG/M
Ga0256703_11057338All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78512Open in IMG/M
Ga0256703_11057469Not Available2198Open in IMG/M
Ga0256703_11058885All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae939Open in IMG/M
Ga0256703_11058985All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae1278Open in IMG/M
Ga0256703_11059450All Organisms → cellular organisms → Bacteria567Open in IMG/M
Ga0256703_11059711All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae845Open in IMG/M
Ga0256703_11064523Not Available1068Open in IMG/M
Ga0256703_11065113Not Available1005Open in IMG/M
Ga0256703_11065402All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Clostridiaceae → Clostridium → unclassified Clostridium → Clostridium sp.659Open in IMG/M
Ga0256703_11067480All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae1136Open in IMG/M
Ga0256703_11069269All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Morganellaceae → Proteus → Proteus mirabilis540Open in IMG/M
Ga0256703_11069323All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae986Open in IMG/M
Ga0256703_11072441All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae1671Open in IMG/M
Ga0256703_11074951Not Available514Open in IMG/M
Ga0256703_11080296All Organisms → cellular organisms → Eukaryota → Opisthokonta3258Open in IMG/M
Ga0256703_11085052All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae932Open in IMG/M
Ga0256703_11085789All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata607Open in IMG/M
Ga0256703_11087450Not Available2250Open in IMG/M
Ga0256703_11092978All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae518Open in IMG/M
Ga0256703_11098755All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae656Open in IMG/M
Ga0256703_11104284All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Morganellaceae → Proteus → Proteus mirabilis673Open in IMG/M
Ga0256703_11108334Not Available554Open in IMG/M
Ga0256703_11110403All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum555Open in IMG/M
Ga0256703_11111214All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum urartu505Open in IMG/M
Ga0256703_11112456Not Available666Open in IMG/M
Ga0256703_11114102All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae2566Open in IMG/M
Ga0256703_11115635All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis599Open in IMG/M
Ga0256703_11115973All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum867Open in IMG/M
Ga0256703_11117151All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata1263Open in IMG/M
Ga0256703_11119540All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae571Open in IMG/M
Ga0256703_11122088All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae604Open in IMG/M
Ga0256703_11122976All Organisms → cellular organisms → Eukaryota → Opisthokonta3295Open in IMG/M
Ga0256703_11126027All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Lamiales → Lamiaceae → Nepetoideae → Mentheae → Salviinae → Salvia1384Open in IMG/M
Ga0256703_11126519All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae1220Open in IMG/M
Ga0256703_11131771All Organisms → cellular organisms → Eukaryota → Opisthokonta5189Open in IMG/M
Ga0256703_11132392All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Morganellaceae → Proteus → Proteus mirabilis681Open in IMG/M
Ga0256703_11133134All Organisms → cellular organisms → Eukaryota → Opisthokonta576Open in IMG/M
Ga0256703_11134563Not Available529Open in IMG/M
Ga0256703_11135253Not Available3396Open in IMG/M
Ga0256703_11135426All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum1113Open in IMG/M
Ga0256703_11136548All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78594Open in IMG/M
Ga0256703_11136714All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae677Open in IMG/M
Ga0256703_11139645All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays621Open in IMG/M
Ga0256703_11142361All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78555Open in IMG/M
Ga0256703_11144756Not Available1544Open in IMG/M
Ga0256703_11144970All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata732Open in IMG/M
Ga0256703_11146425Not Available914Open in IMG/M
Ga0256703_11147795Not Available4511Open in IMG/M
Ga0256703_11151016Not Available753Open in IMG/M
Ga0256703_11152557All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae691Open in IMG/M
Ga0256703_11152764Not Available2160Open in IMG/M
Ga0256703_11156552All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum708Open in IMG/M
Ga0256703_11159814All Organisms → cellular organisms → Eukaryota → Opisthokonta1550Open in IMG/M
Ga0256703_11160284Not Available863Open in IMG/M
Ga0256703_11162788All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum870Open in IMG/M
Ga0256703_11167572All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves957Open in IMG/M
Ga0256703_11170569All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78637Open in IMG/M
Ga0256703_11170982All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum532Open in IMG/M
Ga0256703_11171453All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays561Open in IMG/M
Ga0256703_11173785Not Available1353Open in IMG/M
Ga0256703_11174881Not Available561Open in IMG/M
Ga0256703_11175194All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78514Open in IMG/M
Ga0256703_11176883All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum901Open in IMG/M
Ga0256703_11177071Not Available1051Open in IMG/M
Ga0256703_11179114All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays869Open in IMG/M
Ga0256703_11180563Not Available1390Open in IMG/M
Ga0256703_11182940All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae851Open in IMG/M
Ga0256703_11186327Not Available1858Open in IMG/M
Ga0256703_11186895All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae648Open in IMG/M
Ga0256703_11190568Not Available704Open in IMG/M
Ga0256703_11193326Not Available1158Open in IMG/M
Ga0256703_11193758All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus1191Open in IMG/M
Ga0256703_11194549All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae546Open in IMG/M
Ga0256703_11195531All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum643Open in IMG/M
Ga0256703_11196791All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78503Open in IMG/M
Ga0256703_11205617All Organisms → cellular organisms → Eukaryota → Opisthokonta1480Open in IMG/M
Ga0256703_11207344All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum576Open in IMG/M
Ga0256703_11210330All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Hordeinae → Hordeum → Hordeum vulgare → Hordeum vulgare subsp. vulgare632Open in IMG/M
Ga0256703_11210386All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum887Open in IMG/M
Ga0256703_11213916All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum934Open in IMG/M
Ga0256703_11216587All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus1141Open in IMG/M
Ga0256703_11218081All Organisms → cellular organisms → Eukaryota → Opisthokonta838Open in IMG/M
Ga0256703_11218212Not Available1144Open in IMG/M
Ga0256703_11220273All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia triticina → Puccinia triticina 1-1 BBBD Race 1678Open in IMG/M
Ga0256703_11222018Not Available1030Open in IMG/M
Ga0256703_11224809All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum534Open in IMG/M
Ga0256703_11225387Not Available2198Open in IMG/M
Ga0256703_11225550Not Available624Open in IMG/M
Ga0256703_11234954All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae2173Open in IMG/M
Ga0256703_11236823All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae1032Open in IMG/M
Ga0256703_11239109All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei606Open in IMG/M
Ga0256703_11241160Not Available715Open in IMG/M
Ga0256703_11241555Not Available712Open in IMG/M
Ga0256703_11245999All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Clostridiaceae → Clostridium → unclassified Clostridium → Clostridium sp.1394Open in IMG/M
Ga0256703_11248908Not Available691Open in IMG/M
Ga0256703_11249743All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus1176Open in IMG/M
Ga0256703_11258517All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Sapindales → Anacardiaceae → Pistacia → Pistacia vera858Open in IMG/M
Ga0256703_11259171Not Available732Open in IMG/M
Ga0256703_11261492All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus3183Open in IMG/M
Ga0256703_11265964All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum1003Open in IMG/M
Ga0256703_11268001All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78597Open in IMG/M
Ga0256703_11268349All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus1224Open in IMG/M
Ga0256703_11276065All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia triticina → Puccinia triticina 1-1 BBBD Race 1599Open in IMG/M
Ga0256703_11285336All Organisms → cellular organisms → Eukaryota → Opisthokonta3864Open in IMG/M
Ga0256703_11286029All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum540Open in IMG/M
Ga0256703_11290252All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea874Open in IMG/M
Ga0256703_11294166Not Available2556Open in IMG/M
Ga0256703_11294370All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus1973Open in IMG/M
Ga0256703_11294933All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Passeriformes → Sylvioidea → Zosteropidae → Zosterops → Zosterops borbonicus2316Open in IMG/M
Ga0256703_11297443Not Available703Open in IMG/M
Ga0256703_11297771All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays592Open in IMG/M
Ga0256703_11298005All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Perdicinae → Coturnix → Coturnix japonica2956Open in IMG/M
Ga0256703_11298794All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata747Open in IMG/M
Ga0256703_11302960All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae2023Open in IMG/M
Ga0256703_11303472All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Morganellaceae → Proteus → Proteus mirabilis715Open in IMG/M
Ga0256703_11303749All Organisms → cellular organisms → Eukaryota → Opisthokonta1468Open in IMG/M
Ga0256703_11306145All Organisms → cellular organisms → Eukaryota → Opisthokonta5237Open in IMG/M
Ga0256703_11307995All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae793Open in IMG/M
Ga0256703_11309500All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus938Open in IMG/M
Ga0256703_11312191All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum550Open in IMG/M
Ga0256703_11312258All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes707Open in IMG/M
Ga0256703_11312778All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae2177Open in IMG/M
Ga0256703_11314254All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae1003Open in IMG/M
Ga0256703_11316086All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum568Open in IMG/M
Ga0256703_11320107All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata726Open in IMG/M
Ga0256703_11320712All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata4899Open in IMG/M
Ga0256703_11321134All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum1042Open in IMG/M
Ga0256703_11322247All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei545Open in IMG/M
Ga0256703_11324877All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae897Open in IMG/M
Ga0256703_11325950All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata775Open in IMG/M
Ga0256703_11327162All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae1026Open in IMG/M
Ga0256703_11327771All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae1494Open in IMG/M
Ga0256703_11329905All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Perdicinae → Coturnix → Coturnix japonica664Open in IMG/M
Ga0256703_11331505Not Available1039Open in IMG/M
Ga0256703_11334357Not Available834Open in IMG/M
Ga0256703_11336315All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae1207Open in IMG/M
Ga0256703_11337125All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78752Open in IMG/M
Ga0256703_11346042All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae1566Open in IMG/M
Ga0256703_11348616Not Available1315Open in IMG/M
Ga0256703_11350069All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum urartu594Open in IMG/M
Ga0256703_11351480All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae2335Open in IMG/M
Ga0256703_11353604All Organisms → cellular organisms → Eukaryota → Opisthokonta5459Open in IMG/M
Ga0256703_11355281All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Morganellaceae → Proteus → Proteus mirabilis909Open in IMG/M
Ga0256703_11355593All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Numididae → Numida → Numida meleagris898Open in IMG/M
Ga0256703_11359953All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata794Open in IMG/M
Ga0256703_11363621All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78510Open in IMG/M
Ga0256703_11363971Not Available1436Open in IMG/M
Ga0256703_11365067All Organisms → cellular organisms → Eukaryota → Opisthokonta5132Open in IMG/M
Ga0256703_11365664Not Available521Open in IMG/M
Ga0256703_11366773All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata701Open in IMG/M
Ga0256703_11366903All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae806Open in IMG/M
Ga0256703_11367906All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum764Open in IMG/M
Ga0256703_11368503All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae510Open in IMG/M
Ga0256703_11368813Not Available761Open in IMG/M
Ga0256703_11369922All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78553Open in IMG/M
Ga0256703_11369999All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae1023Open in IMG/M
Ga0256703_11372817All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum1000Open in IMG/M
Ga0256703_11374704All Organisms → cellular organisms → Eukaryota → Opisthokonta1305Open in IMG/M
Ga0256703_11374757All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum773Open in IMG/M
Ga0256703_11376045All Organisms → cellular organisms → Eukaryota → Opisthokonta518Open in IMG/M
Ga0256703_11377072All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum660Open in IMG/M
Ga0256703_11382633All Organisms → cellular organisms → Eukaryota → Opisthokonta580Open in IMG/M
Ga0256703_11384647All Organisms → cellular organisms → Eukaryota → Opisthokonta2368Open in IMG/M
Ga0256703_11387394Not Available2282Open in IMG/M
Ga0256703_11391274All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae2784Open in IMG/M
Ga0256703_11391819All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae4183Open in IMG/M
Ga0256703_11394689All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata847Open in IMG/M
Ga0256703_11395027Not Available608Open in IMG/M
Ga0256703_11396876Not Available1123Open in IMG/M
Ga0256703_11398007Not Available548Open in IMG/M
Ga0256703_11398561All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei1663Open in IMG/M
Ga0256703_11411130All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Meleagridinae → Meleagris → Meleagris gallopavo2243Open in IMG/M
Ga0256703_11411287All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum527Open in IMG/M
Ga0256703_11413403All Organisms → cellular organisms → Eukaryota → Opisthokonta778Open in IMG/M
Ga0256703_11417611All Organisms → cellular organisms → Eukaryota → Opisthokonta1047Open in IMG/M
Ga0256703_11421839All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays816Open in IMG/M
Ga0256703_11422575Not Available516Open in IMG/M
Ga0256703_11425290All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae2685Open in IMG/M
Ga0256703_11425954Not Available1159Open in IMG/M
Ga0256703_11427937All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Perdicinae → Bambusicola → Bambusicola thoracicus10644Open in IMG/M
Ga0256703_11428063All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae2719Open in IMG/M
Ga0256703_11434244All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78799Open in IMG/M
Ga0256703_11435468All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum663Open in IMG/M
Ga0256703_11436290All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae5616Open in IMG/M
Ga0256703_11437221All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum633Open in IMG/M
Ga0256703_11439866All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78564Open in IMG/M
Ga0256703_11439984All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae715Open in IMG/M
Ga0256703_11445060All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Morganellaceae → Proteus → Proteus mirabilis816Open in IMG/M
Ga0256703_11445783All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum706Open in IMG/M
Ga0256703_11448618All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae2463Open in IMG/M
Ga0256703_11449820All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae1631Open in IMG/M
Ga0256703_11449837All Organisms → cellular organisms → Eukaryota → Opisthokonta611Open in IMG/M
Ga0256703_11451726All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Companilactobacillus4544Open in IMG/M
Ga0256703_11455866Not Available2141Open in IMG/M
Ga0256703_11458438Not Available1054Open in IMG/M
Ga0256703_11459148All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves1227Open in IMG/M
Ga0256703_11460369All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78917Open in IMG/M
Ga0256703_11463305All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae1037Open in IMG/M
Ga0256703_11466616All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae1876Open in IMG/M
Ga0256703_11470182Not Available1009Open in IMG/M
Ga0256703_11477657All Organisms → cellular organisms → Eukaryota → Opisthokonta594Open in IMG/M
Ga0256703_11481549All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus853Open in IMG/M
Ga0256703_11484998All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78566Open in IMG/M
Ga0256703_11486175All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Morganellaceae → Proteus → Proteus mirabilis595Open in IMG/M
Ga0256703_11486495All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum649Open in IMG/M
Ga0256703_11486513Not Available2107Open in IMG/M
Ga0256703_11487390All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum753Open in IMG/M
Ga0256703_11488356All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Perdicinae → Bambusicola → Bambusicola thoracicus6124Open in IMG/M
Ga0256703_11491975All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum660Open in IMG/M
Ga0256703_11492038All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78513Open in IMG/M
Ga0256703_11496232Not Available2399Open in IMG/M
Ga0256703_11497074All Organisms → cellular organisms → Eukaryota → Opisthokonta6919Open in IMG/M
Ga0256703_11504709All Organisms → cellular organisms → Eukaryota → Opisthokonta2269Open in IMG/M
Ga0256703_11506768All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae1782Open in IMG/M
Ga0256703_11509307All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum urartu558Open in IMG/M
Ga0256703_11509529All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays672Open in IMG/M
Ga0256703_11511213All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae3266Open in IMG/M
Ga0256703_11513240All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus1339Open in IMG/M
Ga0256703_11517278All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata517Open in IMG/M
Ga0256703_11518210All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae2195Open in IMG/M
Ga0256703_11519762All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum634Open in IMG/M
Ga0256703_11520893All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Morganellaceae → Proteus → Proteus mirabilis532Open in IMG/M
Ga0256703_11521024All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae1374Open in IMG/M
Ga0256703_11522925All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum668Open in IMG/M
Ga0256703_11523990All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum urartu676Open in IMG/M
Ga0256703_11524221All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum522Open in IMG/M
Ga0256703_11526477Not Available571Open in IMG/M
Ga0256703_11530787All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae3616Open in IMG/M
Ga0256703_11531034All Organisms → cellular organisms → Eukaryota → Opisthokonta3043Open in IMG/M
Ga0256703_11535245All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora580Open in IMG/M
Ga0256703_11536276All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei645Open in IMG/M
Ga0256703_11538463All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus1468Open in IMG/M
Ga0256703_11539294All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum505Open in IMG/M
Ga0256703_11540640All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum668Open in IMG/M
Ga0256703_11540688All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora592Open in IMG/M
Ga0256703_11546191All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum669Open in IMG/M
Ga0256703_11548292Not Available1054Open in IMG/M
Ga0256703_11548308All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae4351Open in IMG/M
Ga0256703_11550223Not Available913Open in IMG/M
Ga0256703_11550506All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae713Open in IMG/M
Ga0256703_11551079Not Available2121Open in IMG/M
Ga0256703_11552191All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae1959Open in IMG/M
Ga0256703_11554517All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae603Open in IMG/M
Ga0256703_11556131All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae2325Open in IMG/M
Ga0256703_11557758All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae4231Open in IMG/M
Ga0256703_11562518All Organisms → cellular organisms → Eukaryota → Opisthokonta2705Open in IMG/M
Ga0256703_11562734All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae586Open in IMG/M
Ga0256703_11565783Not Available1268Open in IMG/M
Ga0256703_11566035All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus594Open in IMG/M
Ga0256703_11566321All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays979Open in IMG/M
Ga0256703_11569278All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Numididae → Numida → Numida meleagris2048Open in IMG/M
Ga0256703_11569511All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum682Open in IMG/M
Ga0256703_11574233All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae2533Open in IMG/M
Ga0256703_11575302Not Available1328Open in IMG/M
Ga0256703_11578135Not Available2892Open in IMG/M
Ga0256703_11580583All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae3566Open in IMG/M
Ga0256703_11585306All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Odontophoridae → Odontophorus → Odontophorus gujanensis1858Open in IMG/M
Ga0256703_11586868All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae8694Open in IMG/M
Ga0256703_11591664Not Available609Open in IMG/M
Ga0256703_11592793All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora543Open in IMG/M
Ga0256703_11594447Not Available1387Open in IMG/M
Ga0256703_11596524All Organisms → cellular organisms → Eukaryota → Opisthokonta614Open in IMG/M
Ga0256703_11603142Not Available661Open in IMG/M
Ga0256703_11603750All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae2666Open in IMG/M
Ga0256703_11603890All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae1415Open in IMG/M
Ga0256703_11614416All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus2490Open in IMG/M
Ga0256703_11615253Not Available1544Open in IMG/M
Ga0256703_11615965All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78637Open in IMG/M
Ga0256703_11616944All Organisms → cellular organisms → Eukaryota → Opisthokonta2559Open in IMG/M
Ga0256703_11619534All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae1889Open in IMG/M
Ga0256703_11619844Not Available3135Open in IMG/M
Ga0256703_11622250All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus3993Open in IMG/M
Ga0256703_11622678All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum948Open in IMG/M
Ga0256703_11623102All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae527Open in IMG/M
Ga0256703_11623434All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae1276Open in IMG/M
Ga0256703_11624056All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae1567Open in IMG/M
Ga0256703_11626877All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum559Open in IMG/M
Ga0256703_11626975Not Available3389Open in IMG/M
Ga0256703_11631601Not Available772Open in IMG/M
Ga0256703_11631718All Organisms → cellular organisms → Eukaryota → Opisthokonta629Open in IMG/M
Ga0256703_11632591Not Available1348Open in IMG/M
Ga0256703_11632979All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum729Open in IMG/M
Ga0256703_11634464Not Available1115Open in IMG/M
Ga0256703_11635250All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Odontophoridae → Callipepla → Callipepla squamata4047Open in IMG/M
Ga0256703_11639152All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus1763Open in IMG/M
Ga0256703_11643613All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus1224Open in IMG/M
Ga0256703_11643927All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae4249Open in IMG/M
Ga0256703_11645401All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia triticina → Puccinia triticina 1-1 BBBD Race 1627Open in IMG/M
Ga0256703_11645416Not Available655Open in IMG/M
Ga0256703_11647077Not Available611Open in IMG/M
Ga0256703_11647800Not Available874Open in IMG/M
Ga0256703_11652921Not Available631Open in IMG/M
Ga0256703_11653983All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae919Open in IMG/M
Ga0256703_11654237All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae1446Open in IMG/M
Ga0256703_11655722Not Available559Open in IMG/M
Ga0256703_11660681All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae520Open in IMG/M
Ga0256703_11660980All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays1245Open in IMG/M
Ga0256703_11664220Not Available558Open in IMG/M
Ga0256703_11676099All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria602Open in IMG/M
Ga0256703_11677466All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Numididae → Numida → Numida meleagris1747Open in IMG/M
Ga0256703_11677643All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus2793Open in IMG/M
Ga0256703_11678821All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae1153Open in IMG/M
Ga0256703_11681726All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum594Open in IMG/M
Ga0256703_11682576All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae808Open in IMG/M
Ga0256703_11685674All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Morganellaceae → Proteus → Proteus mirabilis1079Open in IMG/M
Ga0256703_11685995Not Available512Open in IMG/M
Ga0256703_11686326Not Available652Open in IMG/M
Ga0256703_11687800All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78526Open in IMG/M
Ga0256703_11692631All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum612Open in IMG/M
Ga0256703_11694760Not Available1128Open in IMG/M
Ga0256703_11695818All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae844Open in IMG/M
Ga0256703_11700785All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae900Open in IMG/M
Ga0256703_11701137All Organisms → cellular organisms → Eukaryota → Opisthokonta505Open in IMG/M
Ga0256703_11706005Not Available893Open in IMG/M
Ga0256703_11707827All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Morganellaceae → Proteus → Proteus mirabilis578Open in IMG/M
Ga0256703_11709600Not Available2916Open in IMG/M
Ga0256703_11709804Not Available585Open in IMG/M
Ga0256703_11710725Not Available1846Open in IMG/M
Ga0256703_11711409Not Available842Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0256703_10001258Ga0256703_100012581F052316ECWQGAREAWAMVKMRYTKLDPNHMAEVGPAGPDGQEIPVSLVYDQVALAAKYSQHDCKLDSLLDGIEEEYSQSK
Ga0256703_10003836Ga0256703_100038362F081962VVTKLKAVYTLVEQLYTGSQRALAVVALSNEVPTHLAEVLRRLAVLPQRIQELRRASARAGAIAALSRAKAFLPELDPADIALGYPSLKEHGTSFDQRDFAACVKIVRPVATLIGNDTDLTKYQPGYDAENQRIPTPRYEALCLIPPTRKHTFAPEIDPAGLIDEEAQFEALSGINWKSSTF
Ga0256703_10005113Ga0256703_100051131F052316KLDPNHMARVGPVGPDGKEIPVSLVYDQVGLAAKYSQQDCRLDSLLDGIEEEFSQSK
Ga0256703_10005669Ga0256703_100056691F062313HHRLNGREFGWTLGVGDGQEGLACCSPWGRKVSDVTEQLN
Ga0256703_10006314Ga0256703_100063141F081962MLLHTSPRSTNHKQNMLIKLKAVYTLVEQLYSGSQLTLAVVALSNTPPRLLQDVLKHLAVLPQRIKDLRQASARAGAVAALSRAKAWVPELDLADLTLGYPSLKEDGSVFDDQDFSACVKVVRPLATLIGNDTDLTKYSSGYDSENRRIPNVPYDQVSLIPPTRKHTFAPEVDPTGLIDDEAEFEALSGIDWASSTIQDKAANGEAEKDNPESSSPPKE
Ga0256703_10010910Ga0256703_100109101F086390NLGAIVARRLHNNRFNGDLFGGIYATRLANFLGVTIREDDIELPPAYLDYEAMVRHRFVERNDQFLQYRLIFDRRRTFHVALPASTFFDFQAKGRYFITREEANEYERRAEIARLQAAAHNAITAASQYDRNYNFGYPPGHPWQ
Ga0256703_10011012Ga0256703_100110122F038012MTIELQPPCYVQGRQPPDQAAQSHIQPGLECLQGWGIHSLLGQPV
Ga0256703_10012513Ga0256703_100125131F096317VHKQVMLLVAAARTAEVAELKRDLEQAQGELGVTKRQLEEN
Ga0256703_10013464Ga0256703_100134641F013401KYESSSDDNASDEEDNLRSLFANLNIAQKEKLNELVSAIHEKDDLLDSQEDCLIKENKKHVKVKNAYALEVEKCKKLSSELSTCREMIDNLRHENASLNAKVDSHVCNVSIPNSRNNNDDLLASIEELNISLASLRIENEKLLAKAKDFDVCNATISDLRTKNDLLHAKVVELKSCKPSTSNVEHVSICT
Ga0256703_10016773Ga0256703_100167731F096850AIIGTAKNEKVPAATPKRKRMANVLDVLETIKSSSTPPKKAAVTPETTAEISGSTAPEQEISAEAGPSEPAKTLESEAEKITKPTFEETGVVTPEASPKIRDYIFRHASGKKLSEKEEQEAQHYAQKLKYPKGALIFNGSGEEDFLYCLPDSKEISVCREMSKSFGFPT
Ga0256703_10017101Ga0256703_100171013F004001MQWHRLHREAVQSPSLEVFQNRVDMALRDVVSGHGGDGLVVGFGDLRGLFQP
Ga0256703_10027785Ga0256703_100277851F032472GPMAPSIINNDAVHGETFLPGQIFVFGGFALWANSLGHLEQIESYAPGHQVRFGSLNYTADIRGDLIFDGFEPQPSAPHCLDGHDIALPPNSALEAAHASVPTIDLEPTTPIEDQRLDAASGAMISEAIEPNSSPALRMAHDSEEPDSSLNSEPPAPPPIESDWAPIMEFNLTGRSPAMALLIKRETLENSGCRCRARA
Ga0256703_10027804Ga0256703_100278041F052316MVKTWYKKADPNHMVEVGPVGPDGKEIPMSLMYGQVELAAKYSQQDCKLDILLDGIEEEYNQSI
Ga0256703_10027986Ga0256703_100279868F004815LDVALGSLGCWLATLHIAGGWNWMSTVILFSPGHAVIL
Ga0256703_10028392Ga0256703_100283921F081962LKENMLVKLKAVYTLVEQLYSGSQRALDAVALSNTTPRLLQDVLRHLSVLPQRIQDLRRASVRAGAVAALSRARAWVPELDLADLSLGYPSLKEDGTAFDDQDFTACVKVVRPLATLIGNDTDLTKYSPGYDSENRRIPNISYDQVSLIPPTRKHTFALEVDPAGLTDDEAEFEALSGIDWASSTFQDKVTDGEA
Ga0256703_10028551Ga0256703_100285512F068298GQALEWAAQGGGGVTDPGGVQGTFGRCIEGGGLVRTIGDG
Ga0256703_10029956Ga0256703_100299561F011632GQALEWAAQRGGGVTKPGGVQRVFGCCVEGHGLVRTTGDGWMVGLDDPVGLFQP
Ga0256703_10031649Ga0256703_100316495F068298GQALKWAAQRGGGVTDPGGVQGTFERCVEGHGLVRTIGDG
Ga0256703_10032130Ga0256703_100321301F079404YQVGGAEIWRIAETGYLSGTPKKTSEDWPSEWFYMEDVPLPDPVRRGLPEFSNAPLKKCQSWRPRSPQEEDNGEVLYLMNRIKVLAQSGLVVIEVMSICIMRGVQPLQYRGHPLWCFNGEDDATRCKRKGPDNAAALAKKLSELFKGEEEEFIRIKPRDGLSMYNPPSWVSYTYLLPFFPHS
Ga0256703_10035010Ga0256703_100350103F038489MAWVEKDHSHHPVSTPCYVQGRQPPDQAAQSHIQPGLECLQGWGIH
Ga0256703_10035821Ga0256703_100358211F094706VTIPRQLAPTAGPAHGGFEFLKGNFKGLKGYAVGRMTKSRSGKLYIDDEGWGPEAGSIEYGYWVPFCRIHVFIGRIGESDPEPDVHTNLFETAQRARTTRVQSVVKHAFVGCIHSGEYSELSVEGTKTAICSDTASSTGETDSLYQLQDGMLGGCSNGNSIPDPFEPPNWAGVFMAGTQPGQNSIATAATTTGSAAARSGDPARPRLRF
Ga0256703_10036381Ga0256703_100363811F032472QFGTPYPRFTGFDPDIGAFIESSSVSSPLGLLAPTIIDSDVVRGETFLPGQIFVFGGCVLRANSLGHLEQIESYAPGHQVRFGSLNYTADIRGDMIFDGFEPQPGAPHCRDGYALALQSSSTPEAAPASAPTFSSEPTSPVEDGWLDTALGAAVSMAIEPNTILTLCAARESKVPDSFPDSEPSAPLPIESDWAPIMEFTATDIFQHSPFGNILNSLKHLSLSGETWPDYGQDGWDTDDKEIQSPPTTHF
Ga0256703_10039008Ga0256703_100390084F004001MEVVESPSLEVSKNRVDVALRDVVSGHGGDGLVVGLGDLRGPLQP
Ga0256703_10040882Ga0256703_100408823F038012MIMEFQPPCYVQDRQPPDQAAQSRIQPGIQPGLECLQG
Ga0256703_10041093Ga0256703_100410931F094706LKGSFEGLKGYAVGRMTKSHRGKIYINDAGWGPDAGSIEYGYRVPFGGIHVFIGKIGEPGPEPDLCADLIETAQRARPARARPALRHAFVGCIHGGPSDQSGSADEAAAGSDGESSTDESKSLYQLQDGRLMGCSDG
Ga0256703_10042939Ga0256703_100429391F001813EPGGVQRMVGCCVEXHGLVRTIGEGXMFGLDDPVGLFQP
Ga0256703_10044543Ga0256703_100445431F011735PYVVSKVLEKGAYELVDYDGISLGEPRNGLYLKRFYA
Ga0256703_10045421Ga0256703_100454211F038012MIIEFQPPCYVQGHQPPDQAAQSHIQPGLECLQEWGIH
Ga0256703_10045912Ga0256703_100459121F020492MRMQASLLASAALTAEVDTLKQYLERSEQELRRAKKRLEDNEGKEYLV
Ga0256703_10046545Ga0256703_100465452F004001VAGSPSLEMFKNRVDVALRDVVSGHGGDGLVVGQGDLRGLFQP
Ga0256703_10047793Ga0256703_100477931F032472IGAFIESFAASSPKGLMAPSTVHNNTVQGEICLPGQIFVFGSFALRANSLGHLEQLESYAPGQQVRFGSLNFTADIRGDLIFDGLEPQPSVPRYHDGHDLALPPDSALEAAHESALTPSSETTAQIEDRWLDTASGAAISTAMEPNTELVPRKACDSEVPDSEPPAP
Ga0256703_10049008Ga0256703_100490081F005658MAWVAKDHNAHPVPTPCYVQGRQPADQAAQSHIQPGLE
Ga0256703_10050585Ga0256703_100505851F002002MFGWASVVALVKNLPAMQKTRVRSLDQEDSLEAGMATHSSILAWEIPWTEEPVTLQSTGF
Ga0256703_10051945Ga0256703_100519451F081962MYTLVEQLYTGSQRALAVVALSNEVPTHLAEVLRRLAVLPQRVQELRRASARAGAIAALSRAKAFLPELDPADIALGYPSLKEDGTPFDQKDFAACVKIVRPVATLIGNDTDLTKYQPGYNAENQRIPTPHYEAISLVPPARKHTF
Ga0256703_10053887Ga0256703_100538872F059631MVGKKPNVTWLEGAFVESVKGWQSGWFYITELRDPKWAAAPEFRSGTPMQLTSWKEKGLLWGSSEELTGLQSCLQTLVNKKLKLVNVIQVMLVRRILPCQQRAFNLWEFDPAQHRTLSGLFDTTYEAAWRVLFKGGEAPASATEDCGFSTKRPAGEVSHVILYGTLISFIV
Ga0256703_10055560Ga0256703_100555601F006835MIDQSNESNAVDSHHLVFTAWPSRAGIGKEVYYTKCLTEGHPCLIAFDYGSENNVVSQRLVEKLQLPATFHL
Ga0256703_10057985Ga0256703_100579851F038084VVWYTHVFKNFPQFVVIHTVKGFGIVNKAEVDVILELSCSFDDARDVDNLISCSVAFSKSRLNIWKFMVHVLLKPDLENFKHYSASV
Ga0256703_10059864Ga0256703_100598641F083289RSRKIALDCKEGDASYGESVCATEELKFYKENVDPTDMTPLKKPTTEHDPTLHFKPADETKLVDFVPGDSSKQFSISTNLDPK
Ga0256703_10060891Ga0256703_100608911F033854MTAEVQSDKMVSNMDVQVKQRCVIEFLHAENMAPTDIHCCLLNFYGDQTV
Ga0256703_10061860Ga0256703_100618601F067310LQEGKKSAARCGADVVLSLVRVHCKDAREDKLASLKVANTKKHDFRSFMETFIAAATRIVDGIDLDQFVAPSSPPPEE
Ga0256703_10062104Ga0256703_100621041F086390FPAIHYFALFIGRCINGKDEACHMCVPDLNVLRSAVLGDKHYNLGAIVARRLHNNIFNGDFFGGIYATRVANYLGIHVHENVRDLPPAYLDYNAIVRHQFVERNNQFLQYRLIFDRRCTYHVALPAPTFFDFQTKGRYVITREEANEYEKMTEAARLQAIARQAVADGSQYDPSLNIG
Ga0256703_10062652Ga0256703_100626521F093003MATASSLEKKKQQLRADQDLLADKWTEVLVAEEYELERPSKSYPKRRLLPQLEEEALDAADRPPRGRDREASRPSTQAAPRTKAREYAPDIRDMLEDKARQTRSIYGSRRHPTARDDNRHAGHKFGRAEHSRQSSLELRQNIAQYRGAAHPLCFTDEVMDHQIPEGFKPVNIESYDGTIDPAVWIEDYLLHIHMARGDDF
Ga0256703_10065183Ga0256703_100651831F035626MAPSIINNNAVQGETFLPGQIFMFGGFALRANSLGHLEQIDSHAPGHQIRFGKLNYTADIHGDLIFDGFGHEPGAPNNYDGHELDLRSDDARDITPAV
Ga0256703_10072948Ga0256703_100729481F096316WVEKDHNDHSVPTPCYVQGHQPADQAAQSHIQPGLECLQGWGIHSLLGQPVQCITTL
Ga0256703_10074470Ga0256703_100744707F004815LQAFKARLDVALGSLVCWLATLHIAGGWDWMITVILFNPGHSMIL
Ga0256703_10074648Ga0256703_100746481F004815LQAFKARLDVALGSLVCWLATLHIAGGWNWMGIVVIFNPCHSVIL
Ga0256703_10076845Ga0256703_100768451F004815LQAFKARLDVALGSLVCWLATLHIAGGWNEMSVMVLCNPGHSMIFS
Ga0256703_10078277Ga0256703_100782771F020828LTEKVFLSQYAEAGHPVPLSDQLKQLVELHKVAEQAVKGLIVRQWPREAMPGSYFGLVRRLVDACPWVEVIKRSACIEGARRALARAKVHWGKMDAEKLVTDAPPPGKEYRTPEMYYKSVLKGARTIAAECSNNVIFE
Ga0256703_10078468Ga0256703_100784681F043815AEMVCTRILAATIFAYRKTSKFPVISYRSKWPAGSKSEWFYVKVDEDEDKLVQSPLELTFGETRPQCNMIMGSPSQTALAEFRVISDHIGTRDLVQDFLAFKVFPTLREWEMPKLEGEKKKGELVRLPYHYKFKKHFKEPCQEWLDTIEIMCNDILDNYSKKEDQLMTAAFSSRLKRRLNRVLD
Ga0256703_10079013Ga0256703_100790131F004815LQAFKARLDVALGSLGCWLATLHIAGGWNWMSIVVLFNPGHSRIL
Ga0256703_10079158Ga0256703_100791581F068298LEWAAQRGGGVTDPGGVQRTFGYCVEGHGLARTTGDG
Ga0256703_10080233Ga0256703_100802331F005658HRMAWVEKDHNAHPVPTPCYVQGCQPADQAAQSHIQPGPECLKPQNPKK
Ga0256703_10080896Ga0256703_100808961F004001RKSSEAVAQLPREVVQSPSLEVFQNCVDMTVRDVVSGHGDDGLMVGLGAPGGLFQP
Ga0256703_10082180Ga0256703_100821801F004001VVESPSVEVLKNHGDVALRDVVCGHGWDGLTVGLGDLRGLFQS
Ga0256703_10083414Ga0256703_100834142F004815DVALGSLGCWLVTLHIAGGWNWRSTVGLFNPGYSVIL
Ga0256703_10083883Ga0256703_100838831F067310RVQEWMKSSARCGADVALCLVRVHCKEVRQDKLAAIKVANTQKHDFRSFMETFIATATRIADGVDLDEFVEPASPPPTE
Ga0256703_10086684Ga0256703_100866842F004001PSLEVFQSRVDVAPRDVVSGHGGVGLTVRLRDLRDLFQF
Ga0256703_10087642Ga0256703_100876421F105149MLRKMFQGGSSRKQGPRLAMHDADEEPPRDAPVRPCEWPSENFMDRAGIKEEFNAYLRNTDLLSFEEEKCNQYHNITSTFVRRFEFSSSRNSPTVLFDLYENSYTMDLEDFTTACKLPQWGSIRDPRKSEFRDFLASITVGESRDITQA
Ga0256703_10087656Ga0256703_100876561F086390DFTTACKLPQWGSIRDPRKSEFRDFLASITVGESRDITQATIGSIHFPSIHYFALFIGRCINGKDEACHMCVPDLSILRSAVLGDKSYNLGAIIARRFHLNRFNGDFFGGIYANRIANFLGVAIREDDIQLHPAYLDFNAMLHHQFAERNELTLQYRLIFDRRRAVHITLPALALFYYQERGRYTITREEVDEHERRVEAARCHTATQQAIAAASQYDPSYYYGYPPGQ
Ga0256703_10087728Ga0256703_100877281F093003ERFKRRLMAMANSLKKKQQQLQADQDLLPDKWIEVLAAEEYKLEHPSKSYARRMLLPRLEEEAYDMADRPPRGRDREAFQPKAQPPPRRHSNKKAWGDTPDLRDRLEDKAKHSRSIYGSRGRTTLQDDKCHAGYNKSKSGRAKHSGQAPFELRRDIAQYRGATHP
Ga0256703_10087994Ga0256703_100879941F001813TDPGGVQRVFGCCAGGHGLTRTSGDGQMVGLDDPVGLFQP
Ga0256703_10090422Ga0256703_100904222F011632FITTSKLVIILLLLXKGGQALEWAAQRGGGVTEPGGVQRAFGCCVEGHGLAGTIGDGRMVGLDDPVGLFQP
Ga0256703_10094883Ga0256703_100948831F032472GLMDPSIIASDVVQGEVFLPGQIFIFGGFALRANSLGHLEQIESYAPGHQVRFGSLNYTADICGDLIFDGFEPQPSAPHCLDGYDLALQPNSALEAAPASAPTLSLEPTSPIEDEWLDTASGATISTTIEPNTIPVPCKARDSEVPDSSPDSEPPAPLPIKSDWAPIMEFTTADIFQHSPFGDILNSLKSFSLSGEPWPDYGQEGW
Ga0256703_10095058Ga0256703_100950581F035626MAPSIIARDAVQGEAFLPVQNFIFGGFTMRANSLGLLEQIESYAPGHKVRFGNLNYTADIHGDLIFEGFEPMPDAPHSRDEQDVTLPSDSVREIASAATLSINPVQVAPSESGGMDPTMEAALSVAIEPDTDSTKGRN
Ga0256703_10095462Ga0256703_100954621F001813GVQRAFGCCAEGHGLARTIGDGXLIGLDDSVGLFQS
Ga0256703_10096974Ga0256703_100969741F093003QERFKRRLMATANSLKKKQQQLRADQDLLADRWPEVLAAEEYELERPSKSYPKRKLLPRLEEESYKPSSLAHNMADRPPCGRDREASRPSIRTVPRHRSKSAKPRGNAPDLRDILEDKARQSRSIYGSHGRPTTHDDHRRAGYSNSGRAKHSRQCSLELRRDIAQYRGTAHPLCFTDEVMDHQIPEGFKPVNIESYDGTTDPAVWIEDYLLHIHMARGDDLHAIKYLPLKLK
Ga0256703_10103294Ga0256703_101032941F011632KGGQALESAAQRGSRVTEPGGVQRAFGCCVEGHGLARTIDEGWMVELDDPVGLFQP
Ga0256703_10103563Ga0256703_101035631F096316MAWVAKDHNAHPVPTPCYVQGRQPADQAAQSHIQPGLECLQGWGIHSLLGQPVQCVREEYSQLFHF
Ga0256703_10104919Ga0256703_101049192F020492MGLQAALLTSAALTAEVSALKQDLERSEQELGRAKKQLEDKEGE
Ga0256703_10106797Ga0256703_101067971F037171MYVCARIENDPVEEPEELAGEAPEQQSVGGGKCPLTYLCPIHYLIHLPLYTFMPKD
Ga0256703_10107621Ga0256703_101076211F100750LNIRVTDILEEHRIDLFIGTLKDNIQHEVHVLEPNLLEKAFRLARKIECKIMATRKPTTHFYKEGSVATPRFPQPTRLTPQKF
Ga0256703_10108652Ga0256703_101086521F005658MAWVEMDHDDHSVPTPCYVQGLQPPDQAAQSHMQPGLECLQGWGITN
Ga0256703_10109585Ga0256703_101095851F086390IGSIHFPAIHYFALFIGRCINIKDEACHMCVPDLCVLKSVVLGYKGYNLGAIVARRLQNNSRKGNFFGGIYATRVANFLNIAPREGDMIVPPVYLDKEAMFDHHFLERNEQFLHYRLIYERRNVVPVTLPAPYLFYNQAKGRYVVTREEAAEHERRA
Ga0256703_10109841Ga0256703_101098413F028669VHTWCEIKKQRFKCWSDQLITNVNKGDEERGGRTLLWIGVMGKGRQ
Ga0256703_10112489Ga0256703_101124891F001813QRGGGVTDPEGVQRAFGWCVEGHGLARTIGDGQVVGLDDPVGLFQP
Ga0256703_10113728Ga0256703_101137281F035108DRVMSVGMLTGRPAEEMPGSTGDLLPKLAQLHERVRQVMRGVAQSLWPSVSQPEGLGELAEKLKGAQRCFRLWKISACRQGAREAWAMVKTRYTKADPNHMAEVGPVGPDGKEIPVNLVYGQVELAAKYSQQDCRLDSLLGGIEEEINQSN
Ga0256703_10116588Ga0256703_101165881F015450KIKEQSATIEKKNFELQTTESFLAEAEAKVAELNTKLLCQSEQFEQEKQELNTKLEAKVQQNSDLKKLLASLQDKCLEFSNKCIQRLRKIFHSVGASSGKFTPSTEDLPKTFEHIEGEIDELDEVIAGHGDFCAWVASRGTAAAFLKAGCDHGKIVNRPNFTLSPSILDDIPDLARSISNRFVKMIWTKGGREKAGDEARSHLEPVRNHTLCLPLPSSSILTYNNLIHVG
Ga0256703_10116612Ga0256703_101166121F037171MYVCARIENDSVEEPEEFAGEAPEQQSVGGGKCPLTYLCPIHSLIHLPHYTFIPKD
Ga0256703_10119400Ga0256703_101194001F035108KKSSARKYFDMICLVGILTGRPAEEMPISMGDQLPELLQLLERVRQAMSGVVRALWPALSLPEGLGELAEKLQGVRQRFRLWKISACRQGAREAWAMVKTRYKKADPNHMAEVGPVGPVGKEIPVSLVYGQVELAAKFSQRDSKLDSLLDGIEEEYNE
Ga0256703_10121892Ga0256703_101218921F093003VPEDPVEQERFRRRLMATANSLKKKQQQLQADQDLLADRWTEVLAAEEYELERPSKSYPKCKLLPRLEEEAYKPSSPAHNTADRPPRGRDREASKPSDRAVPRHRSKSMKPRGNAPDLRDILEDKARQTRSIYGSRGRPTMSEENRHAGYSNSGQAKHSRQSSFQLRRDIAQCRGAAHPLCFTDEVMDHQIPEGFKPVNIESYDGTIDPAVWIEDYLLHIHM
Ga0256703_10128471Ga0256703_101284711F005658MAWVAKDHNDHPVPTPCYVQGRQPADQAAQSHIQPG
Ga0256703_10128512Ga0256703_101285121F011632NPGVIVLQRGGGVTEPGGVQRAFGCCVEGHGLVRTIGEGQMVGLDDPVGLFQP
Ga0256703_10130414Ga0256703_101304141F038489MAWVEKDLSGHLVSTPCYVQGRQPADQAAQSHIQPG
Ga0256703_10130530Ga0256703_101305301F086390TVGESREIIQATIGSIHFPAIHYFALFIGRCINGKDEACHMCVPDLGVLKSAVLGDKQYNLGAIVARRLHHSSISGYLFGGIYATRVANYLDIPIHGNDIELPPAYLDYNAMVRHQFVQRNEQPLQYQLMFDRRRTFHVALPAPTFFDFQAKGRYVITREEENE
Ga0256703_10130567Ga0256703_101305671F035626MASSIVNHDAVQGETFLPGKIFVFGVFALRANSLGHLEQIESYAPGHQVRFGSLNYTADIRGDLIFDGFEPMTGAPNSHDGHDFDLMSDSIREIAPALAPGINPGQIVPSEDGWMAPAMEAAHS
Ga0256703_10134642Ga0256703_101346421F005658MAWVEKDHNDHLIPTPCCVQCRQPAAQAAQSHIQPG
Ga0256703_10137456Ga0256703_101374561F094706VTIPRQLAPTVGPAHDGFEFLNDNFEGLKGYVVGRMTKSRHSKLYIDDEGWGPDAGSIEYGYRVPFGGIHVFIGRIGEPGPEPDSCTDLVETAQRAKPARAQPVVKRAFVGCIHGAELSEGSEGDGEPAVLSDDDSSAGSTDSLYQVQDGVLG
Ga0256703_10137913Ga0256703_101379131F038489MAWDEKDHNDHLVSTPCYVQGHQPAAQAAQSHIQP
Ga0256703_10137983Ga0256703_101379831F034384FCQNFEEETSRVEPNLDPVNSPVNDEVAMDVFRLESRVAAVVDYLARLKAATSRIDSTLWPEETLQNDLESLMARLNTIPGRVQEWKKSSARCGADVALCLARVHCKDAREEKLAALRVANTKKHDFRSFMETFLAAATRIADGIDLDEFVAPSSPPQEG
Ga0256703_10138054Ga0256703_101380541F035108NVSLGVLTGLPAEEMPGSTGDQLAELVQLLERVRQAMSGVVQALWPSISLPEGLGGLAEKLQGVRRRLRLWKLSAYRQGAREAWAMIKTRYTKPDPNHMAEVGPMGPDGKEIPVSLVYGQVELATKYSQQDCKLDRLWDGIAEEYTESD
Ga0256703_10139289Ga0256703_101392892F002002VTQLVKDPPAMQKTWVLSLGREYVLEKETVTHSSILAWRIPWTEESAGLQSMGFQRIGHD
Ga0256703_10141318Ga0256703_101413185F011632ALEWAAQRGGGVTEPGGVQRAFGCCVEGHGLASPIGDGRMVGLDDPVGLF
Ga0256703_10142628Ga0256703_101426282F006329KEKIRKIEGEKMILELHVKDVVNDHKIKMYAMRLKIKKIRKYAIHTEAWYHYAVGSIVTLVAIMIAFVVALKCFT
Ga0256703_10143960Ga0256703_101439601F005658MAWVAKEHSAHLIPTPCYVQGRQPAAQAAQSHIQPGLE
Ga0256703_10144888Ga0256703_101448881F011632GQALEWAAQRGGGVTEPGGVQRAFGCCVEGHGLARTIGEGQMVGLDDPFPTLAILXFYN
Ga0256703_10146215Ga0256703_101462151F027342LQYFVQKYESLECDSKTQESELSKALQSAQDAKAEAHKALQEIETTKKIMASKAFIMQSNHVKETFLLLTRIRSSPGAFADLPHSISDGAEFYNAEEGSSTEKLFWSQYIGAEHPMTLSDQLKQLVELHKAAELAMKDLIVRLWPVEPLPSSYFGLVKRLVSACPRLEVIKQSVCIECARRAFARAKMHWAKLDAEKLVKDGPPEGKEHRYPEKYYDGIMKGARLVADECTKDIIFE
Ga0256703_10147387Ga0256703_101473873F011632AQRGGGVTELVGVQRAFGCCVEEHGLAGTIGERRMVVLDDPVGLFQP
Ga0256703_10149411Ga0256703_101494112F001813AQRGGGVTDPGGVQGLFGCCVEGRGLARSIGDGWVVGLGDPVGLFQP
Ga0256703_10150297Ga0256703_101502973F001813AQRGGGVTNPGGVQGTFGCCVEGHGLVRTIHDGCMVGLGDPGGLFQPW
Ga0256703_10151835Ga0256703_101518351F038084VSGEEISVGTPVILFVDIWEQESSQVVWYSHLLKNFPQLVIHTVKCFGIVNKAEIDVFLELSCFLDDPMDVGNLISGSSAFAKSSLNIWKFMVHILLMPGLENFEHSFTSM
Ga0256703_10153967Ga0256703_101539671F076748MRFIQLPRDSTPLYVSKSSFLQSDSSLFDRYDEEAVIFPSWKTGIT
Ga0256703_10154276Ga0256703_101542762F079404GGAEVWRIAGTKYLSGTPKKASKDWPSEWFYKEDVPLPEPVGTGLPEFDSAPLKKRLSWRPRSPRKESDKDILYLMDRIRLLAHSGLTMIGVMAACIMRGVQPLQYRSHPMWDFNGEDDATRCGRKGPGSVADLTKILSALYKAEEEEFLRINPQGGFSMNNPPSWVSGHLFLPI
Ga0256703_10157960Ga0256703_101579601F057793MAKKSVTPSIRMDEDVYQKLKALKEERRISWNELIKHTNELLSEEMEKSGK
Ga0256703_10158555Ga0256703_101585551F100750DILEEHMIDVFIGNLKNNIQHEVCLWEPDSLEKKFKLARKFECKIMATRKPTTHIYKDGSVATPRLPQPTRFTPQQLEEKRAKGLCYNFDSK
Ga0256703_10162303Ga0256703_101623031F079404QVDGAEIWRIAGTGYPSGTPKKASEDWPSEWFYMEDAPLPDPVRIGLPEFSNAPLKKRLSWRRRSPQREDDRSVNYLMGRIRLLAHSGLTMIGIMATCIMRGVQPLQYRGHPMWDFNGEDDATRHGHRGPGSAADLAKIISRTKI
Ga0256703_10166863Ga0256703_101668631F035108MKYENKSLARKSIDRVMSVGMLTGRPAEEMPDSTGDLLPELSQLHERVRQVMQGVAQALWPYVSMPEGLGELAEKLKGVRRRFRLWKISACRQGAREAWAMVKMRYTKADPNPMAEVGPVGPDGKEIPMSLVYGQVELAAKYSQQDYRLDILLDGIEEEFNQSN
Ga0256703_10168158Ga0256703_101681584F068298LELNFKKLEWAAQRGGGVTDPGGVQRVFGCCVEGHGLVRTIGDG
Ga0256703_10168381Ga0256703_101683812F035108MLTGRPAEEMPGSAGDLLPELSQLHEQVRQVMQGIAQALWPSDSLPGGMGEVVEMLKGARRRFRLWKISACRQCAREAWAMVKTRYTKADPNHMAEVGPVGSDGKEIPVSLVYDQVKLSAKYSQQDCRLDSLLDGIEEEFRQCK
Ga0256703_10173135Ga0256703_101731351F005658MAWVEKAHNAHPVPTPRYVQGHQPAAQAAQSHIQPG
Ga0256703_10173732Ga0256703_101737322F004001VESPSLEVFKNCGDVALRHVVSGHGGDGLMVGLDDLTALFQPI
Ga0256703_10180339Ga0256703_101803391F013401REWDSDESSTDSSDDEDAANITVNKGLLFPNVVHKCLMIKDGKKKVKSKSSTRYESSSDENASDEEDNLRTLFANLNMQQKEKLNELISAIHEKDDLLDTQEDFLIKENKKHVKVKNAYALKVEKCEKLSSELSTCHDVITNLRNENANLLAKVDSIACNVSIPNLRNNNDDLLARNEELNISLASLRLGNENLIAKARDLDVC
Ga0256703_10182705Ga0256703_101827052F010678SEKEEQEAQHYAQKLKYPKGALIFNGSGEEDFLYCLPDSKEISVCREMSRSFGFPTLEDGLSVLSKNDLADSLAYNSLKVRQMKSLYFC
Ga0256703_10183270Ga0256703_101832702F020492MHVQATLLASAALTAEVDTLKQDLERSEQELERAKKQLEDNEGKKYLFKYI
Ga0256703_10184516Ga0256703_101845163F005658MAWVEKDHGDHPVPTPCYVQGHQPPAQAAQSHIQPGTECLQGWG
Ga0256703_10186080Ga0256703_101860801F038012MIIEFQPPCYVQGRQPPDQAAQSHIQPGLECLQGWGIHNLFGQPVPVHH
Ga0256703_10189983Ga0256703_101899831F052316MVKTRYTKLDVNHMARVGPRGSDGQEIPVSLVYDQVKVAAKYSQHDCKSDSLLDDIEEEIFESK
Ga0256703_10193216Ga0256703_101932161F001813TDPGGVQGTFGRCVEQHGIKRTIGDGWMVGLGDPVGLVQLW
Ga0256703_10197317Ga0256703_101973171F011632GGQALEWAAQRGGGVTEPGGVQRAFGCCVEGHGLAGTSGEGRMVGLDDPVGLFQP
Ga0256703_10199668Ga0256703_101996681F068298HWKWAAQRGGGVTKPGGVQRTFGCCAEGDGLVRTIGEG
Ga0256703_10205134Ga0256703_102051341F094706LKGSFEGLNGYAVGRMTKSHRGKLYIDDVGWGPDAGSIEYGYRVPFGGIHVFIGRISEPGPEPDICTDIVEMAQRARPARTQPAMKRAFVGCIHGGEFSEGSVSGGETAIYCDGESSTGETDSLYQLQDGGLGGCSSGSSIPDPF
Ga0256703_10205740Ga0256703_102057401F052316ISACRQGAREAWAMVKTRYPKADPNHMAEVGPAGPDGKEIPVRLMYGQVELAAKYSQHDCKLDSLLDGIEEEYNQ
Ga0256703_10209686Ga0256703_102096861F004001VESPYLEVFTNHVDEALRDGVTGHAADGLMVGLDDLRGL
Ga0256703_10211708Ga0256703_102117081F038084VIHTVKGFGIVNKAEVDVFFLEIACFFDDLADVGNLISGSSAFSKSSLNIWKFTVHILLKPGLENLEHYFTSV
Ga0256703_10215888Ga0256703_102158882F020492MQASLLASAALTAEVDTLKQNLARSENKLGHAKRQLEEKEGK
Ga0256703_10215902Ga0256703_102159021F001813VQRAFGCCVEGHGLGRTIGDGWMVGLGDPVGLFQPW
Ga0256703_10215986Ga0256703_102159861F005658MAWVEKDHSAHPVPTPCYVQGRQPPDQAAQSHIQPGLE
Ga0256703_10216082Ga0256703_102160821F032472VSSPLGLMAPTIINGDGVQGETFLPGQIFVFGGFALRANSLGHLEQIESYAPGRQVRFGSPNFTADIRGDLIFDGSEPQPSVLRCHDGHDLTLPPDSTLEAAHESAPTHSPEPIAQIEDGWLDTASGAATSTAMEPNTYLVPHKAHDSEVPDSLPDSEPPAPLPVESDWAPIMEFTAADIFQHSPFGDILNSLKHLSLSGEPWPNYGQ
Ga0256703_10218168Ga0256703_102181682F001813CVQRAFGGCVEGHGLARTIGEGRMIGLDDPVGLFQP
Ga0256703_10219960Ga0256703_102199601F004815LQAFRARLDVALGSLVCWLATLHIARGWDWMSVVLLFNPGHSMVL
Ga0256703_10221159Ga0256703_102211591F004815FKARLDVALGSLVCWLATLHIAGGWNWMSIVVLFNPGHSRIL
Ga0256703_10221328Ga0256703_102213281F004815FKARLDVALGSLGCWLVTLHTAGGWNEMSIVGLFNPGRSVIL
Ga0256703_10222557Ga0256703_102225571F001813WAAQGSGGVTDPGGVQGMFGCCVEGHGLVRSIGDGWMVERGDPEGHFQP
Ga0256703_10223079Ga0256703_102230793F038012MSIYFQPPCYVQGHQPPDQAAQSHIQPGLECLQGWGIHNLLGQPVPVKSLKSS
Ga0256703_10223706Ga0256703_102237061F001813GVTDPGGVQGTFGRCVEGYSLVRTIGDGWMVGLGDPMGLFQP
Ga0256703_10225847Ga0256703_102258471F011632WAAQRGGGVTKPGGVQRVFGCCVERHGLARTIGEGRMVGLDDPVGLF
Ga0256703_10229055Ga0256703_102290552F076912MQTKYWRRAPPLCNGRESNPDKVQDSETTLLVSKKGDKNDLVDSEQTPQSCVDVVFELLATTAGTSSSNSLPELVRLLESQLQVERHRSDVLRQEAEGLRKYLQNSDAYFLVQQQVLEDLSAK
Ga0256703_10230897Ga0256703_102308971F004001VESPSLEVLENCVDVALKDVVSGHGWDGPIVVLDDLRSLFQP
Ga0256703_10233804Ga0256703_102338042F011735HGPYTIKRVLEKGAYELVDHEGCPLREPRNGLYLKRYFA
Ga0256703_10235913Ga0256703_102359131F004815FVISGIGMGLDVALGSLVWWLATLHIAGGWNEMVTVVVFNPGHSVTL
Ga0256703_10236801Ga0256703_102368012F027342VVKKIAAGKAFIMQSKHVKVNYLLLTRVWSSPGAFADLPRSASDVAAYYRAEEGSSTEKVFWSQYAEAGHLVPLSDQLKQMVELHKVAEQAIKGLVVRLCPGGALPGSYFGLVRRLVDACPRLEVIKRSICIEGARRALARAKVHWGKMDAGSW
Ga0256703_10240498Ga0256703_102404981F001813IQGTFGCCVEGHGLARTTGDGWMVGLGDPVGLFQLW
Ga0256703_10241155Ga0256703_102411551F038489MDGVEKDHNDHLVSTPCYVQGRQPADQAAQSHIQP
Ga0256703_10242978Ga0256703_102429781F027342EALELDSKTRKSELAAALESAKNAKAEAQKALQEIEEMRKIAAGKAFNMQSKHVKVNYLLLTQVRSSPGAFADFPRSVSDAAKFSQAKDGTSIEKLFWSQYTGTEHPMPVSDQLKQLVELHKAAEQAMRGLIVRMWPSEPLSGSYFGLVRRLPDACPWLEVIKRSVCTEGARRAFTRAKCTGQRWMPRSW
Ga0256703_10244697Ga0256703_102446972F104139CQPLNELWEGVDPGSSPSSHSDALHTPELPWVGPAFLSGPQSLLQTVT
Ga0256703_10250770Ga0256703_102507701F004815APSLDVALGSLGCWLATLHIAGGWNWMSVVVFFNPGHSRIL
Ga0256703_10250991Ga0256703_102509912F020492MRMQASLLASAALTTEVDTLKQNLERSEQELGRAKKQLEDNEGKKYLV
Ga0256703_10251460Ga0256703_102514602F028669MYAWREIKKQRFKCWPDQFITNVNKGDEERGGRTLLRIGVMGKGRRAIEKIERGKNCVKR
Ga0256703_10253936Ga0256703_102539363F013050MSKGKQPRTRVKVPKLLLSEIKKVFIKVNKEIGLEAAII
Ga0256703_10254671Ga0256703_102546711F104139LNEIGEGVDPGSTPSSHSGSLHTPEPSWIGSALLPGAQSLFEAVT
Ga0256703_10255430Ga0256703_102554301F032472LLQSGLDAQFGTPYPRSAGFDTDIGAFIESSSVPTSSGPMAPTIINSDAVQGEAFLPRQIFVFGGFALRADSLGRLEQIESYAPDLQVRLGSLNYTADIRGDLIFDGFEPLPSALHCHDEHDLTLLPNGALEGAPAPAPTLSSEPTAPIEDGRLDATSGAATPMAIEPNTSLVLYETRDSKEPDSSPDSKPSTPLPNESEWAPNMEFT
Ga0256703_10255515Ga0256703_102555151F004001VLAQLPREVVESPSLEVFKSCVEVALRNLVSGHGGVELIVKLGDLS
Ga0256703_10256465Ga0256703_102564651F004815FKARLDVALGSLGCWLATLHIAGGWNWMSIVGLFNPGYSRIL
Ga0256703_10256699Ga0256703_102566991F005658MAWVEKDHNAHPVPTPCYVQGRQPPAQAAQSHIQPGL
Ga0256703_10258194Ga0256703_102581941F027342LDSKTRESELASTLESAKSAKAEAQKALQEIEAMKRIAAGMAFFMQSKHVKVNYLLLTRIRSSPGAFADLPRSVSDAAAFYWAEEGSSTEKVFWSHYAEAGHLVPLSDHLKQLVELHKAAEQAMKGLIGRLWPGEVMPLSYFGLLWRLVDACPRLEVIKRSVCIEGAHRAFARAKVHW
Ga0256703_10258233Ga0256703_102582331F092835MNPGVHLCVFRQHSQFWPILTCFVDYYSRFWGPDAISIVVELQDVLTCGSSTLAVLAHSAPFHGLLLTV
Ga0256703_10264615Ga0256703_102646152F001813GDGVTKPGGVQRAFGCCVEGHGLARTIGEGRMVGLDDPVGLFQP
Ga0256703_10270809Ga0256703_102708091F105149MFRKMYQCGPSRKQVPRLAMRDADDEPPRNAPVRPCEWPSEGFMDRVGIKEEFNAYLRNADLVSFEADKCRQCLYLTDSFVRRFKFSSSRNSQTVLFDLYENSYTMDLEDFNTACELPSWGSVRDPPKSEFINFLASITMGESRYITYATIGSIH
Ga0256703_10274166Ga0256703_102741662F004815SLQAFKARLDVALGSLVCWLATLHIAGGWNWMSIVVLFNPGHSMVL
Ga0256703_10280559Ga0256703_102805593F001813VQGMFGHCVEEHGLVRTVGDGWMVGLGDPVGLFQPW
Ga0256703_10281460Ga0256703_102814601F001813VQRAFGCCVEGHGLARTIGEGXMVGLYDPVGLFQP
Ga0256703_10287142Ga0256703_102871421F020289VVVWHHQLNGHEFEEAPGVGDGQGGLVCYSLGGHKELDATELNRT
Ga0256703_10290158Ga0256703_102901581F094706VTNPRQLAPTVGLSHDGLTILEGKLKGLEGYAVGQMTKSRRGKIYIDDAGWGPEADSIEYGYRVPFGGIHVFIGKIGEPGPEPDICIDPVKTAQRARSTQAKPAVTRAFVGVIHGGGREDESEHGSEAVVYSGDESSTGETESLYQLQDDQVRGCSDGDSIPDPPGQINRVGIFMAGTQAANHSSTAAAM
Ga0256703_10291517Ga0256703_102915172F038012MIINFQPLCYVQGRQPLDQAPHSHIQLECLQGWGIHNLLEQPVPV
Ga0256703_10291695Ga0256703_102916951F011632QRGGGVTEPGGVQRAFGCCVEGHGLVRTIDGGRMVGLDDPVGLFQP
Ga0256703_10293605Ga0256703_102936051F076912MLCNGKGSNANKVQDSETFLLVCNKADKIAKENYLDDSETTPKSFLDVVCELLATTAGTTSSNSLPESVWLLGSQLQVERHRSDVMRQEAEGLRKSLQNLDAYILVQQQALEDLSAKQEKVNKLAKHLASIMGTQDIVS
Ga0256703_10294668Ga0256703_102946682F081962VVTKLKAVYTLVEQLYTGSQRALAVVALSNEVPTHLAEVLRRLAVLPQRIQELRRASARAGAIAALSRAKAFLPELDPADIALCYPSLKEDGSAFDQKDFAACVKAVRPVATLIGNDTDLTKYQPGYDAENQRIPTPRYEALNLIPPARQHTFAPEIDPAGLIDAEAQFKALSGID
Ga0256703_10297511Ga0256703_102975111F035108KSSARKLADRVMSVGMLTGRPTEEMPSSTGDLLPELAQLHERVRQVMQGVAQALWPSVSIPEGLGELAEKLKGAWRHFRLWKISACRQGAREAWAMVKARNTKADPNHMAESGLWDLTTRRSL
Ga0256703_10297751Ga0256703_102977511F035108MLLGHPIEEMPGSTGDLLLELSQLHEQVRQVMQAIAQALWPSASPPGGMGELIEKLKGARRHFRLWKISACRQGAREAWAMVKTRYTKADPNHMAEVGPVGPDGKEIPVSLVYDQVKLAAKYSQQDCRLDSLLDGIEEEFSQSK
Ga0256703_10298000Ga0256703_102980001F079404KASEDWPLKWFYMEDAPLPDPVRIGLPEFSNAPLKKCLSWRPRSPQPEDDRSVHYLMGRIRLLAHSGLPMIEVMATCIMRGVQPLQYRGHPMWDFNEEDDATRHGRKGPGSAADLAKILSGLYKREEEDFLRTNPLNGFSMNNPRSWVSGCSSTRSILSKSSILLCDFDAGAAPGHGGYTKPNSTARGSGTIP
Ga0256703_10300783Ga0256703_103007831F067310ARLNTIPGRVQEWKKSSARCGADVALCLARVHCKDAREEKLAALRVANTKQHDFRSFMETFLAAATRIADGIDLDEFVAPSSPPQEG
Ga0256703_10304195Ga0256703_103041951F094706RTRQLAPTVGLTHGGFEFLKGSLEGIKGYAMGRMTKSRRGKLYIDDEGWGPKAGAIKYGYRVPFGGIHVFIGKIGEPGPEPDICTDLVETAQRARSARVKPVMKRAFVGVIHGGESEDRSESGGETVVYSGDESSTGETESLYQLQDGRIGGCSEGDRIPDPFDPPNRVAIFMAGTQPTVQSSSTAAMISGVAAAAGGPARLPTQVLAGLLDALRALLTTAVTPET
Ga0256703_10304545Ga0256703_103045452F032472MDSLINNHAVLGETFLPGQIFVFGGFALRATSLGHLEQIESYAPGRQVRFGSLNFTADIRGDLIFDGSEPQPSMPRCHDGHDLTLPPDSTLEAAHESALTHSPEPIAQIEDGWLDTASGAATSTAMEPNTYLAPHKAHDSEVPDSLPASEPPAPLPVESDWAPIMEFTAADTFQHSPFGDILNSLKHLSLSGEPWPNYGQDGRDADNGKIQNPPTTHFVATVDDLTDVLNYDS
Ga0256703_10304887Ga0256703_103048871F032472PMASSTSNAVQGETFLPGQIFVFGGFALRANSLGHLEQIESYAPGRQVRIGSLNFTADVRGDLIFDGLEPQPSAPHCDDGHDLALPPNSALVAAQESAPALRPEPIAQIEDRWLDTASGAPTSTTMEPNTNLVPCEARDFEVPDSLPDSVPPTPLPIGSDWAPVMEFTATDIFQHSPFGDILNSLKHLSLSGESWPDYGQDIWDTDDEEIQSPPTTHFVDTVDDLTD
Ga0256703_10308136Ga0256703_103081361F006329EKMILELHVADVVDDHMIKMDAVRLKIRKIRKYVIHTEASYHYAIGSVVTLVAIMIAFVFALKCFT
Ga0256703_10308403Ga0256703_103084031F005658MAWVEKDHSAHPVPTPCYVQGHQPADQAAQSHIQPGLE
Ga0256703_10309382Ga0256703_103093821F094706LSFLAAMAPRLSPCMSTSAVTIPRQLAPTVGLAPGGFEFLKGSFEGLKGYAVGRMTKSHHGKLYINDAGWGPHAGSIEYGYRVPFGGIHVFIGKIGEPGPEPDIGTDLIETAQRARPARTPPALKRAFVGCIHGGLSEGSRSSDETAICSDDESSTGETDSLYQLRDGRLGGCSDGNSIPDPFEPPSRVGIFMAGAQPVTSYVQARKY
Ga0256703_10309594Ga0256703_103095941F020828AMKGLIVRLWPGEAMLGSYFGRVRRLVDACPWVEVIKRSACIEGARRALARAKVHWGRLDAERLITDAPPAGKEYHTPEMYYKTVLKGARKIADECPKDVIIE
Ga0256703_10310897Ga0256703_103108971F105149VRACEWPSEDFMDRAGIKEEFNAYVRNADLVSFEADKCRQYHYLTDSFVRRFEFSSSRNSQTVLFDLYENSYTMDLEGFKIACKLPEWGSPNEPCKSEFRDFLASITVGESRDITQSTIGSIHFPAIHYFALFIVRSINGKDEACHM
Ga0256703_10311208Ga0256703_103112081F007510AVQGVAKSRTQLSDFPFTFHFHALEKEMATHSSVLAWRIPGTGEADGLPSMGSHRVGHD
Ga0256703_10313933Ga0256703_103139331F035626MAPTIINGDAVQGETFLPGQIFVFGGFALRANSLGHLEQIESYAPGRQVRFGSLNYTADIRGDLIFDGFEPPLSTPHYHDEHDLALPPNSALEVAPASAPTLNSEPTAPIEDGWLDTASVAAISTAIEPNT
Ga0256703_10317753Ga0256703_103177531F067310MARLNEIPDRVQQWKKSSAQCGAEVALSLVRVHCKEAREDKLAAIEDANPKRHEFPSFMETFIAAATRIADGIDLDQFVAPSSPPPEE
Ga0256703_10323915Ga0256703_103239152F052316MVKMRYTGLDPNHMARVGPVGSDGQEIPVSLVYDQVKIAAKFSQEDCKLDSLLDGIEEEVFESK
Ga0256703_10325057Ga0256703_103250572F035108MSAGMMTGRPEEEMPGSAGDLLPELSQLHEQVRQVMQGIAQALWPSVSLPEGIGELAEKLKGARRRFRLWKISACRQGAREAWAMVKTRYTKADPNHMAEVTPVGPDGKEIPISLVYGQVALAAKYSQ
Ga0256703_10325855Ga0256703_103258552F105149MSRKMYQGGSSRKQAPRRAMREQDDEPPREADARPCECPSEEFMVNAGIKDEFDACVRNANLEDFMQDKCPQYYYLTDSFVRRFKFSSTRNSQSVLFDIYDQSYTMDLEDFTTACKLPQWGSVIEPRKSEYRDFIASITVGKSRDIARATIG
Ga0256703_10328521Ga0256703_103285211F004001VQSSFLEAFKKCGDVALRDVVSGHGGDGLMVGLGNLSGLFQP
Ga0256703_10329143Ga0256703_103291431F038084MNHTVKGFGIVNKADVFLEFYGFFNDLVDVGNLISGSSAFSKPSMNIWEFMVHVLLKAGLENFEHYFASM
Ga0256703_10329493Ga0256703_103294931F059631HVTWLEGTFVETIKGWQSGWFYITKPRDPEWAAALEFRSGIPTRLTSWKESGRIWGDSEELTGLQACVQKLVDKKLKLVNVVQVILIRQILPCQRRGFNMWEFDPAQHQTLSWRFDTTYEDVWKVLFKGAEAPASAIEDRGFSS
Ga0256703_10335219Ga0256703_103352191F006329LKEKIKTIEEEKMTLELYVADVIDDHKMKMNAMRSKMDAMRLKLKKIRKYAIDNEAWYHYAVGSIVTLVAIFIIFVVMRVSFL
Ga0256703_10339503Ga0256703_103395033F028669MYARHEIKKQQLKCWSDQFITNVNKGDEEREGRMLLQVRVKGEGRKAIAKNRKEVRIV
Ga0256703_10343096Ga0256703_103430961F028669MYARCEIKKQRFKCWSNQFITNVNKGDEERGGRTLLRIGVMGKGRRAIEKIE
Ga0256703_10343582Ga0256703_103435821F027342MKKIAAGKAFYMQSKHVKVNYRLLTRIRSSSGAFADLPRSVSDAAQFYQAEDGSSTEKLFWSQYAEAAHPVPLSDQLKQLVELHKVAEQAMKGLIVRLWSGDALPNSFFGLVRRLVDACPWLEVVKRSVCIEGARRAIARVKTQWVKLDDVKLLKEGPPEGKEPRHPQMYYEGVLPGA
Ga0256703_10343602Ga0256703_103436021F034384DYLARLKVAVSWIDTALWPRVTFQNDLESLMTRLNEIPGRVREWKKSSARCGSDVALPLVRIHCKEAKEEKLAALKVANTKKLDFQSFMETFIAAATRIADGIDLDKFVEPPSPPPAE
Ga0256703_10343708Ga0256703_103437089F004001VVESSSLKNCGDVALKDVVSGHAEGGLVVGLGDLGDLFQSQ
Ga0256703_10349184Ga0256703_103491841F020828DQLKKLVKLHKAAEQAMKGLIGRLWPGEVMPLSYFGLVRRLVDACPRLEVIKRSVCIEGARRAFARAKVHWGKLDAEKLVTEGPPEGKEHRRPEMYYEGVLKGARLVANECSKDLLFE
Ga0256703_10349656Ga0256703_103496561F038012MTIEFQPPCYVQGHQPPDQAAQSHIQPGLECLQGWGIHNLL
Ga0256703_10351552Ga0256703_103515525F011632AQRGGGVTEPGGVQRAFGCCVEGHGLVRTIGEGRMVGLDDPVGLFQPQ
Ga0256703_10351634Ga0256703_103516341F092835SGDPERYPRLMSPGVRLYVRRQYSQFWPNQTCFVDYYSLFLGPEEISIVVVPQGVLTCWSSTLPVLADFGPFHGLLLTVLRSRRDFHSC
Ga0256703_10352239Ga0256703_103522392F033854MAPEGQCYRMASDMEVCVKQRYGIEFLHVEKIVSTDIHQCLLNVYEDXTAEVSTVRQ
Ga0256703_10353804Ga0256703_103538041F010678SESAKVESLEAEKTEIAEQILSEETGTAALEASSKIRDYIVRHASGKKLSEEEIFEANHYARELKYPKGALVFNGTDEDDFLYCLPDNKELSVCREMARSMGFSKLEAGLCAMTKDDLADSLAYNSLKVQKLYI
Ga0256703_10354448Ga0256703_103544481F035108MSVGVLTGHAAEEMPGSTGDLLPKISQLLDRVRQAMRGVAQALWPSVSMPEGLGELAEKLKGARWCFRLWKISACRQGTREAWAMVKTRYSQADPNHMAEVGPVGPDGKEIPVSLVYGQVELAEKYSQQDCKLDNLLDGIEEEYSQSK
Ga0256703_10354785Ga0256703_103547851F038012MTISFQPPCYVQGRQPADQAAQSHIQPGLECLQGWGIHNLL
Ga0256703_10361762Ga0256703_103617623F011632GGQALEWAAQRGGGVTEPGGVQRAFGCCVEGHGLARTIGEGRMVGLDDPVGLFQP
Ga0256703_10363794Ga0256703_103637941F059631KGWQSGWFYITEQRDPEWAAASEFRSGIPTRLTSWKETGQSWGNPEEATGLQTCVQNLMDKKVKLVNVVQVMLFRRILPCQRWAFNLWEFDLAQHQTLSRLFDTTHEDAWKVLFKSSEVHPPTTEDRGFCAKRQASVVSSIFPLQGICFP
Ga0256703_10366289Ga0256703_103662891F005658MAWVEKAHNAHPVPTPCYVQGRQPAAQAAQSHIQPGL
Ga0256703_10366600Ga0256703_103666001F027342QIRSSPGAFADLPRSASDAAAFYRGKEGSSTEMVFWSQYSEAGHPVPPSDQLKQLVELHKVAEEAMKGLIVRLWPGQAMPGSYFGLVRRLVDACPWVEVVKRSACIEGARRALARIKVQWGKRDAEKLLTDLPPPGKEYRMPEKYYKIVLKGACDIADECSRNVIFE
Ga0256703_10366718Ga0256703_103667182F096317VNKQGSLLAATAATAKVSELRPNLGWAEEELGLVKRQLEENKGK
Ga0256703_10367914Ga0256703_103679141F096316MAWVEKDHNAHPVPTPCYVQGRQPADQVAQSHIQPGLECLQGWGIHSLLGQPVQCVTTLWVKNFLLI
Ga0256703_10368612Ga0256703_103686123F007510YSCLENPMDRGAWKAAVHGVAEGPTRLSDFTFTFHFHALEKEMATHSSVLAWRIPEMGEPGWLLSMGSHRVRHD
Ga0256703_10369066Ga0256703_103690661F001445VKSQTRLSDFPFTFYFHALEKEMATHSSVLAWRIPGMGEPGGLPSMGSHRVGH
Ga0256703_10371595Ga0256703_103715952F004815ARLDVALDSLVWWVAALHTAGGWNEMSTVGLCNPGHPMK
Ga0256703_10371684Ga0256703_103716842F053764MVNTEIRLIVFFAAKDEEALYSQQKQDRELTVAQIMNSLLANSDLK
Ga0256703_10372562Ga0256703_103725621F001813DPGGVQGMFGFWVEGHSLVRTIGDEWMGGLGDPGGPFQP
Ga0256703_10373134Ga0256703_103731342F005658MAWVEKDHNDHLVSTPLLRAGLPADQAAQSHIQPGLECLQGWSIHS
Ga0256703_10374120Ga0256703_103741202F096317MNKQALLLTAAARTAEVAGLKHELGQTEEELDLVKKQLEENKGK
Ga0256703_10375370Ga0256703_103753701F027342IEAIKKIAAGKAFFMQSKHVKVNYLLLTRIRSSPGAFADLPCSVSAAAVFYQAEEGSSTEKVFWFQYAEAGHPVPLSDQLKQLVELHKVAEQAMKGLIVRLWPREAMPGSYFGLVRRLVDACPWIEVIKRSVCIEGGRRALAHAKVHWGKLDAEKLLTDAPPPGKEYRTPEMYYKGVLKGECSKDVIF
Ga0256703_10378760Ga0256703_103787602F005658MARVEKDHSDHVVSYPCYVQGRQPADQAAQSHIQPGLECLQGWGIHS
Ga0256703_10382102Ga0256703_103821022F018877LSSEDIKDPSAEASMIGGKFFTDIWDNGGREMAQEIIQKSEKGIHDARKVAEAAEKSTEPEGQIGIN
Ga0256703_10384167Ga0256703_103841671F093243MLSYVPTEDQDADILTKALTRSKFEFHRGRIRVADNPYLAEREC
Ga0256703_10390118Ga0256703_103901181F005658MAWVEKDHNAHPVPTPCYVQGHQPAAQAAQSHIQPGLECLQGW
Ga0256703_10391820Ga0256703_103918201F005658MAWVEKDHNAHPVPTPCYVQGRQPPDQAAQSHIQPGL
Ga0256703_10395950Ga0256703_103959502F004001VVKSPSLEVFKKNMDVALRDMDCGHSADGLMVGLDDLSGLFQPW
Ga0256703_10400286Ga0256703_104002862F005658MAWVEKDHDGHLVPTPRYVQGRQPPDQAAQSHIQPGLECLQGWGIHSLL
Ga0256703_10401221Ga0256703_104012211F001813GVQGTFGRYVEGHGLMRTIGDGWMVGLDDPVGLFQPL
Ga0256703_10401677Ga0256703_104016771F001813GVIKPGGIRRVFGCCVEGHGLARTTGEGRMVGLDDPVGLFQT
Ga0256703_10403784Ga0256703_104037841F011632VEWAAQRGGGVTEPGGVLRAFGCCVEGRGLARTIGEGRMVGLDAPVALFQP
Ga0256703_10406265Ga0256703_104062651F035108MLTGRPTKEMPGSAGDLLSELSQLHEQVRLVMQGIAQALWPSVSLLEGVGELVEKLKGARRRFRLWKISACRQGAREAWAMVKTWYTKADPNHMAEVGPVGPDGKEIPVSLLYGQVELAAKYFQQDCRLDRLLDGIEEE
Ga0256703_10408172Ga0256703_104081721F038012MIIEFQLPSYVQGLQPPDQAAQSHIQPGLECFQGWGIHNLLGQPVPV
Ga0256703_10408321Ga0256703_104083211F051243LQYSCLENPMDGGAWQAAVQGIAKSCTRLSDFTFTFHFHALEKEMATHSSTLAWKIPWTKEPSRLQSMGLLGVGHN
Ga0256703_10411104Ga0256703_104111042F001813VQGTFGRCVEEHGLVRTIGDGWMVGQSDPVGLSQPW
Ga0256703_10412118Ga0256703_104121181F065281MAKKSITTTFRFDEDDFLKFKELKEKSGRSWTKLIAHLNNILEQEMKYKNG
Ga0256703_10412659Ga0256703_104126592F005658MAWVEKDLKDHLVSTPYYMQGHQPPDQAAQSHIQPGLECLQGWGIHNLLG
Ga0256703_10414109Ga0256703_104141091F004815ARLDVALGSLGCWLATLHIAGGWNWMSIVVLFNPGHSMILCTRAC
Ga0256703_10416853Ga0256703_104168532F096317VSYVNKQAVLLAAAARTAEVAGLERDLKQAEEELGLTKRQLEENKGE
Ga0256703_10418362Ga0256703_104183621F052316MKVDPNHMAEVGPVGPDGKEIHVSLVYGQVELAAKYYQQDCKLDILLDGIEEEYTQSN
Ga0256703_10420845Ga0256703_104208451F034384EFCQNFEEETSRVETSLDPINSPMKDEAAMNVLRLESHVAGVVDYLARLKVVVSQIDTTLWPGETLQNDLESLMTRLNEVPGRVQEWKKSSARCGADVALSLVRVHCKDAREEKLASIKVANTKKHDFQSFMETFIAATTRIADGIDLDQFVTPSSPPPEE
Ga0256703_10424656Ga0256703_104246561F020492MGMQAALQTSAALTMEVDALKQSLERSENEHGRAEKQLEDEEGM
Ga0256703_10427549Ga0256703_104275491F005658MQLSQNHRMAWVEKDHSAHPVPTPCYVQGRQPAAQAAQSHIQPGLECLQGW
Ga0256703_10428145Ga0256703_104281451F004815PSLQAFKARLDVALGSLGCWLATLHIAGGWNWMSTVVLFNPGHSMIL
Ga0256703_10429310Ga0256703_104293101F001813TDPGGVQGTFGRCVEGHGLVRTIGDGWMVGLDDPVGLFQP
Ga0256703_10429970Ga0256703_104299701F007409MSEDKKTAAETKLSLDEEKNLGFLIAMSKTNTEKITNEILEGLSEDTGDSESYDVDSGGEDSEDRPWRPSHSVY
Ga0256703_10430917Ga0256703_104309171F093003HERAADREVEDDNYMPPSKDEASLDDDEFVVPEDLVEQKRFQRRLMATARSLKKKQQQLRADQDLLVNRWTKVLAAEEHKLERPSKSYPKRRLLPRLEEEALDAADWPPRGHDREASQPSTQAAPHTKAREYAPDLRDMLEDKARQTRSIYGSRGHPMAQDGNRHACHKFGRAEHSRQNSLELRHDIAQYRGAAHPLCFIDEIMDHQIPEGFKSVKIE
Ga0256703_10432731Ga0256703_104327311F038012MLIEFQPSCCVQGHQPAAQAAQSHIQPGLECLQGWGI
Ga0256703_10434179Ga0256703_104341794F005658MDWVAKDHSAHAVPTPCYVQGRQPAAQAAQSHIQPGLECL
Ga0256703_10437024Ga0256703_104370241F086390SACKLPSWGNVRDPPKSEYRDFLSRITVGESRDITQATIGSVHFPAIHYFALFIGRCINAKDEACHMCVPDLNILRSAVLEDQSYHMGAIVARRLHQNRHNGDFFGGIYATRLANFLDVDIREGDMELLTSYLDLDSMFSHQFIVRTGPPSQYRLIFNKRHVVRITLPAPTFFDSQTKGRYIITREEAYEFERRAEAARRHATTQAAITAASQYDPSFNYRNPPGYPWQ
Ga0256703_10440559Ga0256703_104405592F004815HPSLQAFKARLDVALGSLVCWLATLHIAAGWNWMSIVVLCNPGHSVVL
Ga0256703_10441427Ga0256703_104414271F005658MAWVEKDHNDHLVPTPCYVQGLQPPDQAAQSHIQPGLECLQGWGI
Ga0256703_10442138Ga0256703_104421381F004001IERWWKSSSLEVFKKCGNVALRNAVRGHGGDGLMVGLGDLCALFQP
Ga0256703_10445759Ga0256703_104457591F004815IKARLDVALGSLVCWLVTLHTSGGWNRMSTVVLFNPGHAVIL
Ga0256703_10446785Ga0256703_104467853F001813GGGVTDPGGVQGTFGRCVEGHGLARTTGDGWMVGLRDPVGLFQP
Ga0256703_10448005Ga0256703_104480052F001813VQGGGGVTNPGGLRGTFGRCVEGHGLVRTIGDGWMVGLGDLVGLGLFQPW
Ga0256703_10452323Ga0256703_104523231F004815FKARLDVALGSLGWWLVTLHTAGGWNEMSIAVIFNPGHSMVL
Ga0256703_10452957Ga0256703_104529571F005658MAWVEKDHNAHPVPTPSYVQGRQPAAQAAQSHIQPGLE
Ga0256703_10453378Ga0256703_104533781F038012MINEFQLPRCVQGHQPPDQAAQSHIQPGLECLQGWGIYN
Ga0256703_10453535Ga0256703_104535351F004815LQAFKARLDVALGSLGCWLATLHIAGGWNWMSIVILFNPGHSAIL
Ga0256703_10455433Ga0256703_104554331F020828SSTEKLFWSQYAEAEHPVPMSDQLNQMVELHKAADRAMKSFIVQLWPGDALPNSFFGLVRWLVDACPRLEVVKRYVCIEGARRAFAHVKLQWVKLDVVKLIKEGPPEGKEHRHRKMYYEGVLSGAHLIADE
Ga0256703_10457673Ga0256703_104576731F004001VVESLSLAVVKNCTDVALRDTVSGHGGGGLVVGHDDLGDLFQP
Ga0256703_10460277Ga0256703_104602771F001813GGVTDPGGVQRAFGCCVEGHGLAGTIGDGRMVGLDDPVGLFQP
Ga0256703_10460435Ga0256703_104604353F004815AFKARLDVALGSLVCWLATLHVAGGWNWMIITVLFNPGHSMVLGFYYYANL
Ga0256703_10461208Ga0256703_104612081F001813GGVTEPGGVQRAFGCCVEGRGLARTIGDGRMVGLDDPVGLFQPL
Ga0256703_10461958Ga0256703_104619581F038489MAWVEKDHNDHRVSTPCYVQGHQPAAQAAQSHIQPGLEC
Ga0256703_10461974Ga0256703_104619741F011632KGGQALECAAHSGGGVTKPGGNQRALGCCVEGHGLAGTIGEGRMVGLVDPVGLFQP
Ga0256703_10462532Ga0256703_104625322F035626MAPSIINNNAVQGETFLPGQIFVFGGFALRDNSLCHLEQINSYAPGHQVRFGNLNYTVHIRIGLIFDGFGPTPGAPNSLDEHGLDLSSD
Ga0256703_10462931Ga0256703_104629311F001813GGVTDPGGVQRTFGCCVEGHGLARTISDGRMVGLDDPVGLFQP
Ga0256703_10466654Ga0256703_104666541F076748IQLPGDFTPLYVSKSIFLQSDSFWFDCNDKEAVIFPNCETGII
Ga0256703_10468692Ga0256703_104686921F001813VTDPGGVQGTFGRCVEGHGLARSIGDEWMVGLGDRVSVFQPW
Ga0256703_10470144Ga0256703_104701441F028669MYARCEIKKQRFKCWSDQFITNVNKGDGERGGQTLLWIGVMGKGRRAIEK
Ga0256703_10474286Ga0256703_104742862F005658MLKDHRMAWVEKDHNAHPVPTPCYVQGHQPADQAAQSH
Ga0256703_10475625Ga0256703_104756258F004001VVEPSFLEVFKNHVDVALRDMVSGHGGGRLTVGLENLRGPFQP
Ga0256703_10477032Ga0256703_104770321F034384MFGKYFQLWLFPFDYPLDLAITLAEFCQNFEEETSRLEPNLDPVNSPVNDEVAMDAFRLESRVAAVVDYLARLKAATSRIDSTLWPEETLQNDLESLMARLNTIPGRVQEWKKSSARCGADVALCLARVHCKDAREEKLAALRVANTKKHDFRSFMETFLAAATRIADGIDLDEFVAPSSPPQEG
Ga0256703_10478908Ga0256703_104789081F081962EQLYTGSQRALAVGALSNEVPTHLAEVLRRLAVLPQRIQELRRASARAGAIAALSRAKAFLPELDPADIALGYPSLKEDGSAFDQKDFAACVKAVRLVATLIGNDTDLTKYQPGYDAENQRIPTPRYEALNLIPPARQHTFAPEIDPAGLIDEEAQFEALSGIDWKSSTFQVLGSAGG
Ga0256703_10482375Ga0256703_104823751F028669MYARCEIKKQRFKCWSDQFITNVNKGDEERGGRTLLGIGVMGKGRRAIEKI
Ga0256703_10483039Ga0256703_104830393F104139ADPEPTLSSLSGALDTAELPWVGPAFPPGAQSLLQAIT
Ga0256703_10483207Ga0256703_104832071F035108MEEMPGSTGDQLSELVQLLEHVRQAMSGVVQALWPSVSLPEGLGGLAEKLQGVRRRLRLWKISACRQGAREAWAMVKTRYPKADPNHMAEVEPVGPDGKDIPVSLMYGQVELAAKY
Ga0256703_10483676Ga0256703_104836761F020492MQSALLTSAALTAEVDALKQSLERSENELGLAKKQLEDKEGK
Ga0256703_10485475Ga0256703_104854751F005658MARVEKDHSDHPSTPCYVQGRQPADQAAQSHIQPGLECLQGWGIHSL
Ga0256703_10489118Ga0256703_104891181F006329LELHVADVVDDHKIKMEKMRLKIRKIRKYAIDSVAWYHYAVGSIVTLIAIFIAFVVAFKFFS
Ga0256703_10492530Ga0256703_104925301F034384VLRLESRVAAVVDYLARLKVVTSSIDTALWPGEALQNDLESLMTRLKEVPSRVHEWKKSSARCGADVALSLVRVHYKDAREDKLAALKVANTKKHDFRSFIETFIAATTRIADGIDLDE
Ga0256703_10498819Ga0256703_104988191F027342YKALQEIEALKKIASGKAFFMQRKHVDVDYVFLTRIRSSPGAFADLPRSVSDAAAFYRAEEGSSTEKVFWSQYAEASHPVPLSDQLKQLVELHKVAEQAMKGLIARLWPGEVMPGSYFGLVRRLVDACPWIEAVKRSVCIEGARRALARAKVHWGKLDAKKLLTAAPPPGKEYRMPEMYYNGVLKGARRKADECSKDVIFE
Ga0256703_10503360Ga0256703_105033601F011632LLVXKGGQALEWAAQRGGGVTDPGGVQRAFGCCVEGHGLVRTIGEGXMVGLDDPVGLFQP
Ga0256703_10504718Ga0256703_105047182F011632VLEWDAQGAGGVIDPEGAQGKFRCCVEGYGLVRTIGDGWRVGLGDPVGLFQPW
Ga0256703_10505111Ga0256703_105051111F028669MYARREIKKQRFKCWSDQFITNVNKGDGERGGRTLLTMGVRGKGRRAIEKIERGKNCVKR
Ga0256703_10510033Ga0256703_105100331F009131MGKSFGKNVEELRASKKRCYDKSIECAKKIKSSFASVGAFSSEENFTRGNPEGPIEWISHEAEAFEEILNSRGDICAFSGARGIATILERKGCEHVKSLAQSETALSSEDIKDPSAEASLVGGKFFTDIWDNGGREMAQEIIQKSEKGIHDARKVAEAAEKSAEPEGQIGIN
Ga0256703_10512959Ga0256703_105129591F068298GQVLEWAAQRGGGVTEPGGVQRAFGCCVEGHGLVRTIGDG
Ga0256703_10516506Ga0256703_105165062F004001LEVFRNRMDVALRDMDSGHGGYGLVVGLGDLRGRFQL
Ga0256703_10518248Ga0256703_105182482F005658MAWVEKDRNAHPVPTPCYVQGHQPADQAAQSHIQPG
Ga0256703_10519197Ga0256703_105191977F004001LPREVVDSPSLEVFQDHVDVALRDMVSGHGGDGVMLGLNDLSGIFQL
Ga0256703_10519540Ga0256703_105195401F004001LPREVVQSPSLEVFQSRVDVALRDVGSGHGGGGLLVGLGDLSGLF
Ga0256703_10521373Ga0256703_105213731F027342NVSYLLLTRIQRSLGAFADLPRSLSDAAAFYRAEEGSSTEKVFWSQYAEAGHPVPLSDQLKQLVELHKAAEQAMKGLIVRLWPKEAMPGSYFGLVRRLVDTCPWVDIIKNSAYIEGARRALARAKVHWGKMDAQKLVTDPPPEGKEHRTPEMYYKSVLKGARTIAGECSKDVIFE
Ga0256703_10525371Ga0256703_105253711F035626PLPSGPMAPTIINGDVVQGETFLPGQIFVFRGYALRADSLGQLEQIESYAPGNQVRFGSLNYTADIRGDLIFDGFEPLPSAPLCHDEHDLALPPNRALEAAPASAPAPGSELTVPIEDRQLDAASGAAIPMVVEPNTSPRGGVQPPVLDRRSCL
Ga0256703_10528874Ga0256703_105288742F005658MNLRVAWVEKNHNDHLIPAPCYVQGRQPADQAARSHIQPGLECL
Ga0256703_10529280Ga0256703_105292802F067310DVALSLVHVHCKEAREEKLAAIKVANTKKHDFQSFMETFIAAATRIADGIDLDKFVEPPSPPPAE
Ga0256703_10532042Ga0256703_105320421F020828SDAAELYQAEEGSSTEKLFCSQYIGAEQPMPLSDQMKQLVELHKAAELAMKDLIVRIWPAEPLPSSYFGLVKRLVNACPRLEVIKRSVCTEGARRSLARAKVHWAKMDAEKLVMEGPLTGKEHCHPEKYYDSVLKGARLVAEECAKDVVFE
Ga0256703_10537662Ga0256703_105376621F001813PGGVQRAFGCCVEGHGLARTIGEGQMVGLDDPVGLFQP
Ga0256703_10538419Ga0256703_105384191F005658MAWVEKDQNDHPVPTPCYVQGRQPADQAAQSHIQPGLECLQ
Ga0256703_10542252Ga0256703_105422521F020828AEHPMHLSDQLKQLVEVHRAAELAMKGFIVRMWPGELLPTSYFGLIKWMVDACPRLEVITRSVCIEGARRAFARAKVHWGKLDAEKLVKDGPPEGKPHRIPEKYYDGVMKGACLVADECTKDIIFE
Ga0256703_10543183Ga0256703_105431831F027342PGAFADLPRSISDAAEFYRVEEGSSTEKLFWSQYAGAEHPMPLSDQLKQLVELHRAAEVAMKDFIVRMWPGEPLHTSYFGLIKRMVNACPWLEVIKRSVCIEGARRAFARIKVHWGKLDAEKLVKDGSPEGKAHRHPEMYYDGVMKGARLVADECTKDAILE
Ga0256703_10546851Ga0256703_105468511F004001GCPGPREMGQSPSLELFRNHGDVALRGVVSGHSGDGLVAGFGALRGFFQP
Ga0256703_10547516Ga0256703_105475162F052316MVKTRYMKADPNHMAEVGPMGPDGKELPGSLVYGQVELAAKYSQQDCKLARLLDGFEEEYTES
Ga0256703_10549533Ga0256703_105495331F005658MAWVEKDLNHHLVSTPCCGQGQQPLDQVAQSHIQPGLECLQGWGIHSLLGQPVPVLGTEWEQISQKSG
Ga0256703_10551477Ga0256703_105514772F005658MAWVETTPNAHPVPTPCYVQGRQPAAQAAQSHIQPGLECLQGWG
Ga0256703_10551685Ga0256703_105516853F001813VLEWAAQRGGGVTDPGGVQGMFGCCVEGHGLERTIGDGWMVGLGDLVGLLRP
Ga0256703_10555855Ga0256703_105558551F035626MAPTIIDSDAVQGETFLPGQIFVFSGFALRANSLGHLEQIESYAPGHQVRFGSLNYTADIRGDLIFDGFEPLPCASRGHDEPDLALPLDSVQEIAQVAAPTLNS
Ga0256703_10559148Ga0256703_105591481F004001VVESPSLETFRNCEDVALREMVSGHGGDGLMVGLDDVRS
Ga0256703_10559281Ga0256703_105592811F028669MYARREIKKQRFKCWPDQFITNVNKGDEERGGWILLRIGVMGNGRRVIEK
Ga0256703_10559402Ga0256703_105594022F096317VNKQAVLLAAAACTAEVAELKRDLEQAQGELDVTKRQLEENKGK
Ga0256703_10560239Ga0256703_105602391F020828MKDLIVQMWPGEPLHGSYFGLVKRMVHACPRLEVIKQSVCIEGARRAFACAKMLWGKLDAEKLVKDGPPKGKEHHYPEMYYDGVMKGAQLVANECPKNIIFE
Ga0256703_10563777Ga0256703_105637776F001813AAQRGGGVTDPGGVQGMFGCCVEGHGLMRTIGNGWMVGLGDPVGLFQPW
Ga0256703_10566682Ga0256703_105666822F028713MVEDKRVLLVKVDTLKNVADALTKSVSTQKFSWCRETMGVEELGK
Ga0256703_10567189Ga0256703_105671893F011632QTLEWAAQRGGAVTEPGGVQRAFGCCVEGHGLARTIGEGRMVGLGDPVGLFQP
Ga0256703_10567323Ga0256703_105673231F068298EWAAQGGGGVTDPGGVQGTFGRCVEGHGLVRTIGDG
Ga0256703_10572208Ga0256703_105722081F004001VESPSLEVSQNHGYVALRDVVRGHSGGGTMVGLDGLRVLFQTLW
Ga0256703_10573740Ga0256703_105737401F067310MTRLNEVPSRVQEWKKSSARCGADVALSLVRVHCKDAREEKVASLKVANTKKYDFRSFMETFIAAATRIADGIDLDEFVAPSSPPQEE
Ga0256703_10574007Ga0256703_105740071F001813QRGGGVTEPGGVQRAFGCCVEGHGLVRTIGEGRMVGLGDPVGLFQP
Ga0256703_10577903Ga0256703_105779032F096317VNKQAVLLAAAARTAEVADLKQDLEQAQGELDLTKRQLEENKGK
Ga0256703_10578395Ga0256703_105783951F068298GQALEWAAQRGGGVTDPGGVQGTFGRCVERHGLMRTIGDG
Ga0256703_10582383Ga0256703_105823831F004001TGWVGPPSLGVSQSRVDVALRDVGSGHGGGGLGVPTGLLQP
Ga0256703_10582738Ga0256703_105827381F020828VPLSDQLKQLVELHKAAEQAMKGFIVRLWPGEALPGSYFGLVRRLVEACPRLEVIKCSICIEGARRALARAKVHWGKLDGEKLVKDGPPPGKEHRKPENYYKDVLKGARLMADECSRDVIFE
Ga0256703_10584256Ga0256703_105842561F020492KYVNMGLQAMLLTSAALTAEVNTLKENLERSENELGHAKKQLEEKEGE
Ga0256703_10584361Ga0256703_105843611F020828GFIVRLWPREALPGSYFRMVWQLVEDCPRLEVIKHSVCIEGARRALARAKVHWGKLDGEKLVRDGPPPGKEHRKPENYYKDVLAGARLMADECTKDVIFE
Ga0256703_10587005Ga0256703_105870051F096317IVGVHVNKLVVLLAAAVRKAEVAGLKRDLEHAQGDLGLTKRQLEENKGE
Ga0256703_10590414Ga0256703_105904141F035626MALSIINNDAVQGETFLPGQIFVFGGFALRANSLGHLEQIESYAPGHQVRFGNLNYTADIRGDLIFDGFEPPPSAPHGLMGHDLARSPNSTRAATNPPALPLNSEPAAPIE
Ga0256703_10590649Ga0256703_105906491F038012MIMEFQPPCYVQGRQPPGQAAQSHIQPGLQCLQGWGIHSLL
Ga0256703_10591271Ga0256703_105912712F034384VIFPFDHPLDLVTTLAEFCQNFEEETSRLEPNLDPVNSPVNDEVAMDVLRLESRVAAVVDYLARLKAATSRIDSTLWPEETLQNDLESLMARLNTIPGRVQEWKKSSARCGADVALCLARVHCKDAREEKLAALRVANTKKHDFRSFMETFLAAATRIADGIDLDEVGAPSSPPQEG
Ga0256703_10592921Ga0256703_105929211F105149MSRKMYQGGSSRKKGPRLAIRELDDKLPREADMRPCEWPSEPFMVAAGIKDEFDAYVRNVDLEAFMQDKCPQYRYLTDSFVRRFKFTSSRNYQNVLF
Ga0256703_10593665Ga0256703_105936651F001813GGGGVTDPGGVQGMFGHCVEGHGLVRSIGDGWMVGLGDPVGPFQPW
Ga0256703_10595110Ga0256703_105951101F081962VVTKLKAVYTLVEQLYTGSQRALAVVALSNEVPTHLAEVLRRLAVLPQRIQELRRASARSGAIAALSRAKAFLPELDPADIALGYPSLKEDGSAFDQKDFAACVKAVRPVATIIGNDTDLTKYQPGYNAENQRIPTPRYEAINLIPPARQHTFAPEINPDGLIDEEAQFEALSGINWKSSTFEALVSAEAFLT
Ga0256703_10595860Ga0256703_105958601F093243MLLQYIYTEDQNADILMKVLGTRKFKYHRGRIGVKDNPYLVEREC
Ga0256703_10596805Ga0256703_105968051F079404IAGTGYLSGTPKKPSEEWPSEWFYMEDVPLPAPIRMGLPEFNNAPLKKRRSWRPRSPQEEDNREVLYLMGRIKILAKSGLTIIEVMSICIMRGVQPLQYRGQPMWHFNGEDDATHCGRKGPDTPATLAKILSRLYKGEKEEFIRIKPKDGFSMYNRPSWVSFHPITQFIP
Ga0256703_10598580Ga0256703_105985801F011632MNNNSQVKGGQALEWAAQRGGGVTEPVGVQREFGCCVEGHGLAGTIGEGQMVGLDDPVDLFQP
Ga0256703_10600361Ga0256703_106003611F007510MDGGASWAAGHGVTKSRTRLRDFTFHYHALEKEMAICSTVLAWRIPGMEEPSGLPSMGHTESDMTEAT
Ga0256703_10601303Ga0256703_106013031F001813VTDPGGVQRAFGCCVEGHGLGRTIGDGRMVGLDDPVGLFQP
Ga0256703_10601538Ga0256703_106015382F096317LNVNKQVVLLAAVVRTAEIARLKQDLEKAQGELDLTRRQLEESKGE
Ga0256703_10602094Ga0256703_106020943F038012MIIEFQPPRYVQGCHPPDQAAQSHIQPGLECLQGW
Ga0256703_10603094Ga0256703_106030941F038003DQEVPTDSHPTSFGFSLNPPSALALAGALVEASPNPLGFRMRSPWDRLMDVSTYGPSGSEEDDDSSICWDFSGLGNPSAMRDFMTACDYCLSDCSDGSHSLGDEDCGPSRECFHVDLGGPGEGNHLGIPENGDPPRPAPRVDILRELAVVPVPAGGQDAQLEQIREMQARLDEGAGTLEQFRRNIGQEWADQAPAGEARHLP
Ga0256703_10605446Ga0256703_106054461F076912LENSTTLCNGKGSNADKVQDSETSMLLSKKADKNYLDNSERTQNSCLDVVFDLLATTVGTSSPNSLLELVRLLESQLQVERHQSDVLRQEAEGLRKSLQNSDAYFLVQQQALEDLSVKQEKVNKLSKHLASIMGTQDIVS
Ga0256703_10606543Ga0256703_106065431F004815RLDVALGSLGCWLVTLHIAGGWNWKSVVVLCSPGHSMVL
Ga0256703_10614371Ga0256703_106143712F028669MYTRHEIKKQWSRCWSNQFITNVNKGDEERGGWALLQIGVMGKGKKAIEKIENRSKGVFIGTNQGDGEGKKGSRKDRK
Ga0256703_10614521Ga0256703_106145211F020828KQLVKLHKAAEQAMNGLIVRMWPGEPLPDSYFGLVRRLVNACPWLEVIKRSVCIEGARRAFARAKVHWAKLDAEKLVKEGPPEGKEHRHPEMYYDSVLKGSRLVAEECAKDVIFE
Ga0256703_10615026Ga0256703_106150261F001813WAAQRGGGVTDPGGVQGTFGHCVEGHGLVRSIGGGWMVGLGDLVGLFQPW
Ga0256703_10616531Ga0256703_106165311F002994VEKLDICDDSIVSLRNDNASLITKIDNLNASLSSLKIENEKLIAKAKDLDVCNVSITNHRDENDILHAKIVELNSCKSSTSTVEHVTICTRCRDVNIDAIHDHLALIKQQNDHIAQLSAKINEHDLENEKFKFARSMLYSGRRPGIKDGIGFQ
Ga0256703_10616543Ga0256703_106165431F032472AVQGETFLPGQIFVFGGFALRANSLGHLEQIESCAPGHQVRLGSLNYTADIHGDLFFDGFEPQLGAPHCHDGYDLALPPNSTPEAAPASAPTLSSEPTTPIEDGWMDTASGPTTSTAIEPNTNPIPCEAHDSKVPDSSPDSEPSAPLPIESDWAPIMEFTAADVFQHSPFGDILKSLKSLSLSGEPWPDYGQQGWG
Ga0256703_10618445Ga0256703_106184453F004815APSLQAFKARLDVVLGSLVWWFVTLHIAGRWNWMSTVVLFNPSHAVIL
Ga0256703_10619293Ga0256703_106192931F005658MAWVEKDHNAHPVPTPCYVQGRQPADQAAQSHIQPGLV
Ga0256703_10627995Ga0256703_106279952F028669MYAWHEIKKQWFKCWSDQFITNVNKEDEERGGQTLLRIGVMGKGRREIEKIGNRSKESLN
Ga0256703_10631417Ga0256703_106314171F004815SLQAFKARLDVALGSLGCWLATLHIAGGWNWMSTVVLCNPGHSMIL
Ga0256703_10635107Ga0256703_106351072F073390KKGYEHVKILAQSEATLSFEDAKDPSAEASMVGGKFFTDVWDNGGREMAREIIQKSEKGIHDAREVAEAAKKSAEAEGQLGIN
Ga0256703_10637092Ga0256703_106370923F038012MTIEFQPPCYVQGRQPPDQAAQSHIQPGLECLQGWGIHSLLGQPVP
Ga0256703_10637669Ga0256703_106376691F105149GGSSRQQGPRPAIRETDHEPPREAQVRPCEWLSENFMVQAGIKDEFDAYVRNDELEGFVSDKCPQYYHLTDSFVRRFKFTSSRNSHTVLFDLYDKSYTMDLEDFNTACKLPQWGNASEPRNLNLKTFLLV
Ga0256703_10637835Ga0256703_106378351F005658MAWVEKAHSAHPVPTPCYVQGRQPAAQAAQSHIQPGL
Ga0256703_10639226Ga0256703_106392261F001813AQRGGGVTEPGGVQRAFGCCVEGHGLARTIGEGRMVGLDDPVGLFQR
Ga0256703_10640103Ga0256703_106401031F094706VPTVGLSHDGFEFLEGSVEGLKGYAVGRMTKSRHGKLYIDDAGRGPEAGSIEYGYRLPSGSIAVFIGKIDEPGPEPDICTDIVETAQCARPARALRAMKRAFVGVIHEAESVVRSASGGQTVIYFDDESSTGETESLYQLQ
Ga0256703_10640294Ga0256703_106402941F001813AQRGGGVTDPGGVQRAFGCCVEGRGLAGTIDERRMVGVDDPVGLFQP
Ga0256703_10641752Ga0256703_106417521F076748MPTPMRFIQLPGDSPPLYVSKSSFSQGDSSWLDWNDEEAVLFPNWETGIT
Ga0256703_10642499Ga0256703_106424994F004001MEVLESPSLEVFKSRVDVALRDVVSGHSGDVLVVGQGDLRDLFQP
Ga0256703_10647043Ga0256703_106470433F004001WHWLPREGVESPSLQVFKNCGDVALRDVVSGHGGDGWMVGLDGLSGLFQL
Ga0256703_10648724Ga0256703_106487241F004815KARLDVALGSLVWWLVTLHIAGGWNWMIIVVLFNPGHSTML
Ga0256703_10649197Ga0256703_106491973F038012MIISFQPPHHGQGHQTLDQAAQSHIQPDLECLQGWGIHN
Ga0256703_10651272Ga0256703_106512723F038489MAWVEKGHSDHXVSTPCYVQGHQPPDQAAQSHIQPGL
Ga0256703_10654592Ga0256703_106545922F020828VPLSDQLKQLVELHKAAELAMKGLIDRMWPGEPLPGSYFGLVRRLVNACPRFEVIKRSVCIEGARRAFARAKVHWAKLDAEKLVKEGPPEGKEHRHPEKYYDSVLKGARLVVEECAKDVIFE
Ga0256703_10654648Ga0256703_106546481F038489MAWVEKDHNAHPVSTPCYVQGRQPPDQAAQSHIQPGL
Ga0256703_10656112Ga0256703_106561123F005658MAWVEKDHNDHLVPTPCYVQGRQPADQAAQSHIQPGLECLQGWGIHNL
Ga0256703_10656386Ga0256703_106563862F081962VYTLVEQLYTGSQRALAVVALSNEVPTHLADVLRRLAVLPQRVQELRRASARAGAIAALSRAKAFLPELDPADIALGYPSLKEDGTPFDQKDFAACVKSVRPVATLIGNDKDHTKYQPGYDAENQRIPTPRYEAVSLIPPTRKHTFAPEVDPAGLIDDEAQFEALSGIDWKSSTFQVMETAGGAERDEPGASTQQAP
Ga0256703_10656779Ga0256703_106567791F096316MAWVEKDHSAHPDPTPCYVQGRHPADQAAQSHIQPGLECLQGWGIHSLLGQPVQCVTTLW
Ga0256703_10658807Ga0256703_106588071F020828MPLSDQLKQLVELHKAAEQAMKGHIVLMWPGAPLHSSYFGLVRQLVDACPQLEVIKRYVCIEGACMDFAWVKVHWAKLDAMKLVREGPPEGKEHRCPEMYYDSVLKGSRLVAEECARDVIFE
Ga0256703_10660018Ga0256703_106600181F004815KARLDVALGSLGCWLATLHIAGGWNWMGTVGLCNPGSSMSLW
Ga0256703_10664138Ga0256703_106641381F011632MSMTLWKGGQALEWTAQRGGGVTKPGCVQRALGCCVEGHGLARTIGEGRMVGLDDPVGLFQPW
Ga0256703_10664780Ga0256703_106647801F038084VVWYFHLFQNFPQFVVIHTVKGFGIVNKAEVNVFLELACFFSDPMDVDNLIPGSSAFSKTSLNIRKFMVHILLKPGLGNIELYFTSV
Ga0256703_10666873Ga0256703_106668732F035626FRCVVVRRFDGSINHLQDYNNDALGEVFLPDQIFVFGGFVLRANSLGHREQIESYAPGHLVRFGSLNYTTDIRGDLIFDGFEPMSGAPHNHDEHDLTLSSDSIREITPATTPALN
Ga0256703_10668671Ga0256703_1066867110F005658RVEKDHNDHPVSTPCYVQGHQPPDQAAQSHIQPGLECLQGWGIHSLLGQPVPV
Ga0256703_10669122Ga0256703_106691221F020828VELHTAAKLAMKDFIARLCLGEPLPSSYFGLVKRMVNACPRLEVIKRSVCIEGARRALARAEVHWGKMDAEKLVTEGPPKGKEHRHPEQYYDNVIKGARLVADECSKDVIFE
Ga0256703_10670868Ga0256703_106708681F004001VLESLSLEVFQSRVDLALRDVVSGHGGDGLVVGPGDPTGLFQ
Ga0256703_10674233Ga0256703_106742331F059631MILRMRRNFFEITTFPNTHFGMWLKTFDIKPKVVGVQQAECGGAMVGKMPNVIWLEGSFVEPIKGWQSGWFYITEPCETNWVAAPEFRSGILTRLTSWKEKGLSWGSSVELDGLQKCIRNMTSKKLKLVNIVQVMLFRRILPCQQRDFNLWEFDPAQHQTLHELFDTMHKDVWKVLFKGAEVPPLTEDRGLSVKHPANSVSSVHLVGYLFAIA
Ga0256703_10676050Ga0256703_106760502F083289MLGHKGTITMHGSRKIALECEEGDATYAESVCATEELKFYKDNVDPTDMTSLKKPTTEHDPTPKFKSADETKLVDFVPGNSSKQFSISANLDLK
Ga0256703_10676299Ga0256703_106762993F028669MHTWREIKKQRSRCWSDQFITNVNKGDEERGGWTLLQIGVVGKGRKGIEKIGNRSKGVFIGTN
Ga0256703_10676466Ga0256703_106764661F083289TVHGSQKVALECEEGDAAYAESACAVEELKFYQDNVDLADMTSLKKPTTEHDPTLKFKSAAETKLVDFTPGDPSKQFNISSNLDPK
Ga0256703_10677764Ga0256703_106777641F038084FDVVNKAEVYVFLELSCCFSDPAEVGNLISGSSAFSKTSLNTSTFTVPVLLKPGLENFERYFTSV
Ga0256703_10678135Ga0256703_106781351F038012MTISFQPPCYVQGHQPADQAAQSHIQPGLECLQGWGIHN
Ga0256703_10678534Ga0256703_106785341F013401MQQKEKLNELISAIHEKDDLLDSQEDFLIKENKKHVKVKNAYALEVEKCEKLSSELSTCHETIDNLRNENANLLAKVDSHVCNVSTSNPRDVNDDLLARIEELNISLASLKDENEKLLAKARDFDICNTTISDLRTKNDI
Ga0256703_10679434Ga0256703_106794342F068298MELAAQAGGEVTDPGGIQGTFGCCVEGHGLMGAIGNR
Ga0256703_10681429Ga0256703_106814293F001813VAQEGGGVTKPGGVQRTFGRCVEGHGLVRTIGDGWMVGLGDPAGLF
Ga0256703_10682270Ga0256703_106822703F001813GGVQRIFGCCVEGRGLARTIGEGRMVGLDDPVGLFQP
Ga0256703_10682610Ga0256703_106826101F065766PRRLPMAREKKEEGAGDPIKILLEEALEKQRNVMMDNFAQILQ
Ga0256703_10684235Ga0256703_106842351F051243MTERLHFRFSLSCIGEGNGNPLQCSCLENPRDGGAWWAAIYGVAQSQTRLSNFTFAFHFHALEKEMATHSSVLAWLIPGTGEHGGLPSMGS
Ga0256703_10686229Ga0256703_106862292F020492MQAALLISAALTAEVGALKQELERSEQELSRAKKQLQDKEGE
Ga0256703_10690361Ga0256703_106903611F038012MIIEFQPPCYVQGRQPLHQAAQSHIQPGLECIQQWGIHNLP
Ga0256703_10694424Ga0256703_106944241F005658MAWVEKDHNDHLVSTPCYVQGHQPADQAAQSHIQPGLECLQGWGIHSLLGQPVQCVT
Ga0256703_10695388Ga0256703_106953882F004001MDIRKHFFSERKVLQWHGLPRVVVQSPSLELFRNRGDVALRDVVSGHGGGGLVDGLGDLRGFLKPL
Ga0256703_10696467Ga0256703_106964674F001813QRGGGVTDPGGVQGTFGCCVEGHGLVRTIGDGWMVGLGDPVGLFQP
Ga0256703_10696733Ga0256703_106967331F038012MIIEFQPPCYVQGRQPLDQAAQSHIQPGLECLQGWGIHNLVGQAVP
Ga0256703_10696739Ga0256703_106967391F001813QRGGGVTDPGGVQGTFGCCVEGHGLVRTIGDGWMVGLGDPGGLFQP
Ga0256703_10698727Ga0256703_106987271F098130MIPGPHPRRRPVRDDVMLQGTHVRDWAPPGWHWEVLPRGVRRLVRNPASGPVVDPDLLWWRSRGPHSVQREPAPPEVVRRRVTEEDEHVQRYMAAMDDVRFSTTWRVLWADDRRYDPMMVPSLWVCTARAPGTASGALDSSVVLDLY
Ga0256703_10702052Ga0256703_107020521F104139VRNSHLHCQSLNEVWEGVDPGSSPSGHSGVLRAPEIPWVGPAFPPGAQSL
Ga0256703_10704015Ga0256703_107040151F033854MAAEGQSDTMASDMEVCMEQRCVTEFFHAEKNVATDICXRLMNVDGDQTVDVSAVSGVFL
Ga0256703_10708689Ga0256703_107086891F092835MNPGLRLCVRRQHSQFWPILTCFVDCYSPFWGLKAISIVVEPQVMLTCWSSTLAVLADSDPFRGLLLTVL
Ga0256703_10709381Ga0256703_107093811F011632LEWAAERGGGVTDPGGVQRAFGCCAEGHGLARTIGDGXMVGLDDPVGLFQP
Ga0256703_10709776Ga0256703_107097761F068298LEWAAQRGGGVTEPGGVQRAFGRCVEGRGLARTIGDG
Ga0256703_10710190Ga0256703_107101902F068298LEWAAQRGGGVTNPGGVQRTFGCCVEGHGLARTIGEGQTNGWTA
Ga0256703_10714538Ga0256703_107145381F020637MDGGAWWARVHGVARSWARLSNFTFTFHFHALEKEMATHSGVLAWRIP
Ga0256703_10716439Ga0256703_107164391F004001SPSLEVFKKHGDVALMDVVSGHGGDGLMFELDCLSGLFQS
Ga0256703_10716671Ga0256703_107166711F093003REVEDDNYMPHSGDEASLDDDEFVVPEDPVEQECFKRRLMATASSLNKKQQQLRADQDLLADRWTEVLAAEEYELERPSKSYPKRRLLPQLEEEALKPTSPVHDAADRPSRGRGREASRPSTQAAPRCRSKSTKARGNAPDLRDILEDKARQTRSIYRSRGHPTTRDDNRHARYGKYCQAKHNRQSSSELRRDIAQYRGAAHPLCFTDEVMDHQIPEGF
Ga0256703_10717897Ga0256703_107178971F086390PSWGNVRDPPKSEYRDFLARITVRESRDITQATIGSIHFPAIHYFALFIGRCINAKDEACHMCVTDLSILRSAVLGDQSYHLGAIVARRLHQNRHSGDFFGGIYATRLANFLEVDIREGDMELPPSYLDFDSMVSHQFVERTEQPLQYRLIFNKCHVLHIALHAPTFFDFQTKGRYVITREEADEYERRVEAARRHAAA
Ga0256703_10721236Ga0256703_107212361F081962MKQNTLIKLKAVYTLVEQLYSRTQRALAVVALSTPHPRLLQDVLKSLAFLPRRIQDLRRSSSRAGAVAALSQAKAWLPELDPADLALGYPSLKEDGNAFDDHDFHACVKAIRPVATLIENDTDLSKYASAYDSNNQKIPNAPYDQISLIPPIRKHTFATEVDPAGLIDDEAEFEALSGIDWASSTFQETTADGEAEKG
Ga0256703_10721374Ga0256703_107213741F002002VTWASLLTQSVKNPPAMQETRVWSLGWENPLEKEMATHSSILSWRIPWTEGPGRLQSTGSQRVGHDSATELN
Ga0256703_10722800Ga0256703_107228001F038084VVWYSHLLQNFPQFVVIHTVKVFGIVNKTEIDVFLELSCFFHDPADVGNLISGSSAFSKTSLIIMKFKVKILLKPGLQNFEH
Ga0256703_10723025Ga0256703_107230251F001813AAHSGGGVTDPGGVQAMFGCCVEGHGLMRTMGDGQMVGMGDPVGLFKPW
Ga0256703_10724834Ga0256703_107248342F020492ASAALTAEVDTPKQNVEQSEQGLGCAKKKLKDKEGKKYLV
Ga0256703_10724879Ga0256703_107248791F004001PFLSSLEVFKKRVDMALRDMINGHGEDELLVGLEDLSGLFQP
Ga0256703_10725844Ga0256703_107258441F104139VWEGMKPGSTLSGHSGALHAPELPWAGPAFPPGAQSLFQAVI
Ga0256703_10726247Ga0256703_107262472F053764LIIFFAAKDREALYNQQKQDQEQTVAEIMNSLLPNSDIN
Ga0256703_10726379Ga0256703_107263791F104139VWEEVYPGSTPSSCSGALHAAELPWVGPAFPPGAPSLVQPVT
Ga0256703_10736506Ga0256703_107365061F076912LGKSALLSNGKGSNADKVQDSDTSLLVSNKADKTAKEDYLEDSETTPKSCLGLVLELLAITACTSYSNSLSESVRFLESQLQDERHRSAVLRQEAEGPRKSLKHSDAYFLVQQQALEDFSAKQDKANKLAKLIASLVDTSFIELLRSCFNYALVLL
Ga0256703_10737318Ga0256703_107373182F103019MLFFHHAGKTSSIPPPAGGLSAAIVAVARRWKEYHVVAAVEGHELKTPETEHRPGLERLLETTHLELDGKLCVNTQQAPT
Ga0256703_10741403Ga0256703_107414031F027342EVAAALESAKSAKAEAQKALQEIDEMKKIAAGKAFYMQSKHATVNYRLLTRIRSSSGAFADLPRSVSDVAQFYQAEDGSSTEKLFWSQYAEAEHPVPMSDQLKQMAELHKAADQAMKGFIVRLWPGDALPNSFFSLVRWLVDACHRLEVVKRSVRREGARRAFARVKLQWVMLDAVKLIKEGLLEGKEHCHPEMYYEGVLSGARLMADECSKDVIFE
Ga0256703_10744158Ga0256703_107441582F093243MLLSYIPTEDQDADILTKALTRRKFEYHRGRIEVEDNPYLVEREY
Ga0256703_10744824Ga0256703_107448241F034384MNLLRLESRVDGVVDYLARLKVAMTWIDPTLWPESTLQNDLESLMTRLNRIPDRVQEWKKSSTRCGADVALSLVRVHCKEVREEKLAAIQVANTRKHNFQDFMETFIAAATRIADGIDLDEFVAPASPPPPEE
Ga0256703_10747053Ga0256703_107470531F028765FNKSSLFPNERHTCLMAREKKVCTRNSTYASSSEDESSDEDEIDYSCLFKGLDRTKVDKINELIDALNDKNMLLEKQEDLLYEEHDKFVEAQRSHALEVKRNEMLSCELSSCHETIFKLRSINDDLNAKLEIASKSTSCVENVVTCTRCKDINIDAYSEHLACISKLNEEVASLNAQLKTSKSDFDKLKFARDAYTIGRHPSIKDGLGYKREAKNLTSHKAPISTKEKGKAPMASSAKRNHAFMYHDKRQYRNAYRSYNAYNAFDSHTMFASSSSYMHDRNMSMRNVIHHVPRKNI
Ga0256703_10748089Ga0256703_107480891F079404VSSGRSRSVAHRLPEFDSAPLKKRLSWRPQIPQRESDRDIIYLMGRIRLLAHSGLTMIGVMTECIMRGVQPLQYRSHPMWDFNGEDDATRYGRKGPDSAAALLKILSTLYKGEEEEFLRVHPQSGFSMHNPPSWVSGRIYMLIHLVFPLLNT
Ga0256703_10748957Ga0256703_107489571F004815QAFKARLDVALGSLVCWLVTLHIAGGWNWMSIVLLFNPGHSRTL
Ga0256703_10749615Ga0256703_107496153F028669MYARREIKKQRFKCWSDHFITNVNKGDEERGGRTLLWIGVMGKGRRAIEK
Ga0256703_10752244Ga0256703_107522441F052316MVKTRYTKLDPNHMARVGPLGSNGEEIPVSLVYDQVEGAAKYSQQDCKLDYLLEGVEEEAFEPK
Ga0256703_10755760Ga0256703_107557601F081962VLTKLKAVYTLVEQLYTGSQRALAVVALSNEVPTHLADVLRRLAVLPQRFQELRRASTRVGAIAALSRAKAFLPELDPADIALGYPSLKEDGTPFDQKDFAACVKSVRPVATLIGNDTDLTKYQPGYGAENQRIPTPRYEAVSLIP
Ga0256703_10756413Ga0256703_107564133F020492SAALTAEVDMLKQNLEGSEQEFGRAKKQLKDNEGKKYLV
Ga0256703_10756996Ga0256703_107569961F093243MLLQYIPTEDQDADILMKALTRSKFKYHRGRIGVADNPYLVERKC
Ga0256703_10757565Ga0256703_107575652F001813MTSASSGVQRAFGCCVEGHGLAGTIGEGRMVGLDDPVGLIQP
Ga0256703_10758187Ga0256703_107581871F015450QSAAIEKKDLELQTAEGLLVDSEAKITELNSKLLSQSENFEQEKLKLDAKLEAEVQKSSELKESLTSLQNKCLEFSNRCIQQLKQVFHFVGASSEKFTPSAEDLPGAFKHMEGEIDDLDEVIAGHGDFCALVASRGTVVAFLKSGCKHEKIINRPNFNLSPADLDNIPNLARSIANRFIKLVWT
Ga0256703_10759395Ga0256703_107593951F027342IDAVKKIATGKAFIMQSKHVKETFLLLTRVWSSPGAFADLPQSVSDAAAFYRAEEGSSTEKVFWSQYAEAGHPVPLSDQLKQLVELHKAAEQAMKGLIVRLWPRGALPGSYFGLVRRLVEACPRLEVIKRSVCIEGARRALARAKVHWGKLDAEKLVKDGPPPGKEHRKPENYYKDVLKGACLVAD
Ga0256703_10762412Ga0256703_107624121F052316MVKTRYTGLDLNHMARVGPRGPHGQEILVSLAYDQVKIAAKFSQQDCKLDSLIDGIDKE
Ga0256703_10762535Ga0256703_107625351F001813VQRAFGCCVEGLGLVRTIGEGRMVGLDDHVDLFQPL
Ga0256703_10762742Ga0256703_107627421F001813PGGVQRAFGCCVKGRGLAGTIDEGRMVGLDDPVGLFQP
Ga0256703_10765095Ga0256703_107650951F093243MLPQYIPTEDQDENILTKVLTRRKFEYHRGRIEVKDNPYLVEREC
Ga0256703_10767079Ga0256703_107670791F028669MYTQCEIKKHQFKCWSNQFITNVNKGDEERGGQAQLQIVVMGKGRKVIEKIENRSKESL
Ga0256703_10769811Ga0256703_107698111F027342RSVLDAVEFYQAKEGSSMEKLFWSQYTKTEHPVALSDQLKQLVELHKAAEQAMRGLIVRMWPGEPLPGSYFGLVRRLVNACPRFEVIKRTICSEGVRRDFARAKVHWAKMDAEKLVKEGPPEGKEHRHPEKYYDNVLKGARLIAGECSKDVIFE
Ga0256703_10770377Ga0256703_107703772F028669MYARREIKKQRFKCWSDQFITNVNKGDEERGGWTLLRIGVMGKGRRAIEKIGRSKNCVKR
Ga0256703_10770946Ga0256703_107709461F004001SPPLEVFQSCVDVALRDVGSGHGGDGLMVGLGDPRGLFQSL
Ga0256703_10772444Ga0256703_107724441F028669MYAQCEIKKQRFKCWSDQFITNVNKGDEERGGRTLLRIGVMGKGRRAIEKI
Ga0256703_10773029Ga0256703_107730292F004001MELPSLEVFKKRADVALRDVVSGHDESGSMVGLDDLSGLFQP
Ga0256703_10773281Ga0256703_107732811F004815LQAFKARLDVALGSLGCWLATLHIAGGWNWMSTVVLFNPGHSVIL
Ga0256703_10773831Ga0256703_107738311F001813GGVQGKFGCCVEGHGLAGTIGEGQMVGLDDPVGLFQP
Ga0256703_10776918Ga0256703_107769183F001813VEWAAQEGGEVTDPGGVQGTFGHCVEGCDLVRTTGDGWMVGLGDPVGLFQTS
Ga0256703_10777385Ga0256703_107773852F076912LEKSTPLCNGRESNADKVQDSETTLLVSKKGDKNDLVDSEKTPQSCVNVVFELLASTAGTSSSNSLPESLGLLKSQLQAERHQSAVLRQEAEGLRKSLQNSDAYFLVQQQALEDLSAKQEKVNKLAKHLASIMGTQDIVS
Ga0256703_10778896Ga0256703_107788961F083289NGTITVHGSRKIALECEEGDAAYAESVCATEELKFYKDNVDPADMTSLKKPTTEHEPAMKFKSADETKLVDFVPGDSSKQFSISANQDPK
Ga0256703_10779380Ga0256703_107793801F004001VESPSLEAFKKCGDVAMRDMVSGHGADGLMVGLDDLKVLFQP
Ga0256703_10783946Ga0256703_107839461F001813AAQGGGGVTDRGGVQRAFGCCVEGYGLARTIDERRMVGLDDPVSLFQP
Ga0256703_10786479Ga0256703_107864791F038084VSQEADQVVWYSHLFQNFPQLILIHIVKGFGIVNKAEVDVFLKLSCFFYDPADVGNLISGSSAFSKTSLNLWKLLVRILLKPN
Ga0256703_10787518Ga0256703_107875181F028669MYAWRETKKQRFKCWSDQFITNVNKGDEERGGWTLLRVRIKGEGRKAISKNRKEARIV
Ga0256703_10789479Ga0256703_107894793F011632EWAAQRGGGVTEPGGVQRAFGCCVEGHGLVRTTGEGQMVGLDDPVGIFQPW
Ga0256703_10790597Ga0256703_107905971F079404GAEIWRIAGTGYLSGTPKKASEDWPSEWFYMEDAPLPDPVRIVLPEFSNAPLKKRLSWRPRSPQREDDRSVHYLMGRIQLLAHSGLTMIGVMATCIMRGVQPLQYRGHPMWDFNGEDDATRHGRRGSGSAADLAKILSGLHKGEEEDFLHTNPLNGFSMNNPRSWVSGRLSIRSVLSKLSVLLYDFDAGIAPGCGGRTKPDSTTR
Ga0256703_10790819Ga0256703_107908191F032472PIGLMASSINNNAVLGETFLPGQIFVFGGFALRANSLGHLEQIESYAPGHQVRFGSLNYTTDIRGDLIFDGFEPWPSVPHCHDGHDLALPPNSAHSATQVSAPTISSEPTAPVGDGQLDAAPGAAISTAIEPDTGLVLCEACDSKVSDSFSDSVSSAPLPIEPNWAPIMEFTTADVFQHSPFGDILNSLKSLSLSEEPWPDYGQQG
Ga0256703_10792056Ga0256703_107920561F093003TWWTPQKKAMAMEQGRMTERHGRNREASWPSTQAAPRRRSKTTKAWVNALDQQDILEDKARQTRSIYGSRGCPTTRDNNGHTGYSKSKSCRAEHNRQNSFELHRDIAQYRGAAHALCFTDEIMDHKIPEGFKPVNIESYDGTTDPAVWIEDYLLHIHLASGDDLHAIKSLPLKLKGPA
Ga0256703_10792492Ga0256703_107924922F053764MANTEVRLIIFFAAEDGEALYNQQKQDRELTMAQIMNSLLANSDLN
Ga0256703_10799845Ga0256703_107998452F020492GMQATLLTSAALTAEVDALKQSLERSENELRRAKKQLEDKEGM
Ga0256703_10805277Ga0256703_108052771F001813VNKIACSGVQRAFGCCVEGHGLAGTIGEGRMVGLDDPVGLFQP
Ga0256703_10810206Ga0256703_108102062F051243GKASIHPEKVSTRVSMGEGNGNPLHCSCLENPGDGGAWWAAVYGVTKSQTRLSNFPFTYHFHALEKEMATHSIVLAWRMPGTGEPGGLLSMELHRVVHD
Ga0256703_10810500Ga0256703_108105001F001813VVFKGRCGVHRAFGCCVEGHGFVRTIGEGRMVGLDDPVGLFQP
Ga0256703_10812856Ga0256703_108128561F083289IVHGSWKIALECEEGDAAYAQSVCATEELKFYKDKVDPADMTFLKKPTMEHDPTLKFKSATNTKMVDFVPGNSSKQFSISANVDPK
Ga0256703_10814622Ga0256703_108146221F046965SNLRDKNDILHAKIVELNSCKPSTSIVEHVSICTRCRDVDVNAIHDHMALIKQQNDHIAKLDAKIAEHNLENEKFKFARSMLYNGRRPGIKDGIGFQRGDNVKLNAPPKKLSNFVKGKAPMPQDNEGYILYPTGYPESKIRRTHSRKSHSGPNHAFMYKGETSSSRQPTRAK
Ga0256703_10814987Ga0256703_108149871F104139LPCQLLNEVWEGVDPGSTPSARSGILHAAELPWVSPAFSPGVQSLFQAIT
Ga0256703_10817484Ga0256703_108174841F032472VKTSCPLSPVTIRLDAQFRTPYLRSAGFDTDIGAFIESSSVSSPLGPIASSIINHDVVQGETFLPGHIFVFGGFALRANSFGHLEQIESYAPGHQVRFGSLNYMADIRGDLIFDGFEPRPSVPHCLDEHDLALPPDSAQSAAQVSAPTLSSEPTTPVEDGWLDAASGAAISTAIEPNTNLVPRGAR
Ga0256703_10818468Ga0256703_108184681F001813PGGVQGAFRRCVEGHGLVRTIGEGWMVGLSDPVGLFQPW
Ga0256703_10818636Ga0256703_108186361F001813PGGVQGTFGHCVEGHGLVRTIGDGWMVGLDDPVGLFQPW
Ga0256703_10819104Ga0256703_108191041F067310PGRVQEWKKSSARCGAYVALCLARVHCKDAREDQLAALRVANTKKHDFRSFMETFLAAATRIADGIDLDEFVAPSSPPQEG
Ga0256703_10820409Ga0256703_108204092F096317VNKQVVLLAAAARTAKVAELKRGLEQAHGELNLTKRQLEENKGK
Ga0256703_10820652Ga0256703_108206521F005658MAWVEKDHSDHPVPTPCYVQGRQPAAQAAQSHIQPGLEC
Ga0256703_10823836Ga0256703_108238361F059631GLWLKTFNVKPKVVKGTQADCGGAMLGKMPNVLWFEGAFVESVKGCQSGWFYITEPRDPKWAAAPEFRSGIPVQLTSWKEKGLLWGSSEELKGLQACIQKLVNKKLRLVNVVQVMLIRRILPCQHRAFNLWEFDPAQHQTLNRRFDTTHEDAWKVLFKGAEVPPPTTEDHGFSAKCQASAVSCFTSYRILVFHSLTLCGI
Ga0256703_10826413Ga0256703_108264131F035108PVSTGDQLPELLHLIKRVQQAISGVIQALWPAFSLPEGLGKLAEKLQGVLQRFRLWKISACRQGAREAWAMVKTRYKKADPNHMAEVGPVGPDGKEIPVSLVYSQVEFAAKFSQQDCKLDSLLDGIEEEYNQ
Ga0256703_10828798Ga0256703_108287983F004815APSLQAFKARLDVALGSLGCWLVTLHIAGGWNWVSIVLLCNPGHSMTL
Ga0256703_10833776Ga0256703_108337761F104139SFHCQPLNEGWEGVYPGSTTPSHLATLHAPELPWVGPAFPPGAQSLV
Ga0256703_10836146Ga0256703_108361461F057793KSVTPSIRMSEEEYFKLKALKEKYDISWTEFIKYVNKLVEKDMRKNGY
Ga0256703_10839935Ga0256703_108399351F096317VLLAAAARTAEVAELKRDLEQEQGELDLTKRQHKENKGK
Ga0256703_10840982Ga0256703_108409822F083289PGPKGTITVDGDRRIAKECEEGDATYAEVACAAEELKHHRANVDLADMSPLKKPTTDAEPPLKFKPAEDTKVIDFTPGDSTKQFTIGAGLDPK
Ga0256703_10842319Ga0256703_108423195F001813GGVQSAFGCCVEGHGLARTIGEGQMVGLEDPVGPFQP
Ga0256703_10844195Ga0256703_108441952F001813GGVQRAFGCCVKGHGLAGTIGEGRMVGLDDPVGLFQP
Ga0256703_10845595Ga0256703_108455952F052316MVKTWYTKADPNHMAEVGPVGPNGKEIPVSLVYGQVELAAKYSQQDCRLDRLLDGIEEEFSQSA
Ga0256703_10846408Ga0256703_108464082F004001VESSSLEVFKKRVDVALRVIVSGHGRDGLMVGLKDLGGLFQP
Ga0256703_10846975Ga0256703_108469752F001445FHALEKEMATHSSVLAWRIPGTGEPGGLPSMGSHRVRHE
Ga0256703_10851097Ga0256703_108510971F032472VSSPIGLMASSIINNDAVQGETFLPGQIFVFGGFALRANSLGHLEQIESYVPGRQVRFGSLNFMADIRGDLILDGFEPQPSVPHCHDEHDLALRPDSILEAALEPAPIFNSKPAAQIEDGWLGAASGAATSMAIEPDTDFVPSEARDSKVPNSEPPAPPPMNLIGRRSWGSPPRTSFNTH
Ga0256703_10853678Ga0256703_108536784F096316MAWVEKDHSDHPVPTPCYVQGRQPADQAAQSHIQPGLECLQGWGIHSPLGQPVPAPSCPGSGTAAH
Ga0256703_10854066Ga0256703_108540661F004001VESPSLEVFKNRVDVALGDVVSGHGGDGLMVGLDDLRGLFQP
Ga0256703_10854688Ga0256703_108546882F005658MAWVEKDHNAHLVPTPCYVQGLQPSDQAAQSHIQPGLECLQGWGIHSLLGQPVQ
Ga0256703_10857189Ga0256703_108571891F052316MVKTRYTKADPNHMAEVEPMGPDEKESPVSLVYGQVELAAKYSQQDCKLDSLLDGIEEEYTQSN
Ga0256703_10857797Ga0256703_108577971F067310VLPNDIESLMTRLNEIPDRVQEWKKSAAWCGADVALSLVCVHCKEVRQYKVAAIKVANTQKHDFRTFMETFIAAATRIADGVDLDEFVEPASPPPAE
Ga0256703_10859192Ga0256703_108591921F079404ASEDWPLEWFYIEDVPLPDPVRIGLPEFDSAPLKKRLSWRPRSPQRENDKDGFYLMGRIRLLAHSGLPMIGSMAACIMRGVQPLQYRGRPMWDFNGEDDTTRHGRKEPDSAATLIKILSTLYKGEEEEFLRVNPQGGFSMYNPPRWVSGLLAHPFYIPIVKYSV
Ga0256703_10862420Ga0256703_108624202F034384VVLPRSCFLCLKVNLYARQSFPIVIFSFDHRLDSVIVLAEFCQNFEEETSRLEPNLDPGNSPVNDEVAMNVFRLESRVAAAVDYLARLKVATSRIDSTLWPGETLQNDLESLMARLNTIPGRVQEWKKSSARCGADVALCLARVHCKDAREDKLAALRVANTKKHDFRSFMETFLAAATRIADGIDLDEFVAPSSPPQEG
Ga0256703_10863078Ga0256703_108630781F104139LNEVWEGVDPGSTPSGHSGTLHAPELPWVGPAFPPGAQSLLQAMT
Ga0256703_10864794Ga0256703_108647941F002471DFDVDACSEHLVLISKLNKEVASLNAQLKTSKSNFDKLKFARDAYTVGRHPSVKDGLGFKREVKNLTSHKAPISAKEKGKAPMASNAKKNHAFMYYDRRNARNAYNDFDSHVYDSHAMFASSSSYKHDRDMCKRNVVHMPRRNFAHVPRKVVNKPSTIYYACNAPFAICRKGKKVIARKLGARCKGDKTCIWVPKDICANLVGPNMSWVPKSQA
Ga0256703_10866439Ga0256703_108664391F001813TNPGGVQRAFGCCVEGHGLVRTIGEGXMVGLDDPVGLFQP
Ga0256703_10867648Ga0256703_108676482F011632QALEWAAQRGGGVTEPGGVQRAFGCCVEGHGLVRTIGDRRMVGLEDPVGLLQP
Ga0256703_10869799Ga0256703_108697992F004815FKARLDVALGSLGCWLATLHIAGGWNWMSIVGLFNPGQSIIL
Ga0256703_10872127Ga0256703_108721271F011632GQALEWAAQRGGGVTDPGGDQGMFGRCVEGHGLVRTIDDGQMVGLCDPVALFQPW
Ga0256703_10873056Ga0256703_108730561F027342KSAKAEAQKALQEIDAMKKIAAGKAFYMQSKHVKVNYRLLTRIWSSSGAVADLPCNVSDAAQFYQAEDESSTEKLFWSQYAEAEHPVPMRDQLKQMVELHKAADQGMKSFIVRLWPSDALPNSFFILVRRLVDACPWLEVVKRSVCIEGAHRAFTRVKLQWVKLNALNLIKEGPPEGKEHRHPEMYYEGVLPGPRLIVDECSKDVI
Ga0256703_10873512Ga0256703_108735121F004815APSLQAFKARLDVALGSLGCWLVTLHIAGGWNKMSIVVLFNPGHSVIL
Ga0256703_10873679Ga0256703_108736792F079404YVEDAPLLDPIQTGLPEFSNAPLKKRLSWRPRSPQRENDMDVLYLMSRIRLLAHSGLTMIRVMATCIMRGVQPLQYRGHPMWDFNGEDDATRCGRKGPDSAATLTKILSALYKGEEEEFLRVNPRGGFSMYSPPSWVSEHFHLPNCFQIRAIEY
Ga0256703_10873941Ga0256703_108739413F098130PPPMMPIPHPHRRLGGGGLLDQRGHVRDWASPGWYWEVLPSGGRSLVRSHSVVHPNLVLWRSRGPVTVPRLPAPPEVVRRRVREEDEHVHRYMTAMDVRFSNTWQSLWGDDQSYDPVMVPSLWVSTARASGTASGLDSSVVFDLY
Ga0256703_10875492Ga0256703_108754921F038012MIIEFQPPCYVQGHQPPDQAAQSHIQPGLECLQGW
Ga0256703_10883790Ga0256703_108837901F006329MILELHVVDVVDDHKIKMDAMHLKIXKIXKYAIHTEAWYHYAVGSIVTLVAIMIAFVSALKCFT
Ga0256703_10887717Ga0256703_108877172F067310AMSRIDPTLWPEATLQNDLESLMTRLNEIPDRVQEWKKSSARCGADVALSLVRVHCKEVRQDKLAAIKVANTQRHDFRSFMETFIAAATRIADSVDLDEFVEPASPPPAE
Ga0256703_10889493Ga0256703_108894931F020492MGLQATLLTSAALHAEVNALKQNLERSENELGRAKKQLEDKEGM
Ga0256703_10890003Ga0256703_108900031F011632ALEWAAQRGGGVTDPGGVQRAFGCCVEGHGLARTIGEGRMVGLDDPVGLFQP
Ga0256703_10890696Ga0256703_108906961F011632ALEWAAQRGGGVTDPGGVQRAFGCCVKGHGLAGTIGEGRIVGLDDPVGLFQH
Ga0256703_10892238Ga0256703_108922381F027342KAAKAEAHKALQEIEALKKIAAAKAFFMQSKHVNVNYLLLTRIRSSPGAFADLPRSVSDAAAFYRAEEGSSTEKVFWSQYAEAGHPVPLSDQLKQLVELHKVAEQAMKDLIVRLWPKEAMPGSYFGLVRRLVDACPWVEVIKHSTCIEGARRALARAKVHWGKLDAEKLITDAPPAGKEYHTPEMNYKTVLKGARKIADEGLRDV
Ga0256703_10892668Ga0256703_108926681F027342MAGKKFFMQSRHVEEAFLLLTRVRSSPGAFADLPRSVSDAAEFYRAQEGSSTEKLFWSRYAGAEHATPLSDQLKQLVELHKAAKVAMKDFIVRMWPGEPLPTSYFGLIKRMVNACPRLEVIKRSVCIEGARRAFAHVKVHWGKLDPEKLVKDGPPEGKEHRHLEKYYDGVMKGARLVAHECTKDKIFD
Ga0256703_10893781Ga0256703_108937811F001813GVTDPGGVQRAFGCCVEGHGLARTIGDGRMVGLDDPVGLFQP
Ga0256703_10894765Ga0256703_108947651F032472ALLGPMAPSIINNNAVQGETFLPGQIFVFGRFALRAKSLGHLEQIESYAPGHQVRFGSLNYTADILEDLIFDGFEPQLCAPQWLDGHYIALPPNSALGAAHASVPTIDSEPTAPIEDQWLDAASGAAISEAIEPNSSPALHMAHDSEEPDSSPDFEAPAPLPIESDWAPIMECTAADVFQHSPFGDILKSLKSLSLSGEPW
Ga0256703_10894791Ga0256703_108947911F004815KARLDVALGSLVCWLATLHIAGGWNERSIVVLFNPGHSVILGFSSCDDSS
Ga0256703_10896692Ga0256703_108966921F081962SQRALAVVALSNEVPTHLAEVLRGFAVLPQRIQELRRASARAGAIAALSRAKAFLPELDPTDIALGYPSLKEDGTAFDQKDFADCVKTVRPVATLIGNDTYLTKYQPGYDAENQRIPTPRYEALNLIPPARQHTFAPEIDPAGLIDEEAQFEALSGIDWKSSTF
Ga0256703_10899746Ga0256703_108997461F027342KALQEIDAVKKIVEGKAFFMQGKHMKETFLFLTRVRSSPGAFADLPRSVLDAAEFYRAEEGSSTEKLFWSQYTGTEHPVSLSDQLKQLVELHKAAEQAMRGLIVRMWPGEPLSGSYFSLVRRLVDACPRLEVIKRSVCIEGARRAFARAKVHWAKLDAVKLVKEGPPEGKEHRCPEMYYDSVLKGSRLVAEECAKDVIFE
Ga0256703_10902795Ga0256703_109027955F001813VQETFGCGVEGHGLVRTIGDGWMVGLGDPVDLFQPW
Ga0256703_10905691Ga0256703_109056912F038012MVNLFQTPYYVQGCQPLDQAAQRHIQPGLECLQGWGIHNLLGQPVPVN
Ga0256703_10908092Ga0256703_109080922F011632GQALEWAAQRGGGVTEPGGVQRAFGCCVEGHGLARTIGEGQMVGLDDPVALFQP
Ga0256703_10908444Ga0256703_109084444F005658MAXVAKAHNAHPVPTPCYVQGRQPADQAAQSHIQPG
Ga0256703_10908773Ga0256703_109087732F020492MQASLLASAALTAEVDVLKQSLEKAEQELGRAKKQLEDKEGK
Ga0256703_10908802Ga0256703_109088021F059631FDLWLKTFNVKQKVVSSQQAECGGAMVGKMPNVLWLEGSFVETLKGWQSGWCYITKPRDPEGVAAPEFRSEPPTRLMSWKETGLSWGSKEGLTGLQTCIQNLVNKKLKLVNVGQVMLIRRILPCQQRDFNMWEFDSAQHQTLSRLFDTMYEEAWRVLFKGAEAPASDTEDRGFRSQRPASEVSDF
Ga0256703_10910860Ga0256703_109108601F001813DPGGVQGTFGRCVEGHGLMRANGDGWMVGLGDPVGRFQPW
Ga0256703_10911618Ga0256703_109116181F001813DPGGVQGTFGRCVEGHGLMRTIGDGWMVGLGGHVGLFKPW
Ga0256703_10911906Ga0256703_109119061F092835RFARLTIPGVHLLVRLQHSQFWPILTRFVDYYSPFWGPEAISTVVQPQGALTCQSSTLAVLADSDPFRGLLLTILGSWSDFHD
Ga0256703_10912018Ga0256703_109120181F105149MENGRITRLAIHEQDDEPPREAHVRPCEWPSEEFMVKAGIKDEFDAYVMNADLEEFMQDKCPQYYHLTDSFVRRFKFTSSRNSHNVLFDLYDKSYTMDLEDFTTTCKLPQWGNVHEPRKSEFRDFLASITVGEFRDIAQATIGSIHFP
Ga0256703_10913960Ga0256703_109139601F013401DGKKKKVKTNSSTKYESSSDDNASGEEDNLRTLFANLNMEQKEKLNELISAIHEKDDLLDSQEDFLIKENKKHVKVKNAYALQVEKCEKLSSELSTCHEIIDNLRNENARLIAKVDSHVCDASIPNLRNDNDDLLAKIKELNDSLASIRIENEKLIAKAKDFDVCNVTISNLRSENDILHAKVVEIKS
Ga0256703_10916709Ga0256703_109167091F001813WAAQRGGVVPDPGGVRRGVGCCVEGYGLMRAIADGWMVGLGDAVGLFQPW
Ga0256703_10917510Ga0256703_109175101F004815LQAFKARLDVALGSLGCWLATLHIAGGWNWMSIVLLCNPGHSRIL
Ga0256703_10918410Ga0256703_109184101F006329VVEPEIPTDPIVERLNLVEEENNYLKEKLKKIEEEKMILDFHVADVVDDHKIKMDSMRLKIRKIREYAIHTEAWYHYTIGSIVILVAIMK
Ga0256703_10918789Ga0256703_109187891F071823VSQLVKNPPATWDPPLGWEDPLEKGKATHSSILAWRVPW
Ga0256703_10921912Ga0256703_109219121F028669MYTQHEIKKQWFKCRSDEFITNVNKGDEERGGQTLLQIGVMWKGRWAIEKKEARIV
Ga0256703_10922243Ga0256703_109222432F096316MAWVEKAHNAHPVPTPCYVQGRQPAGQAAQSHIQPGLECLQGWGIHSLLGQPVQCVTKWISNIGEF
Ga0256703_10922651Ga0256703_109226511F071823ARLVKNQPAMWETGARSLGWEDPLENGKATHSSILTWRIPWTV
Ga0256703_10923280Ga0256703_109232801F005658MAWVAKEHSAHPVPTPCYVQGRQAAAQAAQSHIQPGLECLQ
Ga0256703_10924146Ga0256703_109241464F005658MAWVEKDHSAHPVPTPCYVQGRQPADRAAQSHIQPGLECLQ
Ga0256703_10927896Ga0256703_109278961F009131KSEIEDLRKQLARAKEERILEETKRELSDQWADHLEVTVEELRSSKKRCYNKSIDCVKKLKASFAKVGAFSSEENFSRGNPEGVIEWIDHEAEAFEEILNSRGDICAFSGARGIATILEKKGCEHVKILAQSEAALSFEDARDPSAEASMIGGKFFTDIWDNGGREMARKIIRKSEKGIQDAREVAEAAEKSAQPEGQLGIN
Ga0256703_10928297Ga0256703_109282971F004001PREVVESPSLEVFQSHGDVALRDVVCGHGGGGLEVGLDDLSGLFQP
Ga0256703_10928876Ga0256703_109288761F092835MNPGVRLRVGHQHWQFWPILAHFMDYYSLFWGPGVISMIDEPLGAFTCRSSTLAGFVDSVPFHGLLFTVLGTQRDFHFC
Ga0256703_10928876Ga0256703_109288762F092835VWSSTIAFWRILAHFMDYYSPFWGPEAISIVIEPEGALMCRSSTLEVLADSGLFHVLLLTVLGFRSDFHD
Ga0256703_10929576Ga0256703_109295761F034384MNVLRLESRIASATSYLARLKEVVSRIASTLQNDLESLMTRLNEIPDRVQEWKKSSARCGADVAMSLVRVHCKEAREDKLAVIKVANTKKHDFQSFMVTFIAAATRIADGIDLDSFV
Ga0256703_10929644Ga0256703_109296441F053764MVNTEIRLITFFAAEDGEALYSQQKQDWELTVAQIMNSLLPTSDLN
Ga0256703_10929774Ga0256703_109297741F011632MGGQPLQWAPQRGGEVTEPGGVQRVFGCCVEGHGLARTIGEGEMVGLDDPVGLFQP
Ga0256703_10929983Ga0256703_109299831F038084MPISFRIFQFIVIHTVKGFGIVNKAEIDVFLELSCFFDDPADVSNLMSASSAFSKTSLNIWKFTAHVLLEPGLENF
Ga0256703_10931022Ga0256703_109310225F096316MAWVEKDHNAHPVPTPCYVQGRQPADQAAQSHIQPGLECLQGWGIHSLLGQPVQCVTTLWVRNILLISNLN
Ga0256703_10931232Ga0256703_109312321F005658MAWVEKDHNAHPVPTPCYVQGRQPADQAAQSHIQPGLEC
Ga0256703_10931961Ga0256703_109319612F010678LVKPHLEYCAQFWAPQLKKKTEIAEQILAEETGTAAPEASSKVLDYIVRHASGKKLSEEEIFEANHYARELKYPKGAIVFNGTDEDDFLYCLPDNKELSVCREMARSMGFPKLEAGLCAMTKDDLADSLAYNSLKV
Ga0256703_10933750Ga0256703_109337502F014346VVLEKTLESPLDCKEIQPIHPKGNQSWVFIGRTDVETETPIFWLP
Ga0256703_10938685Ga0256703_109386851F011632LLXKGGQALEWAAQRGGGVTEPGGVQRVFGCCVKEHGLARPIDEGRLVGLDDPVGLFQP
Ga0256703_10940184Ga0256703_109401841F011632LLXKGGQALEWAAQRGGGVTEPGGVQRAFGCCVEGHGLAGTIGDGQMGGLDDPVGLFQP
Ga0256703_10940421Ga0256703_109404211F028669MYAWREIKKQRFKCWSDQFITNVNKGDEERGGRTLLQIGVMGKGRQATGKIGRSKNCVER
Ga0256703_10940465Ga0256703_109404651F067310SARCGADVALSLVRVHCKEVREEKLAAIQVANTRKLNFQDFMETFIAAATRIADGIDLDEFVAPSSPPLEE
Ga0256703_10943214Ga0256703_109432142F001813VQGMFGRCVEGHGLVRTIGDGXMVGLDDPVGLFQP
Ga0256703_10945665Ga0256703_109456651F081962TLVEQLYIRSLRALAVLSLSNDVPYLLQDVLQRLAVLPQRIQELRWAQARAGAIAALSRAKAWLPELDPADIALGYPSLKEDGTPFDEKDFTTCVRDIRPVATQIGNDTDLTKCQPGYDKENQRIPTPHYDDVNLIPPTRKHTFAPEVDPTGLIDDEAEFEALSGIDWASSSFQDKAAGGEAEKAKCGGFKSTPRVDCQAPPAYVIVEKQCHIIQTRGVL
Ga0256703_10946236Ga0256703_109462361F038012MIIEFQPPCYVQGWQPPDQAAQSHIQPGLECQEGKLY
Ga0256703_10947590Ga0256703_109475901F005658MAWVEKDHNDHLVSLPCRGQGHQPPDQAAQNHIQPGLERLHRXGIHNL
Ga0256703_10949003Ga0256703_109490032F011632WAAQRGGGVTEPGGVQRAFGCCVEGHGLAGTIGEGRMVELGDPVGLFQP
Ga0256703_10949374Ga0256703_109493742F004001VESPSLEVFKNRVDVALRDMGSRHGGGGLMVGLDDLGGLFQS
Ga0256703_10951241Ga0256703_109512411F011632WAAQRGGGVTDPGGVQRTFGCCVEGHGLVRTIGDGRMVGLDDPVGLFHP
Ga0256703_10954949Ga0256703_109549491F001813VQRTSGCCAEGHGLMRTIGNGXMVGLGDAVGLFQP
Ga0256703_10957190Ga0256703_109571901F028669MYAWREIKKQRFKCWSDQFITNVNMGYEERGGLTLLRIGVMVNGRMVIEKIGSRIKKSL
Ga0256703_10957556Ga0256703_109575561F020492MLLTSAAMTAEVDALKQSLERYENKLGLAKKQLEDKDGK
Ga0256703_10957953Ga0256703_109579532F020492MRMQALLLSTAALTAQVDVLKKDLERSEQELGLVIGQLEEREGKKNR
Ga0256703_10959003Ga0256703_109590033F068986CWPMMSEANMGGMAVEVEPSRQYSVTCGCCVTDGSSGAV
Ga0256703_10961735Ga0256703_109617351F002471KLNNEVASLNDQLKTSKSEFDKLKFARDAYTIGRHPSIKDGLGFKGEAKNLTSHKTPISTKEKGKAPMANSVKKNHAFMYYDRRYSRNAFRSNDVFDSHAYDSYAMTASSSHVMHGRNVFRRNVVHQMPRKNVVHNAPRKVVNEFSTIYHALNASFAICRKNRKIIARKLGAKCKGDKTCIWVPKSIVTNLVGPIKSWVHKSQA
Ga0256703_10963499Ga0256703_109634991F093003EALDAADRPPRGRDREASSPSTQAAPRTKAREYAPDLRDMLEDKARQTRSIYGSRGCPMARYGNRHAGHKFGGAEHSSQGSLELHHDIAQYRGAAHPLCFTDEIMDHQIPEGFKPVNIESYDGTTDPAVWIEDYLLHIHMARGDDFHAIKYLPLKLKGPARHWLKSLPTGSISC
Ga0256703_10967994Ga0256703_109679941F001813SPGGVQRAFGCCVKGHGLAGTIGEGRMVGLDDPVGLFQP
Ga0256703_10970237Ga0256703_109702372F004815APSLQAFKARLDVALGSLGCWLVTLHIAGGWNCMSIVVLLNPGRSMVR
Ga0256703_10972528Ga0256703_109725282F020492MGMQAALLTSAALTAEVNALKQSLERSENELGLAKKQLKDKEGK
Ga0256703_10975172Ga0256703_109751721F076748MPTPMRFIQLPGDSPPLYVSKSSFLQRDSSWFVWNDDEAVLFQNWETG
Ga0256703_10976217Ga0256703_109762171F011632GQALEWAAQRGGGVTDSGGVQRAFGCCVEGHGLAGTIGDGGMVGLGAPVGLFQP
Ga0256703_10978222Ga0256703_109782222F068298PGGPALEWAAQGGGEGIDPGGVQRVFGCCVEGHGLVGTIGEG
Ga0256703_10980109Ga0256703_109801091F004001VELPFLEVLKNCGRVALRNMVSRHGEGGFWVGLDDLRGLFQP
Ga0256703_10980393Ga0256703_109803931F079404VPRSHKGSIYQVGGAEIWRIARTGYPSGTPKKASEDWPSEWFYMQDAPLLDPVQIGLPEFSNAPLKKRLSWCTRSPQREDDGSVHYLMGRIRLLAHSGQTMIGIMATCIMRGVQPLQYRGHPMWDFNGENDATRHGRRGPSSAADLAKILSDLYKGAEEDFIRTNPLNGFSLN
Ga0256703_10985815Ga0256703_109858151F038012MTIEFQPPCYVQGRQPPDQAAQSHIQPGLECLQGWDIHNLLG
Ga0256703_10987255Ga0256703_109872552F020492MQASLLVSTALTAEVGTLKQNLERSEQELGLAKQQLEEKEGKKYLIEMCERCNCKK
Ga0256703_10989673Ga0256703_109896731F038012MIIEFQPPCYVQGHQPPDQAAQSHIQPGLECLQGWGIHNLLG
Ga0256703_10989706Ga0256703_109897061F006329MILELHVADVVDDHKIKMDAMRLKIRKIRKYAIHTEAWYHYVVGSIVTLVAIMIAFVFALKFFT
Ga0256703_10991969Ga0256703_109919691F004815FKARLDVALGSLGCWLATLHIAGGWSWMGTVGLFNPGRSVML
Ga0256703_10993723Ga0256703_109937232F020492MHMQASLLASATLTAEVDMPKQNLERSEQELGRAKKQLEDNEGKKYPV
Ga0256703_10996780Ga0256703_109967801F004001EVFKNCVGVALRDVVSGHTGHGLIFGLSALRGLFQP
Ga0256703_10997347Ga0256703_109973472F032472MASSIVNHDAVQGETFLPGQIFVFGGFTLRANSLGHLEQIESYDPGHQVRFGSLNYMADIHGDLIFDGFEPRPSAPHCHDGHDLALPPDSAQSAAQVSAPTPSSEPTTPVGDGRLDAAPGAAISTAIEPNTSLVLCEACDSKVPDSQRT
Ga0256703_10997753Ga0256703_109977531F038012MIIKFQPPCYVQGHQPPDQAAQSHIQPGLEYFQGRGIHNLLGQPVPVNIFVY
Ga0256703_10997947Ga0256703_109979472F096316MAWVEKDHNDHLIPTPCYVQGHQPADPAAQSHIQPGLECLQGWGIHSLLGQPVQCVTTLWGKNFL
Ga0256703_10998892Ga0256703_109988921F004001LFKNRGDVALRDVVSRYGGDGLVVELDDLTGLFQS
Ga0256703_10999554Ga0256703_109995541F099086SRPHSDPTKASSGPQPKDDDEIKKMAEAIMDQVVDRLLNEAAEIVLRED
Ga0256703_10999785Ga0256703_109997851F020492MGLQSVLLTSAALTTEVNTLKQSLEQSENELGRAKKQLEDKEGSKAH
Ga0256703_11000031Ga0256703_110000317F104139PLNEVWEGVDPGSSPSGHSGVLLAPEIPWAGPAFPPGAQSLFQAMT
Ga0256703_11000838Ga0256703_110008382F004001VESPSLEVFKGHRDVVLRDVVSGSGGGELMLGVNDLRGLFQS
Ga0256703_11001191Ga0256703_110011911F005658MAWVAKAHSAHPVPTPCYVQGRQPADQAAQSHIQPGLECLQGWGIHSLLG
Ga0256703_11003979Ga0256703_110039791F004815LDVALGSLGCWLATLHIAGGWNWMSITVLFNPGRSRIL
Ga0256703_11006396Ga0256703_110063963F028669MYAWREIKKQWFKCWSDQFITNVNKGEEERGGRTLLQIGVIGKGRQVIEKIERSKNCVKR
Ga0256703_11006975Ga0256703_110069751F028669MYARREIKKQRFKCWSDEFITNVNKGDGERGGRTLLRIGVMGKGKQAIDKIERGKNCIKR
Ga0256703_11008067Ga0256703_110080671F034384MNMLRLESRVAGVVDYLARLKVAVSRIDTALWPGATLQNDLESLMTRLNEIPGRVQAWKKSSTRCGADVALCLVRVHYKEGKEEKLAALKVANSKKLHFESFMETFLEAATRIADGINLDEFVEPANPPPAE
Ga0256703_11008158Ga0256703_110081581F081962NLNQNILTKLKAVYTLVEQLYTGSQRALAVVALSNAVPTHLADVLRRLAVLPQHFQELRRASARAGAIAALSRAKAWLPELDPADIALGYPSLKEDGTPFDQKDFAACVTDVRPVATLIGNDTDLSKYQPGYDADNQRIPTPHYEAISLIPPPRKHSFAPEVDPAGLIDDEAEFEALSGIDWKSSTFQDRETTGGVERDEPEASAQQHL
Ga0256703_11008528Ga0256703_110085282F076912LGKSALLSNGKGSNADKVQDSDTSLLVSNKADKTAKEDYLEDSETTPKSCLGLVFELLATTACTSYSNSLSESVRFLESQLQAERHRSAVLRQEAEGLRKSLEHSDAYFLVQQQALEDFSAKQDKANKLAKLIASMVDTQDNVS
Ga0256703_11013523Ga0256703_110135231F028669MYARRESKKQRFKCWSDQFITNVNKGDGERGGRTLLRIGVMGKGRR
Ga0256703_11013575Ga0256703_110135751F032472GKHCVPCLLLPSTSDAQFGTTSPRSAGFATDIGAFIKSSSMSSPLGLMAPTIINSDAVQGETFPPGQIFDLGGFALRANSLGHLEQIERYAPGRQVRFGSLNYTADIRGDLIFNGFEPLPSAPHCHDEHDLALPPNSALEAAPASASPLNPEPTAPIEDGWLDAASGAAIPTAIELNTSPALRETRDSMEPDSSPDSEPSAPLPIESDWVPIMEFTAADIFQHSPFGDILKTLKSLSLSG
Ga0256703_11013891Ga0256703_110138911F034384LTYPWIVKAEFCQNFEEETGRIEPGLDPINSLVKDETAMNLLRLESRIDSAVDYLARLKVAMSPIDPTLWPEAVLQNDIESLMTRLNEIPDRVQEWKKSAAQCGADVALSLVRVHCKEVRQDKLAAIKVSNTQKHDFRTFMETFIAAATRIADVVDLDEFVEPASPPPAE
Ga0256703_11017271Ga0256703_110172713F053764GHHQMVNTEIRLIIFFATEDGEALHSKQKQDWELTVAQIMNSLLQNSDLN
Ga0256703_11018000Ga0256703_110180003F038489MAWVEKDHNDHXVSTPRYVQGHQPPDQAAQSHIQPGLE
Ga0256703_11019635Ga0256703_110196351F005658MTWVEKDHSAHSVPTPCYVQGRQPAAQAAQSRIQPGLECLQGWGIHSLLG
Ga0256703_11022123Ga0256703_110221231F052316MVKTRYTKADPIHMAEVGPIGPDGKEIPVSLAYGQVELAAKYSQQDYKLDRLLDGIEEEYAESD
Ga0256703_11023383Ga0256703_110233831F104139YCQPLNEVWKGLDPGSPPSSHSDALHAPELPWVGPAFPPGA
Ga0256703_11026217Ga0256703_110262174F001813QGTFGRCVEGHGLMRNIGDGWMVGLGDPVGLFQPW
Ga0256703_11032349Ga0256703_110323491F009131HLEINVKELRASQRRCYVKSIECVKKIKSSFANVGAFSSEENFSRGNPEGPMEWISHEAEAFEEILNSRGDICAFSGARGIATVLEKKGCEHVKSLAQSEATLSTEDIKNPSPEASMVGGKFFTDIWDNGGRELAQEIIQRSEKGIHDARKVAEAAEKSTEPGGHIGIN
Ga0256703_11033006Ga0256703_110330062F063479MGARNWSETHWIARSTRGGGRPKSGEVDLGPPVKSGRVRGLGELHGLLAELAEAQVGLEGGWSGLATAAVALAAMAGGNTLAGAKERWLADEGECGAKWGAPGEAL
Ga0256703_11033711Ga0256703_110337111F033854VTAEGHSGKMTSDMEVCVKQRCVIEFSHVEKTASTDIHGHLLNLSGDQTVDVSTVQRWDGLFQQW
Ga0256703_11033765Ga0256703_110337651F035108MGDLLPELSQLLDRVRQAMQGVAQALSPSVSMPEGLGELAEKLKGARRCFQLWKVSACRQGAREAWAMVKTRYAKADPNHMTEVGPVGPDGKEIPVSLVYGQVELAAKYSQQDCKLDSPLDGIEEEYNQSE
Ga0256703_11036179Ga0256703_110361791F033854MQQMVAEGQSCKMTSDMDVYLKERCEIEFLHVEKKEPTDIYXCLLNAYGDQTVD
Ga0256703_11038232Ga0256703_110382321F004815QAFKARLDVALGSLGCWLATLHIAGGWNGMSIVGLFNPGHSVILRLALL
Ga0256703_11042663Ga0256703_110426632F001813GVQGTFGHCDEGHGLMRTIGDGWMVGLDDPVGLFQP
Ga0256703_11045798Ga0256703_110457983F096317VNKQAVPLAAAARTAEVTRLKRDLEQAQGELSLMKRKLEENKGK
Ga0256703_11046155Ga0256703_110461551F086390RDITQATIGSIHFPAIHYFALFIGRCINGKDGACHMCVPDLSILRSAVLGDKTYNLGAIVARRLHHNRFNGDFFGGIYATRLADFLGVDIREDDIELPPTYLDYNAMVHHQFVERNESPLRYRLIFDRRRAVRITLPAPAFFDYQAKGRYVITREEADEYERRAEAARRHAAAQEAITAASQYDPSYTDGYSPGHPWQ
Ga0256703_11047820Ga0256703_110478202F004815DVALGSLVCWLATLHIAGGWNWMSIVVLFNPGHSMIL
Ga0256703_11048194Ga0256703_110481948F065281MAKKSIVTSIRLNEDDYLKLKELKEKYNLSWTKLVSYVNTLLEN
Ga0256703_11048558Ga0256703_110485581F062313QEEKRTTEDEMVGWHHQLDGHGFGWTPGVGDGQGGLACCGSWGHKESGTTESLN
Ga0256703_11057338Ga0256703_110573381F032472DVGFYLHQEGLNLGKPSCPFSPVTIRLAAHFGTPYPRSAGFDTDIGAFIESSSVSSPIGLMASSTNNAVQGETFLPGQIFVFGGFALRANSLGHLEQIESYAPGRQVRFGSLNFTADVRGDLIFNGLEPQPSVPHCYDGHDLALLPNSALVAAHESALAFSPEPIARIED
Ga0256703_11057469Ga0256703_110574692F001813QRGGGVTNLGGVQRVFGCCVEGHGLAGTIGEGRMVGLGDPVGLFQP
Ga0256703_11058885Ga0256703_110588851F005658MAWVEKAHSAHPVPTPCYVQGRQPAAQAAQSHIQPGLECLQGWGIH
Ga0256703_11058985Ga0256703_110589851F001813VTEPGGIQRAFGCCVEGHGLAGTIGDGQMVGLDDPVGLFQP
Ga0256703_11059450Ga0256703_110594501F028713LVKVDTLKNVADGLTKSMSTWKFSWFRETIGVAKLR
Ga0256703_11059711Ga0256703_110597112F059631VCEAFLRIRPHFGLWLKTFNIKPKVVGGQQAECGGAMVGKMPNVIWLEGSFVETIKGWQSAWFYITEPRETKWVAAPKFRSGFPTRLTSSKENGLSWGSWVELDGLQKCIRSMASKKLKLVNIVQVMLICRILPCQQRDFNLWEF
Ga0256703_11064523Ga0256703_110645231F001813GGVTEPGGVQRAFGCCVEGLGLARTMGEGRMVGLDDPVGLLQP
Ga0256703_11065113Ga0256703_110651131F011632AAQRGGGVTEPGGVQRAFGCCVEGHGLARTIGEGRMVGLDDPVGLFRP
Ga0256703_11065402Ga0256703_110654021F001445HACMHALEKEMATHSSILAWRIPGTEEPGGVPSMGSHRVKHD
Ga0256703_11067480Ga0256703_110674801F005658MAWVEKAHNDHLFQPLCYVQGGQPPDQAAQSHIQPGLECLQGWGIHSLL
Ga0256703_11069269Ga0256703_110692691F105149MLRRMYQGGSSAKKGPRIAIREQDVNLPRDANVRACEWASDDFMVEAGFKGEFDAYVRNAELEDFLQDKCPQYYQLTDSFMRRFEYISSRNSPSVMFDIYDTSYTMDL
Ga0256703_11069323Ga0256703_110693231F068298LLLXKGGQALEWAAQRGGGVTDPDGVQRTFGCCAEGCGLVRTIG
Ga0256703_11072441Ga0256703_110724412F068298CLKYHISLEWAAQRGGGVTDPGGVQRAFGCCVEGHGLARTIGEGQTNGWTG
Ga0256703_11074951Ga0256703_110749511F096317VNKQASLLAAAARTSEVSGLKQDLERSKEELGLVKRQLEENKGK
Ga0256703_11076444Ga0256703_110764441F004001SLEVFKSHVDVALRDVGSSHGGDVLMVGPGGLSGHFHSL
Ga0256703_11077013Ga0256703_110770131F027342VAVVRQELQALMEKHESLERDSKTQESELASALESAKTAKADAHKSLQEIELVRKIAAGKAFFMQSKHVNVNYVLLTRIRSSPGAFADLPRSVSDAAAFYQAEEGSSTEKVFWSQYAEAGHPVPPSDQLKQLVELHKAAEQAMKGLIVRLWPGEAMPGSYFGLVRRLVDACPWVEVIKRSACIEGARRALARAKVHWGKLDAEKLITDAPPAGKEYRTPEMYYKTVLKGARKIADECPRDVIIE
Ga0256703_11080296Ga0256703_110802964F004815VDAPSLQAFKARLDVTTLHTAGGWNWMIIVVLFNPGHSIIL
Ga0256703_11085052Ga0256703_110850522F083289LECEEGDAAYAESVCATKELKFYKDHVDPADMTSLKKPTTKHEPELKFKSADDIKMVNFVPGDSSKQFIISANLDPK
Ga0256703_11085789Ga0256703_110857892F083289KFMVRPCDVYLQLKMPGYKDTITLHGSRKVALECEEGDAAYAESVCATEELKFYKDNIDPADMTPLKKPTIEHDQVLKFKSVDDTKLVDFVPGDSSKQFSISANLDPK
Ga0256703_11087450Ga0256703_110874502F001813VPGGVQRAFGCCVEGHGLAGTIGEGRMVGLDDPVGLFQP
Ga0256703_11091529Ga0256703_110915291F093003PRLEEEAYDAADRPPRGREREAFQPKTKPAPQRHSNKEAWGNMPDLRDILEDKEKHSRSIYGSRGSTTLRDGKRHAGYSKSKSGRAEHSRQDPFELHRDIAQYRGAAHPLCFTDEVMEHQLPEGFKPVNIESYDGTTDPAVWIEDYLLHIHMARGDDFHTIKYLPLKLKGPARHWLNSLPAESISCWEDLEAAFLDNFQ
Ga0256703_11092978Ga0256703_110929781F067310MKEWKKSSARCGADVALSLVRVHCKEAREEKLAAIKVANTKKHDFQSFMKTFIAAATRIADGIDLD
Ga0256703_11098755Ga0256703_110987552F004815LEVFKARRDVALGCLVWWFVILHIAEGWNWMSIVVLLNPGHSMIL
Ga0256703_11104284Ga0256703_111042841F086390FIGRYINGKDEACHMCVPDLCVLKSVVLGNKDYNLGAIVACRLHNNGMSGDLFGGIYATHVANYLGIAPREGDMELLPAYLDYDAMVKHHFLLRNEQFLQYRLIFDRHSSVHVTLPAPFLFDYQAKRRYVVTREEAAEHEGRAEAARQHIPQIRRHLLLHLSTTPVTTTDISQAILGIRP
Ga0256703_11108334Ga0256703_111083341F096317VNKQAVLLAAAAYTTEVTGLKRDLEQAEEELSLTKRQLEENKGE
Ga0256703_11110403Ga0256703_111104031F079404TPKKVSEDWPSEWFYMEDAPLPDPIRIGLPEFSNAPLKKCLSWCPRSPQREDDGSVQYLMGRIRLLAHSELTMIGVMATCIMRGVQPLKYRGHPLWDFNGEDDATRHGCKGPGSVANLVKILSDLYKGEEEEFIRIKPWDGFSLYNPPSWGSCYILLQTFPHALS
Ga0256703_11111214Ga0256703_111112141F059631RPHFGLWLKTFNVKPKVVSGQQVECGGAMVGKMPNVTWLEGSYMETIKGWQLGWFYITEPRDPAWAAAPEFRSGIPTQLTSWKEKGLLWGNSTELTGLRACIQKLVNKKLRLVNVVQVMLIRRILPCQQRAFKLWEFNPAEHQALSGLFDTTYEGTWRVLFKGAEAPA
Ga0256703_11112456Ga0256703_111124561F096317MNKQAMLLAAATRTGEIASLTQDLERAQGELGLTRRQLEESKGE
Ga0256703_11114102Ga0256703_111141021F005658MAWVAKEHNAHAVPTPCYVQGHQPADQAAQSHIQPGL
Ga0256703_11115635Ga0256703_111156352F000305HQLPCLKRKLVHSALLCFWSLDKKQIHQTQCMQLFIVTYQGGVLLSRIVIDGLQPLESNKYQVEFDPGRRELVSTCEKIKFLHKIIINLH
Ga0256703_11115973Ga0256703_111159731F020492MGLQAALLTSAALTAEVSVLKQDLEWSEQELGHAKKQLEDKEGE
Ga0256703_11117151Ga0256703_111171511F098130YFTFAAHSICCRRCPARILAVRDDVLLQRTHVRDWAPPGWHWEVLPSGARHLVRNPAPGPVVDPHLLWWRSRGPLSVRREPAPPEVVRRRVREEDEHVRRYMAAMDVRFSNTWQVLLGDHPSYDPVMVPSLWVSTARTSGTASGLDYSVVFDLY
Ga0256703_11119540Ga0256703_111195401F034384DHCLDSVIALAEFCQHFEEETSRLEPNLDPVDSPVNDEVAMNVFRLESRVAAAVDYLARLKVATSRIDSMLWPGETLQNDLESLMARLNAVPGRVQEWKKSSARCGADVALCLARVHCKDAREEKLAALRVANTKKHDFRSFMETFLAAATRIADGIDLD
Ga0256703_11122088Ga0256703_111220881F094706LVAMAPQLSPFTRTSDVTIPRQLAPTVGPAHGGFEFLKGNFEGLKRYAMGRMTKSRRGKLYINDAGWGPEAGSIEYGYRVPFGGIHVFIGKICEPGPEPDICTDLVETAQRASPARVQPTVKRAFVGFINGAELEPASDGETVVYSDDESSPGETESLYQLQDGQFGGYFDGDSIPDPFEPSNRVAIFMAGTQPMLQSSTA
Ga0256703_11122976Ga0256703_111229761F001813QGGGVTNVGGVQGTFGHCVEGHGLVRTIGDGWMVGLDGPVGLFQPL
Ga0256703_11126027Ga0256703_111260271F038489MAWVEKDQNAHPVPTPCYVQGRQPAAQAAQSHIQPGLECL
Ga0256703_11126519Ga0256703_111265191F004815QAFKARLDVALGSLGCWLATLHIAGGWNWMSIAVLCNPGYSIIL
Ga0256703_11131771Ga0256703_111317714F001813MQNRATEAGGVQRAFGCCVKGHGLARTIDEGRMVGLDDPVGLFQP
Ga0256703_11132392Ga0256703_111323921F086390HFPAIHYFALFIGRCINGMDVACHMCVPDLSILRSAVLGDKSYNLGAIVARRLHLNRFNGDFFGGIYATRIANFLGITIREDDIELPPAYLDYEAMVRHHFVERNDQFLQYRLIFDRQRTYHVALPASTFFDFQAKGRYFITREEADEYKRRAEIARLQAAAHDAMTAASQYDPNYNFGYPLGHPCH
Ga0256703_11133134Ga0256703_111331341F020289MTKDEMVGRHHQLNGHEFEQAPGDGEGQGSLACCSPRGCKESATTERLNNSRIN
Ga0256703_11134563Ga0256703_111345631F053764MVNTEIRLIIFFATKDGKALYTYQKQDGELTVAQIMNSLLPNSDLN
Ga0256703_11135253Ga0256703_111352535F068298RGGGVTDPGGVQRVFGCCVEGHGLARTSGEGQTNGWTG
Ga0256703_11135426Ga0256703_111354261F035108MLTGRPAEEMPTSTGDLLPELMQLHERIRQAMRGVAQALWPAHSMPEGLGELAEKLKGARQRFRLWKISACRQGAREAWAMVKTRFTKSDPNHMAEVGPVGPDGKEIPVSLVYGQVELAAKYSQQDCKLDSLLDGIEEEYN
Ga0256703_11136548Ga0256703_111365481F032472YPRSADFDTDIGAFIESSSASSPSGLMAPTIINSDAVQGETFLPGQIFIFGGFALRANSLGHLEQIESYAPGRQVRFGSLNYTADIRGDLIFDGFEPLPSTPHCHDEHDLALPPNSALEAAHASVPTLNSEPTAPFEDEWLDAASGAMISKAIEPNTSPALCKARDSEGPDSSPDSEPSAPLPIESDWVPIMEFTAAD
Ga0256703_11136714Ga0256703_111367141F005658MAWVEKDHSAHPVPTPCYVQGRQAAAQAAQSHIQPGLECLQGWGIHSLLGQPV
Ga0256703_11139645Ga0256703_111396451F007409MSEAAKKAAAEMKLSLDEEKNLGFLIAMSKSNTEKITKEILEGLSEDTGDSESYDMDSGGEDSEDRPWRPSHSVYGKSTIKENHLVNMRGRYFRDLSVVRADEGEKTCPHPEENEI
Ga0256703_11142361Ga0256703_111423611F032472QGETFLPGQIFVFGGFALWANSLGHLEQIESYTPGHQVRFGSLNFTADIRGDLIFAGFEPQPSAPHCHDGHDLALPPNSALEAAPVAAPTPSSEAITPIEDGWLDTASGAAISTAIKPNTSLVLCEARDSKVLDSSPDSEPAVPLPIESDCSPIMEFVAADISQHSPFSDILNSLKSLCLSGEP
Ga0256703_11144756Ga0256703_111447562F001813GGGVTDPGGVQGTFGCCVEGHGLVRTTGDGWMVGLGDPVGLFQPW
Ga0256703_11144970Ga0256703_111449702F096317LNVNKQVVRLAATARTAEIAGLTRDLEQAQGELGLARRQLEESKGKWFPYLL
Ga0256703_11145677Ga0256703_111456777F033854MAPEGQSDKMLSDMEVHVKQRCVIEFIHAGKIAPTDIHWCFLSIYGNQTVDGAH
Ga0256703_11146425Ga0256703_111464251F004001PRELGESLSLGVSNKHGDVALKDMVSGHGGVGLMVGLGDFRGLFQP
Ga0256703_11147795Ga0256703_111477951F001813GGGVTDPGGVQGTFGRCVMGRGLGRAIGDGWMVGLGDPVGLFQPSMIL
Ga0256703_11151016Ga0256703_111510161F001813GGGVTDPGGVEGTFGCCVEGHGLVRTIGEGRMVGLGDPVGLFQP
Ga0256703_11152557Ga0256703_111525571F034384SLVKDETAMNVLRLEYRAAAIVDYLARLKVATSRIATTLWPGETLQNDLETLMTRLNELPSRVQEWKKSSARCGADVALSLARVHCKEAREDKLAALKVANTKKHDFRSFMETFIAAATQIADGIDLDEFVAPSSPPQEG
Ga0256703_11152764Ga0256703_111527642F001813GGGVTDPGGVQGTFGRCVEKCSLVRTTGDGWVVGLGNPVGLFQPL
Ga0256703_11156552Ga0256703_111565522F020492MGLQAALLASAALTAEVNALMQSLERSANELGHAKKQLEDKEGA
Ga0256703_11159814Ga0256703_111598142F096316MAWVEKDHNANPVPTPCCVQGRQPAAQAAQSHIQPGLECLQGWGIHSLLG
Ga0256703_11160284Ga0256703_111602842F001813PGGVQRAFGCCVEGHGLARTTGDGLMVELDDPVGLFQL
Ga0256703_11161441Ga0256703_111614411F093003EEYKLECPSKSYPKRRLLSQLEEEATKPTSPAYDAPKRPPRGRDREAFSPSNQAAPRRRSKNTRARGNATDLRDILEDKARQTRSIYGSRGRPTSRDDNGHAGYEKYGQAEHNRQSSSDLRRDIAQYRGAAHPLCFTDEVMNHQIPESYKPVKSNHTKAQQILRYRSRII
Ga0256703_11162788Ga0256703_111627882F020828MPGSYFGLVQWLVEACPRLIVIKRSVFIEDARRALARAKVLWGKMDAEKLVTDAPPLGKEYRTPEMYYKGILKGARLIAGECSKDVILSRLAFVILYAENFVHVR
Ga0256703_11167572Ga0256703_111675722F001813GGVQRVFGCCVEGHGLMRTIGEGQMVGLDDPVGLFQP
Ga0256703_11168061Ga0256703_111680611F104139MRYLYLHYQPLNEVREGVDPGSIPSGNSGTLHAPELPCVGPAFPPG
Ga0256703_11168402Ga0256703_111684021F038012MIIQFQLPCYVQGRQPLDQAAQSHIQPGFESLQGWGIHNLLG
Ga0256703_11170569Ga0256703_111705692F035626QGETFLPGQIFVFGCFALRANSLGHMEQIESYAPGRQVRFGSLNYTANVRGDLIFDGFEPQPSAPHCHDGHDLALPPYSA
Ga0256703_11170982Ga0256703_111709821F081962QLYTGSQRALAVMALSNEVPTHLADVLRRLAVLPQRFQELRRASARAGAIAALSRAKAWLPELDPADIALGYPSLKEDGTPFDQKDFAACVKDIRPVATLIGNDTDLTKYQPGYDAENQRIPTPRYEAISLIPPTRKHTFAPEVDPAVLIDDEAEFEALSGIDWKSSTFQDRETAGG
Ga0256703_11171453Ga0256703_111714531F012765MEELDNQRCKLQESTDEVIRLKQLISAKDTTIKELRASKKCITQELETARLAAKVADETSITLRAQRDRAMDKAIRAGRILMRRPGVVVPEDIRADVNAAPDSSSRPSSSIAPEKNITK
Ga0256703_11173785Ga0256703_111737851F001813TEPEGVQGTFGCCVEGHGLARTIGEGRMVGLDDPVGLFQP
Ga0256703_11174881Ga0256703_111748811F006329PTDPIVERLNLVEEENNLLKEKIRKIEEEKMILKLHVADVVDDHKIKMDAMRLKIRKIRKYVIHTEAWYHYAVGSVVTLVAIMIAFVFALKCFT
Ga0256703_11175194Ga0256703_111751941F035626MAPSIIGNDAVQDEVFLPGQIFVFGGFVQWANSLVHLEQIDSYAPGHQVRFGNLNYTADIRGDLIFAGFEPMSEAPHTHDEHDVTLPSDNIREITSATTPAVNPEKIAPSESTGIDPATEVVLSAAIDPNTDFTPYESRVAEP
Ga0256703_11176883Ga0256703_111768831F027342GAFADLPRSVSDATAFYRAEDGSSTEKVFWSQYAEAGHPVPLSNQLKQLVELHKMAEQAMKGLIVRLWPKEAMPGSYFGLVRRLVDACPWVEVIKHSACIEGARRALARAKVHWGKMDAQKLVTDPPPEGKEYRTPEMYYKSVLKGARTIAGECSKDVIFE
Ga0256703_11177071Ga0256703_111770711F001813IDPGGVQRAFGCCVEGHGLAGTIGEGGMVGLDDDVGLFQP
Ga0256703_11179114Ga0256703_111791141F007409MSEDKKAGPEMKLSLSEEKNLGFLIAMAETNTEKITKEILEGLSEDTGDSDSYDVDSGGEESEDRPWRRSHAVFGKTTI
Ga0256703_11180563Ga0256703_111805633F001813GGVQRVFGCCVEGHGLAGTIGDGRMVGQDDPMGLFQP
Ga0256703_11182940Ga0256703_111829401F011632LEWAVQRGGGVTEPGGVQRAFGCCVEGHGLVRTIGDGKLVGLDDPVGLFQP
Ga0256703_11186327Ga0256703_111863271F001813GGGVTDLGGVQRAFGCCVEGHGLARTIGEGRMVGLDDPVGLFQP
Ga0256703_11186895Ga0256703_111868951F034384SRLSAVVDYLARLKAATSRINTSLWPEETLQNDLESLMARLNEVPSRVQEWKKSSARCGADVALSLVRVHCKEAREDKLVSLKVANTRKHDFRSFMETFIAAATRIAAGIDLDKFVAPSSPPQEG
Ga0256703_11190568Ga0256703_111905682F001813GGVTEPGGVQRAFGCCVEGHGLARTIGEGRMVGLDDPVGRFQR
Ga0256703_11193326Ga0256703_111933261F011632LECAAQRGGGVTEPGGVQRAFGCCAEGHGLVRTIGDGXMVGLDDPVGLFQP
Ga0256703_11193758Ga0256703_111937581F028669MYARREIKQQRFKCWSDQFITNVNKGDGERGGRTLLRIGVMGKGRRAIENIERGKNCVKQ
Ga0256703_11194549Ga0256703_111945491F067310CKESREDKLAAIKVANTKRHDFQSFMETFIAAATRIADGIDLDEFVEPASPPPAE
Ga0256703_11195531Ga0256703_111955311F027342LESAKSAKAEAQKPLQEIEAMKKIVASKAFFMQSKHVKVNYLLLTRIRSFPGAFTDLPRSVSDVAKYYKAEEGSSTEKLFWSQYTGTEHPMPVSDQLKQLVELHKAVEQAMRGLIVRMWPGDSLPNSYFDLVRRLVDACPRLEVVKRSFCIEGACWAFARAKVHWAKRDAEKLVEEGPPQGKEHRHPEMYYEGVLKGAHLVADECAKDVIFE
Ga0256703_11196791Ga0256703_111967911F032472CAVVRRFDGPIHHLQQRCQGDVFLPGQIFIFGGFALRANLLGRLEQIESYAPGCQVRFGSLNYTADLRGDLIFDGFEPQPSTPHCHDGHDLALPPNSAMGAAPVPAPTLSSEPIAPIEDGWLDSASGAAISTVIEPNTNPVLCEARDSKVPDSSPDYKPSVPLPIES
Ga0256703_11203683Ga0256703_112036832F104139MNYPALLCQPSHEVWEGVDPGSIPAVHSAALHALELPSVCPAFPPGAQSLVQAMT
Ga0256703_11205617Ga0256703_112056171F005658MAWVEKYLKDQLVSTSCNVQGRQPAHQAAQSHIQPGLECLQGWGIHSL
Ga0256703_11207344Ga0256703_112073441F027342AEAQKALQEIEAMKKIAARKAFFMQSKHVKVNYLLLTRIRSSLGAFADLPRSVSDAAAFYRAEEGSSTEKVFWSQYAEAGHPVPLSDQLKQLVELHRAAEQAMKCLLVRLWPGEALPGSYFGLVRRLVEVCLRLEVMKRSICIEGARRALARAKVHWGKLDAEKLVKDGPSPGKEHRKPENYYKDVLKGAC
Ga0256703_11210330Ga0256703_112103301F006329MKLELYVDDVVDDHKMKMNAMRLKMDAMRLKIMKIRKYAIDNEAWYHYAIGSIVTFVAIFIAFVVMWLSFL
Ga0256703_11210386Ga0256703_112103861F034384KVAMSRIATSLCPGTPLQNDLESLMARLNEVLGRVAEWKKSSARCGADVALSLVRVHCKEAREEKLAAIQVANTRKHSFQDFMETFIAAATRIADGIDLDEFVAPSSPPPEE
Ga0256703_11213916Ga0256703_112139161F034384MNVLRLESRVTSVDDYLARLKAAMSRIDTSLWPGTTLQNDLESLMVRLNEVPGRVAEWKKSSARCGADVALSLVRVHCKEAREEKLAAIQVANTRKHNFQDFMETFIAAATHIADRIDLDEFVAPSSPPHEE
Ga0256703_11216587Ga0256703_112165871F028669MNARREIKKQRFKCWSDQFITNVNKGDGERGRRTLLRIGVMGKGRRAIEKIERGKNCVKR
Ga0256703_11217503Ga0256703_112175031F104139NDVCEELDPGSTPSSHSAALHAPECPWVDPAFPPGALSLFQAMT
Ga0256703_11218081Ga0256703_112180811F001813AQRGGGVTEPGGVQRAFGCCVEGHGLVRTIGEGRMVGLDDPVGLFQP
Ga0256703_11218212Ga0256703_112182122F011632MQLYKYYFSERVGQALEWAAQRGVGVTEPGGVQRAFGWWVEGHGLARTIGEGRMVGLGDPVGLFQP
Ga0256703_11220273Ga0256703_112202732F020492MGLQAALLTSAALTAEVNALKQSLERSENELGRAKKQLEDKEGE
Ga0256703_11222018Ga0256703_112220181F001813RAAHRGGGVTDPGGVQGTFGRCVEGHGLVRTVGDGWMVGLGDPVGLFQPW
Ga0256703_11224809Ga0256703_112248091F079404VPCTQRGSLYQVGGAKIWRIAGIGYLSGTPKMSSEDWPLEWFYMEDVPLPDPVRRGLPEFSNAPLKCRSWRPRSPQEEDSGEVLYLMNRINALAQSGLTVIEVMSICIMRGVKPLQYRGHPLWCFNGADDATRCGRKRPDNAATLAKILSELFKGEEEEFIRIKPRDGFSMYNPPSW
Ga0256703_11225387Ga0256703_112253871F001813GGGVTEPGGVQGMFGCCVEGHGLVRTIGDGWMVGLGDPFPTLVIL
Ga0256703_11225550Ga0256703_112255501F076912LWKSALLSNGKGSNVNKVQDSDTSCLGLVLELLATTACTSYSNSLSESVQFLESQLQAERHRSVVLRQEAEGLRKSLEHSDAYFLVQQQALEDFCAKQDKANKIDNLIASMVDTQDNIS
Ga0256703_11234954Ga0256703_112349541F005658MAWVQKDHNAPLVPTPCYVQGHQPADQAAQSHIQPGLECLQGWGIHS
Ga0256703_11236823Ga0256703_112368231F011632MGGPALEWAAQSVTDPGSVQGTFGCCVEGHGLARTIGEGRMVGLDDPVGLFQP
Ga0256703_11237862Ga0256703_112378621F104139LPTFKEVWEGLDPGSTLSGHSGALHCMHAPELPWVGPAFPLGAQSLLQAVT
Ga0256703_11239109Ga0256703_112391092F076748MRFIQLPGDSPPFYVSKSSFLQSDLSWFDWIDEEAVLFPNWETGIT
Ga0256703_11241160Ga0256703_112411602F038084SSRTPITLRIYQIAVIHTVKSFRLENQAKVDVFLELSCFFDDPVDVGNLISGSSVFSKSSLNIWKFMIHVLLKPGLENFEYYFANV
Ga0256703_11241555Ga0256703_112415551F001813GVTNPGGVQGTFGRCVEGHGLARTIGDVWVVGLGDPVGLFQPW
Ga0256703_11245999Ga0256703_112459993F038084VVWYSILFQNFPQFIVIHTVKGFGLVNKAEVDVFLELSCFFHDPVNVGNLISGSSAFSKTSLNIRKFTVHILLKPGLENFEHYFTRV
Ga0256703_11248908Ga0256703_112489081F001813VQGTFGCCVERCGLVRTIGDGRTAGLGDPVGLFQPL
Ga0256703_11249743Ga0256703_112497431F028669MYARREIKKQRFKCWSDQFITNVNKGDEVRGGRTLLRIGVTGKGRQASEKGGNRCKEA
Ga0256703_11256311Ga0256703_112563111F093003RRLLPRLEEEAPTLPAHDMADRPPRGCDREASWPSAQAMPRRRVKHTKAWENAPDLRDILEDKARQTRSIYGPRRRPTARDGDLHSGYNKSGRAEQSRQSSFELRRDIAQYRGAAHPLCFMNEVMDHKIPEGFKPINIESYDGTTDSTVCIEEFLLHIHMAHRDSLHAIK
Ga0256703_11258517Ga0256703_112585172F023843MERNSKMEIEKFNGKSFELWKLKMEDFLVDKDQWIAVDPGTNPTGVSDED
Ga0256703_11259171Ga0256703_112591711F092835VRLRVGYQQSQLWPVLARFVDYYSLFWGPGVIYTINEPWGAFTFRSSTLTVFIDSDPFYGLLLTVLGSESI
Ga0256703_11261492Ga0256703_112614925F005658MNQRMAWVEKDHSAHLIPTPCYVQGRQPAAQAAQSH
Ga0256703_11265964Ga0256703_112659643F035108MSVGLLTGRPAEEMPDSTGDLLPELLQLLERVRQAMRGVVQAMWPSLSMPEGLGELANKLEGVRQRFRLWKISAYRQGAREAWAMVKTRYTKADPNHMAEVGPIGPDGKEIPVSLAYGQVELAAKYSQQDCKLDRLLDGIEE
Ga0256703_11268001Ga0256703_112680011F035626MASSLVNRDASRDETFLPRQIFVFGGFALRANSFDHLEQIESYAPGHQVRFGSLNYTADIRVDLIFDGFKPQPGAPHRRDGYDLALPPNSTPEAVPASAPTLSS
Ga0256703_11268349Ga0256703_112683491F028669MYARREIKKQRFKCWSDQFITNVNKGDGERRGRTLLRIGVMGKGRRAIEKIERGKNCVKR
Ga0256703_11276065Ga0256703_112760652F020492MGLQAVLLTSAALTAEVNTLKQSLEPSENELARAKKQLEDKEGE
Ga0256703_11285336Ga0256703_112853363F004001ESPSLEVFKKHVDVALRDVVSGHGGDGLVVGLGHLSDIFQP
Ga0256703_11286029Ga0256703_112860291F020828MEKVFWSQYAEVGHPVPLSDQLKQLVELHKAAEQAMKGLIVWLWPKEAMPGSYFGLVRRLVDACPWVEVIKHSACIEGARRALARAKVHWGKMDAQKLVTDPPPEGKEHRTPEMYYKSVLKGARTIAGECSKDVIFE
Ga0256703_11290252Ga0256703_112902521F002471IDINACSEHLVSISKLNDELASLNAQLKASKSEFDKLKFARDAYTIGRHPSIKDGLGFKREAKNLTSHKAPIPAKEIGKAPMATSAKKNHAFLYHDRKNSRNAFRSYDAFDSHAYDSYAMTASSSHVVHDRKVGRRNVIHNMPRRNVVNAHRKVHGPSTIYHALNASFAICRKDRKIVARKLGAKCKGDKTCIWVPKEICTNLVGPNKSWVPKSQA
Ga0256703_11293443Ga0256703_112934431F104139NEVWEGVEPGSGGSSLHAPELPWVGPAFPPGAQSLVPAVT
Ga0256703_11294166Ga0256703_112941663F004001VQSPSLEVFKGHVDVALRDMVSGYGGGGFVLGQGDLKALFQHSIL
Ga0256703_11294370Ga0256703_112943701F038489MAWVEKDDNDHPVSTPCYVQGRQPPDQAAQSHIQP
Ga0256703_11294933Ga0256703_112949333F096316MAWVEKDHNAHPVPTPCYVQGRQPAAQAAQSHIQPGLECLQGWGIHSLLGQPVHKDIKQ
Ga0256703_11297443Ga0256703_112974431F001813VTEPGGVRRALGCCVEGHGSARTIGDGQMVGLDDPVGLFQP
Ga0256703_11297771Ga0256703_112977711F002471SKNDFDKLKFARDAYTIGRHPSIKDGLGFKREAKNLTSHKAPIPAKEKGKAPMASSAKRNHAFMYHDRRHARNACNDFDSYVYDSHAMFAPSSSYVYDRNVTRRNVVPKRNTIHHVSRKNAIHAPRKVVNEPSTIYYALNASFAICRKDKKIVARKLGAKCKGDKTCIWVPKEIVTNLVGPNKSWVPKSQA
Ga0256703_11298005Ga0256703_112980053F033854MAAEGQADKMVSDMEGRMKQRCVTEFLCMEKMAPTDIHXYLLGVCGDQTVDVSTVRQXVVCFSS
Ga0256703_11298794Ga0256703_112987941F094706MGPAHGGFELLKGNFKGLKGYVVGQITKSRRGKIYIDDEGWGPDAGSIEYGYRVPFGGIHVFIGKIGELGPEPNICTNLVKTAQRARPARAPPAVNRAFVGCVHGGPSEGSASGGETAIFSDGELSTCETDSLYQLQDGGLGGCSGGSSIPDCLEPPSRVGIFM
Ga0256703_11302960Ga0256703_113029601F005658MAWVAQAHRAHPAPTPCYVQGRQPAAQAAQSHIQP
Ga0256703_11303472Ga0256703_113034721F086390DLYDKSYTMDLEDFNTACKLSQWGNVSEPRKSEFKEFLASITVGESREITQATIGSIHFPAIHYFALFIGRSINGKDEACHMCVPDLSILKSAVLGDKQYNLGAIVARRLHLNGISGDLFGGIYATHLANFLEIPIHENDIELSPAYLDYNVMVRHQFVERNDQFLQYRRIFDRRRTVHIALPAPAFFDFQTKGRYVITREEANEYERRMDAAHLQATVGERSNNSKFSYVSPRSIYG
Ga0256703_11303749Ga0256703_113037491F038012MIIEFQLPCYVQDCQPLDQAAQSHIQSGLECIQGWGIHNLLGQP
Ga0256703_11306145Ga0256703_113061457F068298MLEWAAQGGGGVTDSGGVQGTFGCCVEGHGLVRSIGNG
Ga0256703_11307995Ga0256703_113079952F034384VNAEFCQNFEEETGRIETGLDPINSPMKDEAAMNLLRLESRIDGVVDYMARLKVAMSRIDPALWPEATLQNDLESLMTRLNGIPDRVQEWKKSSARCGADVALSLVRVHCKEVRQDKLAAIKVANTQKHDFRTFMETFIAVATRIADGVDLDEFVEPASPPPVE
Ga0256703_11309500Ga0256703_113095001F004815KARLDVALGSLGCWLATLHIAGGWNWMSTVGLFNPGHSVIP
Ga0256703_11312191Ga0256703_113121911F052316EAWAMVKTQYTNADPNHMAEVGPVGPDGKEIPISLVYGQVELAAKYSQQDCKLDRMLDGIEEEFSQSK
Ga0256703_11312258Ga0256703_113122581F033854MTAGGQSDKMASDMEVCMKQIYVIEFLHVEKIARMDIHQRLLNVYGDQTEDMSTVRWDGG
Ga0256703_11312778Ga0256703_113127783F096316MAWVEKDHNAHVVPTPCYVQGRQPADQAAQSHIQPGLECLQGWGIHSLLGQPVP
Ga0256703_11314254Ga0256703_113142541F004815KARLDVALGSLVCWLATLHIAGGWNWMGIVVLFNPGHSMTL
Ga0256703_11316086Ga0256703_113160861F052316TRYTKADPKQMAKVRPVGPDGKEIPVSLVYGQVELAAKYSQQDCKLDSLLDGIEEEYTQS
Ga0256703_11320107Ga0256703_113201071F083289MPGHKGTITVHGSRKIALECEEGNAAYAESVCATEELKFYKDNVDPVDMTSLKKPTTEHDPALKFKSADETKLLDFVPGDSSKQFSISANLDPK
Ga0256703_11320712Ga0256703_113207121F004815VALGSLVCWLATLHIAGGWKQMITVVLFNPGRPMVL
Ga0256703_11321134Ga0256703_113211341F020828AGHPVPLSDQLKQLVELHKVAEQAMKGFIVRLRPGEALPGSYFGLVRRLVEACPRLEVIKRSVYIEGARRALACAKVHWGKLDAEKLVKDGPPPGKEHRKPENYYKDVLAGARLVADECTKDVIFE
Ga0256703_11322247Ga0256703_113222471F076748KWDTVFMPTPMRFIKLPVDSPPLYLPNSSFLQNDPSWFDWNEEEAVLFPNWETGIT
Ga0256703_11324877Ga0256703_113248771F096316RMAWVEKDHNAHLVSTPCYVQGRQPADQAAQSHIQPGLECLQGWGIHSLLGQPVQCVTTLWVKV
Ga0256703_11325950Ga0256703_113259502F083289MPGYKGTITVHGSRKIALECEEGDAAYAESVCATEELKFYKDHVDPADMTSLKKSTTEHEPVLKFKSADDTKMVDFVPGDSSKQFIISANLDPK
Ga0256703_11327162Ga0256703_113271621F011632KGGQALEWAAQRGGGVTEPGGVQRAFGCCVDGHGLVRTIDEGRMVGLDDPVGLFQP
Ga0256703_11327771Ga0256703_113277711F005658MAXVEKDRNAHPVPTPCYVQGRQPADQAAQSHIQPGLECLQGWGIHSLLGQPVQ
Ga0256703_11329905Ga0256703_113299052F033854MAAEGQSDKMVSDVEAGMKQTCVTEFLHVEKVAPIDIHQHLLNVSGDQ
Ga0256703_11331505Ga0256703_113315051F076912LENSTALSNGKGSNADKVQDSETSLLVSKKADKNYLDDSEGTQKSCLDVVFELLATTAGTSSSNSLPESVRLLESQLQVERHRSDVLRQEAEGLRKSLQNSDAYFLVQQQALEDLSARQDKVSKLAKHLASIMGTQDIVS
Ga0256703_11334357Ga0256703_113343571F011735PYIFKRVLGKGAYELVDYEGNVLPWPRNGLYLKKYFA
Ga0256703_11336315Ga0256703_113363151F011632MEWAAQRGGGVTEPGGVQRVFGCCVEGRGLARTIGQGQMIGLDDPVGLFQP
Ga0256703_11337125Ga0256703_113371251F035626MASSIITNDAVQGETFLPGQIFVFGGFALRANSLGHLEQIESYAPGRQVRFGSLNFTADIRGDLILDGFEPQPSVPHCHGEHDLALQPDSTLEAALEPAPIFNSEPAAQIEDGWLDTASGAATSTVIEPNIDLPSNEVCAIGPPDSSPDMDSKPRASVPMNLTGH
Ga0256703_11342255Ga0256703_113422551F093003EQERFKRRLIATANSLKKKLQLLRADQDLLADRSTEVLAAEEYELERPSKSYPKRRLLPRLKEEALKPTSPAYDAADRPPRGRDREAYQPEVQPAPRRHPNNNTKARGNTRDLRDVLESKAKHARSIYGSRGRAPTRDDDRHDGYFKRNSGRAEYSRQDSYELRRDIARHRGATHPLCFTDEVMDHQIPEGFKPVNIESYDGTIDPAVWIKDYLIHIHMARGDDLHA
Ga0256703_11346042Ga0256703_113460422F096316MAWVAKERSAHPVPTPCYVQGRQPAAQAAQSHIQPGLECLQGWGIHSLLGQPVQ
Ga0256703_11347339Ga0256703_113473391F035108MSVGVLTGRPAEEMPGSTGDPLPELVKLFERVRQAMSGVVQALSPSVSLPEGLGGLAEKLQGARRRLRLWKISACRQGAREAWAMVKTRYPKADPNHMAEVGPAGPDGKEIPVSLMY
Ga0256703_11348616Ga0256703_113486162F020289MTEDEMVGWHHQLIGHEFEQSLGDDEGWGSLAYCSPWGHKESDTTERLNWTDVA
Ga0256703_11350069Ga0256703_113500692F020492MRVQASLLASAVLTAEVDTLKQSLEKSEQELGHAKKQLEEKEGKKYLG
Ga0256703_11351002Ga0256703_113510023F004001MSHSAREVVQSPSLEVFQNCMDVTLRDVVSGHGGPGMVVELGDLSGLFQPLEF
Ga0256703_11351480Ga0256703_113514804F096316MAWVEEDHSAHPVPTPCYVQGRQPAAQAAQSHIQPGLECLQGWGIHSLLGQPVQ
Ga0256703_11353604Ga0256703_113536043F096316MAWVEKDHSAQFSSNPLLCDGRQPAAQAAQSHIQPGLECLQGWGIHSLLGQPVQCVTAL
Ga0256703_11355281Ga0256703_113552811F105149MRDADDEPPREAQVRACEWPSENFMDRAGIKEEFNAYLRNADLVSFEADKCRQYHYLTSSFVRRFEFSSSRNFPTVLFDLYEKSCTMDLEDFTFACKLPQWGSTIDPHKSEFRNFLASITVGESRDIAQATIGSIHFPAIHYFALFIGRCINHKDEACHMCVPDLSVLKSAVLGNKQYNLGLLLHVGCIIIVFMEISLVEFMQLV
Ga0256703_11355593Ga0256703_113555931F004001QWHRLPRGVVQSPSLEVFKNCVDVALRDVVSECGGEGMMVGLDDLRGLFQP
Ga0256703_11359953Ga0256703_113599531F098130MPGPHPRRRPVRDDVLLQRTHVRDWAPPGWHWEVLPGGARRLVRNPASGPVVDPDLLWWRSRGPHSVQREPAPPEVVRHRVREEDEHVHRYMAAMDVRFSNTWQVLWADDRRYDPVMVPCLWVSTARAPGTASGLDSSIVFNLY
Ga0256703_11363621Ga0256703_113636211F032472INNNTVQGETFLPGQIFVFGGLALRANSLGHLEQIESYAPGHQVRFGNLNYTADIRGDLIFDGFEPPPSAPHCHDEHDIALPSNSALEAAPTSASTLNSEPTAPIEDGWLDVASGAAIPTAIEPNTSPGLRETRDSTEPDSSPDSEPSAPLPIESDRAPVMEFTAADIFQ
Ga0256703_11363971Ga0256703_113639711F006329LKEKLKRIEGEKMELELHVADVVDDHKMKMEKMRLKIRKIRKYDIDSEAWFHYAVGSIVTLVAILIIFVVAFKCFS
Ga0256703_11365067Ga0256703_113650671F001813GGVKGTFRHFIERHGLVRTIGDRWMVGLDDLVGLFQPW
Ga0256703_11365664Ga0256703_113656642F096317VNNQALLLAATASTTEVSGLRQSLGRAEEELGLVKRQLEENKGK
Ga0256703_11366773Ga0256703_113667731F083289GLKGTITVHGSRKIALECEEGDVTYAESVYATEELKFYKDNVHPADMTSLKKPTTEHDLVLKFKLADDTKMVDFVPGDSSKKFNISTNLDPK
Ga0256703_11366903Ga0256703_113669031F059631MVGKMPNVIWLEGSFVETIKGWRLGWFYITEPRDPEWAAAPEFRSGIPTRLTSWKEKGLPWGDSEELTGLQSCLQTLVNKKLKLVNVSQVLLIRRLLPCQQRYFNLWEFDPAQNRTLSGLFDMTYEAAWRVLFKGGETPA
Ga0256703_11367906Ga0256703_113679061F083289HGSRKIALECEEGDAAYAESICATEELKFYKDNVDPADMTSLKKPTTEHDPALKFKSADETKTVDFVPGDSSKQFIISANLDPK
Ga0256703_11368503Ga0256703_113685031F094706TVGLSHDGLTILEGKLKGLEGYVVGRMTKSRRGRIYIDDTGWGPEADAIEYGYRVPFGGIHVFISKIGEPGPEPDICTNLIETAQRARSTWAKPAVKRVFVGVVHEGEREDESEHGSETVVYSDDESSTGETESLYQLQDDQIRGCSDGDSISDPPGQVNRVEIFMAGTQ
Ga0256703_11368813Ga0256703_113688133F096317MQASLLAAAARTAEVAALKRDLERSKEELGLAKRQLEEN
Ga0256703_11369922Ga0256703_113699221F035626IIYNDTIQCEVFLPGQIFVFGSFALRANSLGHLEQIDSYAPGHQVKFGSLNYTTDIRGDLIFVRFEPISGAPNSHGEHDLDLPSDGVREIAPAAAPALIRSRSCHPRTGG
Ga0256703_11369999Ga0256703_113699992F001813QALEWAAQRGGGVTDPGGVQGTFGCCVEGHGLVRTIGDGWMVGLGDPVGLFQPW
Ga0256703_11372817Ga0256703_113728172F079404GSIYQVCGAEIWCIAGTGYLSGTPKKTSEDWPSEWFYMEDIPLPDPIRMGLPEFDNAPLKKLRSRRPRSPQEEDNGEVLYLMGRIKVMSQSGLTIIEVMAICIMRGVQPLQYRGHPMWNFNGEDDATRCGRKGPDSATALAKILFDLYKGEEEEFTRIKPRDGFSMYNPQAG
Ga0256703_11374704Ga0256703_113747042F068298QALEWAAQRDGGVTEPGGVQRAFGCCVEGHGLARTIGDG
Ga0256703_11374757Ga0256703_113747571F079404SQKGSIYQVGGAEVWRIAGTGYLFGTPKKASEDWPSEWFYIEDVPLSDPVRIGLPEFDSAPLKKRLSWRPRSPQRESDKDVLYLMGRIRLLAHSGLTMIGGMAACIKRGVQPLQYRGHPMWDFNGEDDATRYGRKGPDSAAILLKIFSTLYKGEEEEFLRVNPQGGFSMHNPPSWVSGRIYLLIRLVFPLLNT
Ga0256703_11376045Ga0256703_113760451F020289MVGWHHRLDGHEFEQAPGVGDGLGSLVCCSPWDGKDLDKTE
Ga0256703_11377072Ga0256703_113770721F020492RRSHKKYVNMVLQAVPLTSAALTTEVNTLKESLERSKNKLGRAKKQLEDKEGK
Ga0256703_11381461Ga0256703_113814611F093003ERPSKSYPKRRLLPHLEEEALKPHSPVYDAADRPLRGRAREAFQTKVQSAPRRHSVKNTKAWGNTEDLRDILDSKAKIARSIYGTRARAPTWDDDHRVGYTKSKSGQAEYNRQDSYELRRDIARHRGTAHPLCFTDEVMNHEFPEGFKPINIESYDGTTGPAVWIEDFLLHIHMARGDDLHAIKYLPLKLK
Ga0256703_11382633Ga0256703_113826331F011632QALEWAAQRGGGVTEPGGVQRAFGCCVEGHGLARTIGEGQMVGLDDPVGLFQP
Ga0256703_11384647Ga0256703_113846474F038012MNIEFQPSCYVQGHQPPDQAAQSHIQPDLECLQGWGI
Ga0256703_11385369Ga0256703_113853691F032472RANSLGHLEQIESYAPGRQVRFGSLNFTTDIHGDLIFDGSKPQSSVPHYHDGYDLALPSDSTLEAAHESALTHSSEPTVQIEDRWLDTASGAATSTAMEPNTDLVPCKARDSEVPDSSPDSEPPAPLPIGSDWAPIMEFTAVDIFQRSPFGDILSSLKYLSLSGEAWPDC
Ga0256703_11385613Ga0256703_113856132F004001VESVSLEMFKKCADVALRDMVSGHGGDGLMSCLDDLTGLFQPQ
Ga0256703_11387394Ga0256703_113873944F004001VGSPSLEEFKNCGDVALRDAVRGRGGDGLTVGLGDLSGLS
Ga0256703_11389873Ga0256703_113898731F005658MAWVEKDHNDIWFQPPCYVQGRQPADQAAQSHIQPGLECLQGWGIHSLL
Ga0256703_11391274Ga0256703_113912744F011632VLEWAAQRGGGVPEPGGVQRAFGCGVEGYGLMRTIGEGRMVGLDAPVGRFQP
Ga0256703_11391684Ga0256703_113916841F032472HLEQIKSYAPSRQVRFGSLNYTADIRGDLIFDGFEPQPSAPHCHNGHDLALPPNSALEAAPASAPIPNSEPTAPIEDGWLDAASGAAIPTAIEPNTSPALRETRDSKEPDSSTDSEPSAPLPIESDWAPIMEFTAADIFQHSPFGDILKTLKSLSLSGEP
Ga0256703_11391819Ga0256703_113918196F004815ALGSLVCWLATLHIAGGWNWMVIVGLFNPGLSVIL
Ga0256703_11394689Ga0256703_113946892F083289QLKMPGHKGTITVHGGRKVALECEEGDAAYAELVCATEELKYYKDNVDPADMTPLKKPTTEHDPALKFKSAAETKLVDFVPGDSSKQFSISANLDPK
Ga0256703_11395027Ga0256703_113950272F053764MVNTKIRWIVFFAAEDGEALYSQQKQEWELTMAQIMNSFLQNSDLNSRK
Ga0256703_11396876Ga0256703_113968761F063479MSERNWAGTHWIARSTHGGGRPKSGEVDLGPPVKSGRVRGLGKLHGLLAELAEALAWLEGGWSGLATVAEALAAMAGGIKLAGAKERWLAGEGECGAKRGAPGEAL
Ga0256703_11398007Ga0256703_113980072F020492MGMQAVLLTSAALTAEVNTLKENLELSENELGRAKKQLENKEGE
Ga0256703_11398561Ga0256703_113985611F017089SFQCKAKTGDKQKPTSKISNTYINKVDKKATTPYLIKKTENGNVIAIKANKQANKGKGAKRIWLPKEIISTMKSTKKIWIPKGK
Ga0256703_11411130Ga0256703_114111301F068986MPPILLCWPTTSEADAGGMAVEIEPSNQCSVALCCCETDSSREAV
Ga0256703_11411287Ga0256703_114112871F027342RSSSGVFADLPSSVSDAAAFQGTEEGSSTEKVFWSQYAEAEHPVPLSDQLKQLVELHKVAEQAMKGLIARLWPGEVMPGSYFGLVRRLVDACPWIEVVKRSVCIEGARRALARAKVHWGKLDAEKLLTDAPPPGKEYRTPEMYYNGVLNGARRIADECSKDVMF
Ga0256703_11413403Ga0256703_114134032F038084VIHTVKGFGIVNIAEIDVLLELSCFFNDPADVGNLISGSSAFPKTSLNIWKFTVHLLLKPGLGNFEHYFNSV
Ga0256703_11417611Ga0256703_114176113F062313SKADSLEKTLMQGKTRQKEKGTTDNKMVRWHHQLNGHGFGWTPRVGDGQGGLVCCGSWGRKESHATERLI
Ga0256703_11421839Ga0256703_114218391F082256MKKIKTSFANVGAYSTEENFIRGDPEGVIEWISGEAESFEEILSDRGDVCAFSGARVISAILEKAGCDHIKTMAQTEAAFSINDTKDPTAEATLMGRKFFNDLWVNGGREMAHEIIKKSEKDTHDARVEARQAEEAAEREKRIGNIF
Ga0256703_11422575Ga0256703_114225752F020492MGMQAALLTSVTLTAEVDALKQSLERSENELGRAKKQLEDKEGE
Ga0256703_11425290Ga0256703_114252904F001813VTEPGGVQRPFGCCVEGHGLARTIGEGRVVGLDDPVGLFQP
Ga0256703_11425954Ga0256703_114259541F068986MPPILLCWPMTSEADVDGMAVEVELSQQYSITFCCRATDGISHGNV
Ga0256703_11427937Ga0256703_114279374F011632MIQALEWVAQGGGGVTDPGGVQGTFGRCVEGHGLVGTIGEGRMVGLDDTVGLFQPY
Ga0256703_11428063Ga0256703_114280631F005658MAWVEKDHNDHPVPTPCYVQGRQPADQAAQSHIQPGLE
Ga0256703_11434244Ga0256703_114342442F035626IGAFIQSSSVSLLLGLMAPSTITNNAVQGETFLPGQIFVFGGFALRANSLGHLEQIDSCAPGHQVRFGNLNYTADIHGDLIFNRFGPAPEAPKSHDEHGLDLLSDEAQDITPSVKASDLN
Ga0256703_11435468Ga0256703_114354681F020828MPLSDQLKQLVELHRAAEVAMKAFIVRMWPGEPLPASYFGLIKRMVNACPRLEVIKRSVCIEGARRAFARAKMHWAKLDAEKMVKEGPPKGKPHRYPEKYYDGVMKGARLVADECTKDTIFEGMYSCRLCNMKTNLFALYSILLI
Ga0256703_11436290Ga0256703_1143629010F005658MAWVEKDHNDHPVPTPCYVQGHQPADQAAQSHIQPGLECLQGWGIH
Ga0256703_11437221Ga0256703_114372211F052316NHMARVGPLGSDGEEIPVSLVYDQVEVAAKYSQQDCKLDCLLEAVEEEVFESK
Ga0256703_11437983Ga0256703_114379831F093003KRWLTATAISMKKTQQQNQADQDLLADRWTEVLVAEEYELERPSKSYPKCRLLPQLEEEAPKPTSPAYDAANRPPCGRDRETFQPKAQPAPRCHSNKKAWGNTPDLRDVLEDKAKHARSIYGSQGRATMRDKNHHAGYSKSKSGRAEHSGQDPFELRRDIAQYTGAAHPLCFIDKVMDHQIPEGLKPVNIESYDSTTDHAVWIEDFLLHIHMARGDDLHAIKYLPLKLKGPARHWLN
Ga0256703_11439866Ga0256703_114398661F032472VTIRLDAQFGTPYPRSAGFDTDIGAFIESSSVSSPIGLMASSINNNTVHGENFLTGQIFVFGGFALRANSLGHLEEIESNAPGRQVRFGSLNFMADIRGDLILDGFEPQPSVPHCHDGHDLALLPDSTLEAAQEAAPTLSSEPTLPIEDGWLDTASGAATATAMEPNTDLVHYKARDSEEPDSLLDSE
Ga0256703_11439984Ga0256703_114399841F067310LQNDLESLMNRLNEIPDRVQECKKSSARCGADVALSLVRVHCKEAREDKLAEIKVANTKKHDFQSFMETFIAAATQIADGIDLDSFVEPASPPPAE
Ga0256703_11445060Ga0256703_114450602F086390FISRCINGKDEACHMCVPDLSILRSAMLGDKSYNLGAIVSHRLHHNRLNGDFFGGFYATRIANFLGVAIREDDIELPPAYLDFNAMVHHQFVERNKSPLQYRLIFDRRRAVRITLPAPAFFDYQARGRYTITREEADEYERREEAARRHTAAQQAIAAASQYDPSYYYGYPPGQPWS
Ga0256703_11445783Ga0256703_114457832F020492MRMQALLLASAALTAEVDTLKQNLARSENELGHAKRQLEEKEGK
Ga0256703_11448618Ga0256703_114486181F005658MALVAKDHNAHPVPTPCYVHSRQPAAQAAQSHIQPGLECLQGWGIHSLLGQPV
Ga0256703_11449820Ga0256703_114498201F004815KARLDVALGSLGCWLATLHIAGGWNWVSIAVLCNPGHSMVL
Ga0256703_11449837Ga0256703_114498371F038012MTKFQPPCYVQGRQPPDQAAQSYIQPGLESLQGWGIHN
Ga0256703_11451726Ga0256703_114517262F076748MPNPMIFIQLPDDSPPLYVSKSSFSQSDSSWFDWNDEEAVLFPNLETGIT
Ga0256703_11455866Ga0256703_114558663F001813VTDPGGVHRAFGSCLEGHSLAGTIGDGWMVGLDDPVGLFEPW
Ga0256703_11458438Ga0256703_114584382F001813PGGVQRAFGCCVEGHGLARTIGEGRMVGLGDPVGLFQP
Ga0256703_11459148Ga0256703_114591481F001813MAFHKATYIQGTFGCCVEGHGLVRTIGDGLMVGLGDPMALFQPW
Ga0256703_11460369Ga0256703_114603691F035626MASSINNAVQGETFLPGQIFVFGGFALRANSLGHLEQIESYAPGRQVRFGSLNFTADVRGDLIFDGLEPQPSAPHCNDGHDLALPPNSALVAARGPLRPLARSRSPRSRAGG
Ga0256703_11463305Ga0256703_114633052F005658NHRMAWVEKDHSAHPVPTPCYVQGCQPAAQAAQSHIQPGPECLPGGVLLT
Ga0256703_11464748Ga0256703_114647481F011632EIIVLWKGGQALEWAAQGGGGVTDPGGVRRAFGCCVKGHGLVRTTGEERMVGLDDPVGLFQP
Ga0256703_11466616Ga0256703_114666161F004815VALGSLGWWLATLHTAGGWNWMSIVVLFNPGHSMSL
Ga0256703_11470182Ga0256703_114701822F001813YISQGGGGVAEPRDVQGTFGCSTEGHVLVRTIGDGWMVGLGDPVGLFQPW
Ga0256703_11472348Ga0256703_114723481F027342KTQESELALALESAKSAKDMAQKALEEVEDIKKIAAGKAFSMQSKHVNVNYLLLTRIRSSPGVFADLPCSVSDAATFYRAEEGSSTEKVFWSQYAEAGHPVPPSDQLKQLVELHKVAEEAMKGLIVRMWLEQVMPGSYFGLVRRLVDACPWVDVIKRSACIEGARRALARTKVQWGKLDAEKLLTDPPLPGKEYRTPEKYYKIVLKGACNIADECSQNVIFE
Ga0256703_11477657Ga0256703_114776571F001813PGGVQGTFGHCVEGHGLMRTTGDGWMVGLSDPVGLFQPQ
Ga0256703_11481549Ga0256703_114815492F005658MAWAEKDLTVIIQFQPPCYVQGLQPLDQAAQSHTQTGLQCLQGWGIHNLKCQKLARE
Ga0256703_11484998Ga0256703_114849981F032472ESSSVSSPIGLMASSINNAVLGETFLPGQVFVFGGFTLRANLLGHLEQIESYAPGRQVRFGSLNFTADIRGDLILDGLEPQPSVPHYHGGHDLALQPDSSLEAALELAPIFNSEPAAQIEDGWLDTASGAANSTAIEPNTDIVPHEARDSEAPDSLPDSEPPVPPPIESDWAPIMEFTAADIFQRSPF
Ga0256703_11486175Ga0256703_114861751F086390ALFIGRCINAKDEACHMCVPDLSILRSAVLGDQSYHMGAIVARRLHQNRHNGDFFGGIYATRLANFLEIDIREGDMELPPSYLDFDSMVSHQFVERTEPPLQYRLIFNKRHVVHIALPAPAFFDFQTKGRYVITREEADEYERRAEAARCYTVAQEAIAAASQYDPSCTYGYLQAIPGNRPT
Ga0256703_11486495Ga0256703_114864951F020828VPMSDQLKQMVELHKAAEQAMKGFIVRLWPGDALPNSFFGLVRRLVDACPWLEVVKRSVSIEGARRAFTRVKFQWVKLDAMKLIKEGPLKGKEHRHPEMYYEGARRGPVL
Ga0256703_11486513Ga0256703_114865132F001813GGGVTDPGDVQGTFGCCVEGYSLMRTIGDGWMVGLGDPGGLFQPW
Ga0256703_11487390Ga0256703_114873902F020828MKGLIVRLWPKEAMPGSYFGLVRRLVDACPWVEVIKRSACIEGARRALARAKVRWGRLDAERLLTDPPPAGKEYRMPEMYYKTVLKGARKIADECPRDVIIE
Ga0256703_11488356Ga0256703_114883561F001813QALEWAAQRGGGVTNPGGVQGTFGHCVEGHGLVRTIGDGWMVGLGDPRGLFQPW
Ga0256703_11491975Ga0256703_114919752F020828WSQYTGAEHLVPMSDQLKQLVELHKAAEQAMKGFIVWMWSGNTLPNTYFGLVRRLVDACPRLEVIKRSVCIEGACRAFAQVKVQWAKLDAVKLIKEGPPQGKEHRHPEMYYEGVLKGARLVADECAKDVIFE
Ga0256703_11492038Ga0256703_114920381F032472APLIINSDKVQGETFLPGQIFIFGGFALRANSLGHLEQIESYAPGHQDRFGSLNYMADNCGDLIFDGFEPQPSVPHCLDGHDIALPPNSALEAAHASVSTIDLEPTAPIEDQRLDAASGAAISKAIEPNSSPTLRMARDSEEPDSSPNSEPLAPLPIESDWAPIMEFTAVD
Ga0256703_11496232Ga0256703_114962321F001813VTDPGGVQGTFGRCVEGRGLARTAGDGWMVGLGDPVGLFQPW
Ga0256703_11497074Ga0256703_114970741F038012MTIQFQPSCYVQGRQPPDQAAQSHIQPGLECLQGW
Ga0256703_11504709Ga0256703_115047091F038489MAWVEKDHNDHLVSTPCYVQGHQTAAQAAQSHIQPGLECL
Ga0256703_11506768Ga0256703_115067681F011632QALEWAAQRGGGVTDPGDVQRAFGCCVEGHGLARTIGERRMVGLDDPLSLFQP
Ga0256703_11509307Ga0256703_115093071F059631HIGLWLKTFNVKPKIVGGSQAECGGIMVGKMPNVTWLEGSFVETIKGWQSGWFYITEQRDPEWAAAPEFRSGIPTRLTAWKESGRIWGDPEERTGLQTCIQNMVNKKLKLVNVVQVMLIRRILPCQQRAFNLWEFDPAQHRTLNRLFDTTHEDAWMVLFKGAEVPPPTTEDRGFCVKCQASAVSY
Ga0256703_11509529Ga0256703_115095291F002471ACSKHLASISRLNDEVASLNAQLKTSKSEFDKLKFARDAYTIGRHPSIKDGLGFKREAKNLTSHKAPISIKEKGKAPMANSIQKNHAFLYHDRRYSRNVYHDRSCNDIVSHAYDSNAMFASSSSMMYDRSLARKNVIHHVPRRNAHVPRKTSNEPSTIYHALNASFAICRKDKKVVARKLGAKCKGDKTCICVPKAICTNLVGPNKSWVPKTQA
Ga0256703_11511213Ga0256703_115112134F038012MIIEFQPPCYVQGRQPPDQAAQSHIQPGLECLQEWGIHSLLGQPVPVRHH
Ga0256703_11513240Ga0256703_115132401F004815MLWVPHPWRHYKARLDVALGSLVCWLATLHIAGGWNWVSIVVLFNSGHSMIL
Ga0256703_11514468Ga0256703_115144683F004001SLEVFKSRVDVALRDVGSGHGGGGLVVGPDDLRGLFQPQ
Ga0256703_11517278Ga0256703_115172781F020828LIVRMWPGEPLPDSYFGLVKRMVHACPRLEVIKQSVCIEGARRDFARAKVHWGKLDAEKLVKDGPPEGKVHRYPKKYYDGVMKGAWLVANECPKNIIFE
Ga0256703_11518210Ga0256703_115182101F005658MAWVEKAHSAHPVPTPCYVQGRQPAAQAAQSHIQPGLECL
Ga0256703_11519762Ga0256703_115197621F020828WSQYSWTEHPMPLSDQLKQLVELHKAAEQAMKGFIVWMWPGDALPNSYFGLVRRLVDACPRLEVIKRSVCIEGARRAFARVKVQWAKLDDAKLIKEGPPQGKEHRTPKIYYEGVLKGARLVADECPKDVIFE
Ga0256703_11520893Ga0256703_115208931F105149MFRKMYQGGSSRKQAPRLAIREPDNELPREAQVRPCEWPLEDFMVQAGIKEEFDAYVRNAELEGFVSDKCPQHYYLTDSFVRRFKFTSSRNSHMVLFDLYDKSYTMDLEDFNTACKLPP
Ga0256703_11521024Ga0256703_115210241F001813GVQGTFGCCVEGHGLMRTIGDGWMVGLGDPVGLFQPW
Ga0256703_11522147Ga0256703_115221471F004001MQSPLLEVLKSRVDVAVRDVVSGHGGGMLLVGLDDFSGLFQP
Ga0256703_11522925Ga0256703_115229252F020492MGMQAALLTSAALTVEVNALKENLERSERELVRAKKQLEDKEGM
Ga0256703_11523990Ga0256703_115239902F059631MVRKMANVLWLEGSFVETIKGWKSGWFYITEPRDPKWLAAPEFRSGFPTRLTSWKETGLPWGNLEELTGLQPCSQNLVNKKLKLVNVVQVMLIRRILPCQKRAFNLWEFDPAQHQTLSRLFDTTYGDAWKVLFKGAEAPVSATEDRGFSSQRQASEVSYFTLYGTFVFHSLTPCGI
Ga0256703_11524221Ga0256703_115242212F020828KQLVELHKVAEQAMKGLIDRLWPGEVMPRSYFGLVQRLVDACPWIEVVKRSVCIEGARRALTRAKVHWGKLDAERLLTDAPPPGKEYRTPEMYYNGVLKGARRIADECSKDVIFE
Ga0256703_11526477Ga0256703_115264771F038084VVWNSHLFQNFPQFIVIHTVKGFGIVNKEVDVFFLELSCFFDDPVDVGNLISGSSAFSKTSLNIIRKFTVHILLKPGLEKFKHSFTSMWDECNCAVV
Ga0256703_11530787Ga0256703_115307874F005658MAWVEKDHNDHLVSTPCYVQGHQPPDQAAQSHIQPGLECLQGWGIH
Ga0256703_11531034Ga0256703_115310341F038012MIIEFQPPCCGQGHQPADQAAQSHIQPGLERLQGWGIHSLLGQPVPVHHHPLCEKL
Ga0256703_11535245Ga0256703_115352451F014346VVLEKTLESPLDYKEIQPVHSEGDQSWVFIGSTDVEAVTPILWPLYAKS
Ga0256703_11536276Ga0256703_115362761F076748PDDSPPLYVSKSSFLQRDSSRFDLNDEKAVIFPNWETGIT
Ga0256703_11538463Ga0256703_115384631F028669MYTPHEIKKQRSRCRSNQFITNVNKGDEERRGQTLLRIGVMGKRRQATEKIERSKNCVKR
Ga0256703_11539085Ga0256703_115390851F068986MPPILLCWPTPAEVDGGGMAVEDEPSHHYSITFCCCATDVSRGAV
Ga0256703_11539294Ga0256703_115392941F052316VKDNITKVDPNRMAEVGPIGSDGKEIPISLVYDQVGLAAKYSQQDCRLDIMLDGIEEEAFESK
Ga0256703_11540640Ga0256703_115406401F081962LVEQLYTGSQCALAVVALSNEVPTHLADVLRRLAVLPQRFQELRRASARAGAIAALSRAKAFLPELHPADIALGYPSLKEDGTPFDQKDFAACVKSVRPVATLIGNATNLTKYQPGYDAENQRIPTPCYEAISLVPPTRKHTLAPEIDPAGLIDEEAQFEALSGIDWKSSTFQ
Ga0256703_11540688Ga0256703_115406883F002002MVKHLPTMWETWAGSLGWEDPLEKETATHSSTLAWKIPWTKEPGRLQSMGLQSQA
Ga0256703_11546191Ga0256703_115461912F052316MVKTWYTKADPNHMAEVGPIGPDGKKIPMSLVYGQVELAAKYSQQDCKLDSMLDGIEEEYNQSI
Ga0256703_11548292Ga0256703_115482921F001813GVTDPGGVQRAFGRCVEGHGLARTIGEGRMVGLDDPVGHFQT
Ga0256703_11548308Ga0256703_115483081F038489MAWVEKGHNELLVSTPCYVQGCQPADQAAQSHIQPGLE
Ga0256703_11550223Ga0256703_115502231F068298QALEWAAQGGGGVTDPGGVEGMFGRCVEGHGLVRTIGDG
Ga0256703_11550506Ga0256703_115505063F011632QALEWAAHRGGGVTAPGGVQGAFGCCGEGHGLARTIGEGQMVGLEDPVGLFQP
Ga0256703_11551079Ga0256703_115510794F001813GVQRAFGCCVEGHGLARTIGEGRMVGLGDPVGLFQP
Ga0256703_11552191Ga0256703_115521911F005658MAWVEKDHNAHPVPTPCYVQGRQPPDQAAQSHIQPGLDGSSVGC
Ga0256703_11552871Ga0256703_115528711F004815APYGRSIKARLDVALGSLVWWLATLHIAGGWNWMSIVVLFNPGHSMTL
Ga0256703_11554517Ga0256703_115545171F034384SPVCDETAMNALRLESRIANATSYLARLKEVVSRIDSTLWPEVTLQNDLESLMTRLNEIPDRVQEWKKSSARCGADVALSLVRVHCKEAREDKLAAIKVANTKRHDFQSFMETFIAAATRIADGIDLDSFVAPASPPPAE
Ga0256703_11555329Ga0256703_115553291F032472ERARTWVKTSCPLSPVTIRLDAQFGTPYPRSAGFDTDIGAFIESSSVSSPLGLMAPTIIDGDAVQGETFLPGQIFVFGGSSLRANSLGHLEQIESYAPGHYVRFGYLNYTVYICGDLIFDGFEPLPCASRGHDECGLALPSDSVQEIAQAAAPTLNSEPGAPSADGWMDPATEALPSAVIEPNIDLTLHESCAVKLSDPSPATDSEPPAPVPIESDWAPIMEFTSADIFQHSPFGDIL
Ga0256703_11556131Ga0256703_115561316F004815FEARLDVALGSLGCWLATLPIAGGWNWMSTVVLFNPGHSTI
Ga0256703_11557758Ga0256703_115577581F038012MIIEFQPPCYVQGRQPLHQAAESHIQPGLECLQGWGIHSLL
Ga0256703_11562518Ga0256703_115625181F038012MIIEFQPPCYVQGHQPADQAAQSHIQPGLECLQGW
Ga0256703_11562734Ga0256703_115627341F067310MARLNEVPSQIQEWKKSSARCGADVALSLVRVHCREAREEKLAAIKVANTQRHDFQSFMETFIAAATRIADGIDLDEFVEPASPPPAE
Ga0256703_11565783Ga0256703_115657831F004001VVESLSLEMFRNWGDVALRDVVSGHGGDGLMDGHDDLKSFFQPVSL
Ga0256703_11566035Ga0256703_115660351F028669MCTQREIKKLRFKCWSDLFITNVNKGDEERGGWTLLRVRVKGEGRKAIAKNRKEARII
Ga0256703_11566321Ga0256703_115663211F050219MSEDKKIPAETKLSLEEEKNLGFLIAMAETNTEKITKEILEGLSEDTDD
Ga0256703_11569278Ga0256703_115692781F004001NRLPRKVVESPSLEVFKNCVDVALRDMVSVLGGDGLMVGLDDLKGFFHPL
Ga0256703_11569511Ga0256703_115695111F035108GCPAEEMPGSTGALLPELSQLHERVRQGMQGVAQALWPSVSMPEGLGELAEKLKGARWRFRLWKISAYRQGAREAWAMVKTRYTKADPNHMAKVGPIGGPDEKEILVSLAYGQVELAAKYSQQDCKLDRLLDGIEEEYAESD
Ga0256703_11574233Ga0256703_115742331F005658MAWVEKHHNAHPVPTPCYVQGHQPPAQAAQGHIQPGLECLQGWGIH
Ga0256703_11575302Ga0256703_115753022F001813VTEPEGVQRVFGCCVEGHGLVRTVGEGRMVGLDGPVGLFQP
Ga0256703_11578135Ga0256703_115781351F001813PGGVEGTFGCCVEGRGLARRSGDGWVVGLGDAVGLFQPL
Ga0256703_11579700Ga0256703_115797003F004001SLEVLKSRVDVALRDVGSGRGGNWLAVGLGDLRGLFQS
Ga0256703_11580583Ga0256703_115805831F005658MAWVEKDHNDHLVSTPCYVQGHQPADQAAQSHVQPGLECPQRXGIHNLLGQPKIMYNI
Ga0256703_11585306Ga0256703_115853061F028669MYARREIKKQRFKCWSDQFIINVNKGDGERGGRMLLRIGVMGKGRRAIEKIERGKNCIKR
Ga0256703_11586868Ga0256703_115868681F011632MXLFLXKAGQALEWAAQRGGGVTEPGGIQRAFGCCVEGHGLAGTFDEGRMVGLDDPVGLFQP
Ga0256703_11591664Ga0256703_115916641F038084TFVVIHTVKGFRIVDEAEVDVFLEISCFFDDPTDAGNLISGSSALSKSSMNIWNFSVHVLLKPGLENFDHYFAIM
Ga0256703_11592793Ga0256703_115927931F038084FQNFPQFIVIHTVKGFGIVNKAEIDAFLELSCFFHDPADVGNLISGSSAFSKTSLNIRKFTVHILLKPGLENFEHYYTSM
Ga0256703_11594447Ga0256703_115944471F011632QALEWAAQRGGGVTEPGSVQRVFGCCVDEQCLERTIGEGRMVGLDDPVGLFQP
Ga0256703_11596524Ga0256703_115965241F062313MTEDETVGWYHLLNGHGFGCTLGVGDGQGGMACCDSYSRKESDMTERLN
Ga0256703_11603142Ga0256703_116031422F053764MVNTEIRLIIFFAAKDEEALHSQEKQDWELTVAQIMNSLLPNSDLN
Ga0256703_11603750Ga0256703_116037502F011632VVKALEWAAQRGGGVTEPGGVQRAFGCCVEGHGLVRTIGDGQMVGLDDPVGLFQP
Ga0256703_11603890Ga0256703_116038901F096316MDVNLSSHNPRMAWVEKDRNAHPVPPPCYVQGRQPADQAAQSHIQPGLECLQGWGIHSLLGQPVQ
Ga0256703_11614416Ga0256703_116144161F028669MYARREIKKQRFKCWSDQFITNVNKGDRERGGRTLLRIGGMGKGKRAIEKIERGKNCVKRDQSPCCGEGSDGRE
Ga0256703_11615253Ga0256703_116152531F001813AQRGGGVTDPGGVQRAFGCCVEGHGLARTIGDGRMVGLDDPVGLFQP
Ga0256703_11615965Ga0256703_116159651F035626MAPLIINNDAVQGETFLPGQIFVFGGFALRANSLGHLEQIESYTPGRQVRFGSLNFTADTRGDLIFDGFEPQPSAPHCHDGHDLALQPDSALDAAHESAPTLNSEPAAQIKDGWLDIASGAATSMALEPNTD
Ga0256703_11616944Ga0256703_116169443F038012MIIEFQPSCYVQGRQPPDQAAQSHIQPGLECLQGWGIH
Ga0256703_11619534Ga0256703_116195342F038012MTIQFKPPCYVQGRQPADQAAQSHIQPGLECLQGWGIHSL
Ga0256703_11619844Ga0256703_116198444F004001VREVVQSPSLEVFKSHVDGALRDVVSGHGGGKLPDLDDLSGLFQP
Ga0256703_11622250Ga0256703_116222501F004001HRLPRELVKSPFLHIFKSRVDVALRDVGSGHSGDGLTIGLGDLSGLFQP
Ga0256703_11622678Ga0256703_116226782F020492MGLQATLLTSTALTAEVNTLKENLERSENELGRAKKQLEENEGE
Ga0256703_11623102Ga0256703_116231021F011632KGGQALEWAAQRGGRVTDPGGVQRAFGCCVEGHGLVRTIGDGRMVGLDDPVGLFQP
Ga0256703_11623434Ga0256703_116234342F005658MSWVEKDHNAHPVPTPCYVQGHQPAAQAAQSHIQPGLECLQGWGIHSL
Ga0256703_11624056Ga0256703_116240561F038012MIIEFQPPCCMQGHQPPDQAAQSHIQPGLEYLQGWGIHNLLGQPVPVR
Ga0256703_11626877Ga0256703_116268772F020492AALLTSAALTAEVDALKQSLERSENKLGLAKKQLEDKEGM
Ga0256703_11626975Ga0256703_116269751F004001SLEVFKKRVDMALRDKVSGHGGDGLMVGLDDFRCLFWPS
Ga0256703_11631601Ga0256703_116316011F001813PGGVQRVFGCCVEGHGLAKTTDEGQMVELDDPAGLFQT
Ga0256703_11631718Ga0256703_116317181F014346PMDCKEIHPVHSEGAQSSVFFGRNDAEAEAPIIWPPNAKK
Ga0256703_11632591Ga0256703_116325912F004001EVFKNCGDVALRNIVSGHGGDGLMVGQGDLRSLFQP
Ga0256703_11632979Ga0256703_116329792F020492MHMQASLLASATLTAEVGTLKQNLERSEQELGLAKQQLEEKEGKKYLI
Ga0256703_11634464Ga0256703_116344641F001813VQRAFGCCAEGHGLARTIGGGXMVGLDDPVGLFQP
Ga0256703_11635250Ga0256703_116352505F038012MARVKRTTMIIEFQPPCYVQGRQPPDQAAQSHIQPGLECLQG
Ga0256703_11635992Ga0256703_116359921F093003GRDREASRPSIQAMPRCRVKHTKARENAPDLCDILEDKARQTRSIYRSRGRTTLRDDKRHTGYSKSKSCRAEHSGQDPFELRHDIAQYRGAAHPLCFTDEVMDHQIPEGFKPVNIESYDGTTDHVVWIEDFLLHIHMARGDDLHAIKYLPLKLKGPARHWLNSLPAESIGC
Ga0256703_11639152Ga0256703_116391523F028669MYARREIKKQRFKCWSDQFITNVNKGVEEREGRALLRIGVMGKGRRAIEKIERSKNCVEQ
Ga0256703_11643613Ga0256703_116436133F001813YPGGVQGTFGHCVEGHGLLRTIDDGWMVGLGDPVGLFQP
Ga0256703_11643927Ga0256703_116439276F096316MAWVEKDHSDHVVSTPCYVQGRQPADQAAQSHIQPGLECLQGWGIHSLLGQPVQCIT
Ga0256703_11645401Ga0256703_116454012F020492MGMQVALLTSAALTAEVNALKQILVRSENKLGLAKKQLEDKEGK
Ga0256703_11645416Ga0256703_116454161F020492MHMQASLLASAALTAEVDALKQNLERSEQELEHAKKQLEDNEGKKYLVKNIYIKRCNCKE
Ga0256703_11647077Ga0256703_116470771F020637MDRGAWRATVHGIAERQTRLSDFTFNVHFHVLEKEMAAHSSVLAWRIPGTEGPGRRPSVG
Ga0256703_11647800Ga0256703_116478001F076912LENSTALSNGKGSNADKVQDSETSLLVSKKADKNYIEDTETTPKSCLDVVFELLATTVGTSSSNLLPKSVWLLESQLQVERHRSDVMRQEAEGLRKSLQNSDAYFLVQQQVLEDLSAKQEKVNKLAKHLANIMGTQDIVS
Ga0256703_11652921Ga0256703_116529212F096317VNKKASLLAAATRTVEVSTLKRDLERSKEELGLTKRQLEENKGK
Ga0256703_11653696Ga0256703_116536961F004001PLEMFKTRGDVALSDMVSGYGGDGLVVGLGDPRDLFQPL
Ga0256703_11653983Ga0256703_116539831F005658MAWVAKDHNAHPVPTPCYVQGRQPAAQAAQSHIQPGLECLQGWGIHSLIFRASHW
Ga0256703_11654237Ga0256703_116542371F005658MESQNHRMAXVEKDLKDDPVSTPCYVQGHQPPDQAAQSHIQPGLECLRGW
Ga0256703_11655722Ga0256703_116557222F096317NDQASLLIATAHTAEVSGLRQRLERAQGELGLTRRQLEESKGE
Ga0256703_11660681Ga0256703_116606811F067310MTRLNEIPSRVQEWKKSSARCGADVALSLVRVHCKDAREDKLASLKVANTKKHDFQSFMENFIADATRIADGIDLDHFVAPSSPAPEE
Ga0256703_11660980Ga0256703_116609801F015450IIEKKDFELQSTEGLLAETEAKISELNSKLIGQSKQFEQEKLELNSKLEAEVQANSNLKKSLTSLQDKCLNFSNNCIQQLKKIFYSVGASSGKFTPSDEDLPKAFDHIEAEIEELDEVIAGHGDFCAWVASRGTAAAFLKAGCEHGKIVNRPNFALSPSILDDIPDLARSISNRFIKMIWTKGGREKAGDEARSHLEPVRNHTLYLPPPSHLIFTRDTLIHVG
Ga0256703_11661096Ga0256703_116610963F104139VDPGSIPSGHSVTLHAPELPLVGPAFPPGAQSLVQALT
Ga0256703_11664206Ga0256703_116642064F004001VVESLSLKVFKNHGDVALRDMVSGQGGVGLMAGPDAVSGLFQP
Ga0256703_11664220Ga0256703_116642201F006329RIEEEKMTLELYVADVVEDHKMKMNAMPLKMDAMRLKLNKIRKYAIDNEAWYYYVVGSIFTLVAIFIAFVVMRVSFLWCFA
Ga0256703_11671924Ga0256703_116719242F004001PREVVESLSLELFKSNGDVALRDVVSEHGGDGLVVGLDDLSDLFQP
Ga0256703_11672455Ga0256703_116724551F004001MESSSLEVFKSHVDVALRDVVSGHDGDGLMVRLDELFFQP
Ga0256703_11674392Ga0256703_116743923F104139CHPLNEVWEPGSTPSGHSGVLLAAVLRWLGPAFPPGAQSPLQTLT
Ga0256703_11675889Ga0256703_116758891F093003KKQQQLQADQDLLADKWTEVPAAEEYKLERPSKSYPKCRLLPRLEEEAPKPTSLAYDAAYRPPRGRDKEAFQPKVQPAPRRHSTKNLKRWGNMPDPRDVLEDKAKHARSIYGSRGRATMRDDNRHAGYSKSKSGRAEHSGQDSFELRCDIAQYRGPAHPQCYTDEVMDHQIPEGFKAA
Ga0256703_11676099Ga0256703_116760991F020637MDGGAWWAAVHGVEKSRTQQSDFTFTFRFHVLEKEMA
Ga0256703_11677466Ga0256703_116774661F004001MEVVESPSLEVFKSRVDVALRDVVSGHGGDRVAVGFDDLRGLFQP
Ga0256703_11677643Ga0256703_116776434F001813VVESLNPGGVQRVFGCCVEGHGLARTIGEGRMVGLDDPVGLFQP
Ga0256703_11678821Ga0256703_116788212F068298FVLWKGGQALEWAAQRGGGVTDPGGVQGTFGCCVEGHGLVRTIGDG
Ga0256703_11681726Ga0256703_116817261F020828QLVELHKAAEQAMKGLIVRLWPKEDMPGSYFGLVRRLVDACPWVEVIKHSACIEGARRALARAKVHWGKMDAQKLVTDPPPDGKEHRTPEMYYKSVLKGARTIAGECSKDVIFE
Ga0256703_11682576Ga0256703_116825761F034384VHAEFCQNFEEETGRVETSLDPILSLVKDKAAMNIFRLESRVAGVVNYLARLKVAMSRIDTALWPRATLQNDLEYLMTRLNEVPGRVQEWKKSSARCGADVALSLVRVHCKEAREEKLAVIKVANTKRHDFQSFMETFIASATWIADGIDLDEFVEPASPPHAE
Ga0256703_11685674Ga0256703_116856742F086390VGESRDIAQATIGSIHFPAIHYFALFIGRCINGKDEAFHMCVPDLCVLKSAVLGNKDYNLGAIVARRLHNNGLVGDLFGGIYASRVANYLGIPPREGDMELPPAYLDYNAMASHHFLVRNEQFLQYRLIFDRRCSIHVTLPAPSLFDYQAKQRYVVTREEAIEYERRAEAARQHAAAQEALAAASQYDPSYNYRYQPGGPWYYTNLGQKPELGGVRISHRLYIHVHTLVVDAHTLSLYYP
Ga0256703_11685995Ga0256703_116859951F038084NFPQFIVIHTVKGFGIVNKANIDVFLELSCFFRDPADVGNLISGSSAFSKTSLNIWKFTVHLLLKPGLENFERFFTSM
Ga0256703_11686326Ga0256703_116863261F001813GGVTNPGGVQGTFGRCVEGHGLARTIGDGWMVGQSDPVGLVQPW
Ga0256703_11687800Ga0256703_116878001F032472LGPMASSIINHDAVQGETFLPGQIFVFGGFALWANSLGHLEQIESYAPGHQVRFGSLNYTADLRGVLIFEGFEPQPSAPQCHDGHDLALSPNSALEAAPASAPTLNSKPAAQIEDGWLDTASGAAISTAIEPNTNLILSEARDSTLPDSPPNSEPSAPLPIESDWAPIMEFTAA
Ga0256703_11692631Ga0256703_116926312F052316MVKTRYKKADPNHMAEVGPVGPDGKEIPVSLVYGQVELAAKFSQRDCKLDSLLDGIEEEYSQSI
Ga0256703_11694760Ga0256703_116947602F038985MPKKCCLGPQNGSGSSGPENLTKIVNCAIIKETEKLKETMARAQVE
Ga0256703_11695818Ga0256703_116958182F005658YGMAWVEKDHNAHPVSTPCYVQGRQPADQAAQSHIQPGLECLQGWGIHSLLVNKDD
Ga0256703_11695886Ga0256703_116958862F104139PGSTPFGHSGTPELPWAGPNFPPGAQSLLQAVTWH
Ga0256703_11700785Ga0256703_117007851F096316MAWAEKDHNDHLVSTPCYVQGRQPADQAAQSHIQPGLECLQGWGIHSLLGQPV
Ga0256703_11701137Ga0256703_117011371F048299YLMHETWVQSLGQDDPIEEGRATRSSILAWRIPWTDEPGGLQPVGLQRLR
Ga0256703_11706005Ga0256703_117060051F076912LGKNALLSNDKGSNADKVQDSDTSLLVSNKADKTAKEDYLEESETTPKSSLGLVFELLATTACTSYSNSLSEPVRFLESQLQDERHRSVVLRQEAEGLRKSLEHSDAYFLVQQQALEDFSAKQDKANKLAKLIASIVDTQDNVS
Ga0256703_11707827Ga0256703_117078271F086390MGESREITQATIGNIHFPSIYYFALFIGRCIDGKDEPCQKCVPDLSVLKSAVLGDKQYNLGAIVARRLHHNSISGDLFGGIYATRVANYLGVPIHGSDMELPPAYLDYSAMVRHQFLERNEQFLQYRLIFDRQRTVHVALPAPTFFNFHAKRRYVITREEANEYERRTEATRLQAAAHQAIAAASHYDPSYN
Ga0256703_11709600Ga0256703_117096001F001813VFKFGVQRAFGCCVEGHGLARTIGEGQMVGLDDPVGLFQ
Ga0256703_11709804Ga0256703_117098041F038985MLLSVFPEKHRLGPQNCFRSSGPEKLLKIVICAETEKMKEMMVGVQME
Ga0256703_11710725Ga0256703_117107252F011632MLYIYTSQALEWAAQRGGGVTDPGGVQRVFGCCVEGHGLARTIGDGRMVGLDDPAGLFQP
Ga0256703_11711409Ga0256703_117114091F001813HGTFGRCVEGHGLMRTIGDGWMVGLGDPVGLFQPW

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.