NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300023280

3300023280: Combined Assembly of Gp0238881, Gp0242115



Overview

Basic Information
IMG/M Taxon OID3300023280 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0130338 | Gp0238881 | Ga0255813
Sample NameCombined Assembly of Gp0238881, Gp0242115
Sequencing StatusPermanent Draft
Sequencing CenterUniversity of Toronto
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size2039222861
Sequencing Scaffolds884
Novel Protein Genes959
Associated Families101

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available277
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae135
All Organisms → cellular organisms → Eukaryota → Opisthokonta95
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays26
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum37
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Solanales → Solanaceae → Solanoideae → Solaneae → Solanum → Solanum subgen. Lycopersicon → Solanum lycopersicum1
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Morganellaceae → Proteus → Proteus mirabilis9
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae64
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae33
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae17
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata4
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Numididae → Numida → Numida meleagris3
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Lamiales → Oleaceae → Oleeae → Olea → Olea europaea → Olea europaea subsp. europaea1
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta2
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus61
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves9
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-789
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Odontophoridae → Odontophorus → Odontophorus gujanensis3
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum urartu9
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Meleagridinae → Meleagris → Meleagris gallopavo8
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Phasianus → Phasianus colchicus2
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei2
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria3
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes5
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea5
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Perdicinae → Bambusicola → Bambusicola thoracicus2
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora → Bovidae → Bovinae → Bos2
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Pavo → Pavo cristatus2
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis4
All Organisms → cellular organisms → Eukaryota4
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Anseriformes → Anatidae → Anatinae → Anas → Anas platyrhynchos1
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Euarchontoglires → Glires → Rodentia → Myomorpha → Muroidea → Muridae → Murinae → Rattus → Rattus norvegicus2
All Organisms → cellular organisms → Bacteria → PVC group → Chlamydiae → Chlamydiia → Chlamydiales → Chlamydiaceae → Chlamydia/Chlamydophila group → Chlamydia1
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum4
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter calcoaceticus/baumannii complex → Acinetobacter baumannii1
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter johnsonii1
All Organisms → cellular organisms → Bacteria3
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora → Cervidae → Muntiacinae → Muntiacus1
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Tetraoninae → Lagopus → Lagopus muta2
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Staphylococcaceae → Staphylococcus → Staphylococcus aureus1
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora5
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora → Bovidae → Caprinae → Ovis → Ovis aries2
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Charadriiformes → Scolopacidae → Limosa → Limosa lapponica → Limosa lapponica baueri2
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea abies1
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → Bacteroides uniformis2
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Cuculiformes → Coccyzidae → Piaya → Piaya cayana1
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Strigiformes → Strigidae → Athene → Athene cunicularia1
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae2
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Salmonella → unclassified Salmonella → Salmonella sp. hn-f52
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Passeriformes → Sylvioidea → Zosteropidae → Zosterops → Zosterops borbonicus1
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Passeriformes1
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Perdicinae → Coturnix → Coturnix japonica1
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Charadriiformes → Scolopacidae → Calidris → Calidris pygmaea1
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae2
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Passeriformes → Corvoidea → Corvidae → Corvus → Corvus moneduloides1
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora → Bovidae → Bovinae → Bos → Bos grunniens1
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae1
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Testudinata → Testudines → Cryptodira → Durocryptodira → Testudinoidea → Emydidae → Chrysemys → Chrysemys picta → Chrysemys picta bellii1
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora → Bovidae1
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata1
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Clostridiaceae → Clostridium → unclassified Clostridium → Clostridium sp.1
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa1
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Hordeinae → Hordeum → Hordeum vulgare → Hordeum vulgare subsp. vulgare1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameMetagenomes From Anaerobic Digester Of Solid Waste
TypeEngineered
TaxonomyEngineered → Bioreactor → Aerobic → Unclassified → Unclassified → Food Waste → Metagenomes From Anaerobic Digester Of Solid Waste

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Water (non-saline)

Location Information
LocationDurham, Ontario, Canada
CoordinatesLat. (o)44.1763Long. (o)-80.8185Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000010Metagenome7424Y
F001445Metagenome692Y
F001813Metagenome630Y
F002002Metagenome / Metatranscriptome605Y
F002471Metagenome / Metatranscriptome556Y
F002654Metagenome / Metatranscriptome539Y
F002798Metagenome529Y
F002932Metagenome519Y
F002994Metagenome / Metatranscriptome514Y
F003406Metagenome / Metatranscriptome488Y
F004001Metagenome457Y
F004815Metagenome422Y
F005658Metagenome393Y
F006329Metagenome / Metatranscriptome376Y
F007068Metagenome358Y
F007409Metagenome / Metatranscriptome351Y
F007510Metagenome / Metatranscriptome349Y
F008539Metagenome331Y
F009131Metagenome / Metatranscriptome322Y
F009316Metagenome319Y
F010678Metagenome / Metatranscriptome300Y
F011632Metagenome288Y
F011735Metagenome / Metatranscriptome287Y
F012765Metagenome / Metatranscriptome277Y
F013401Metagenome / Metatranscriptome271Y
F014346Metagenome / Metatranscriptome263Y
F014592Metagenome / Metatranscriptome261Y
F015450Metagenome / Metatranscriptome254N
F018877Metagenome / Metatranscriptome232Y
F020289Metagenome224Y
F020492Metagenome223Y
F020637Metagenome222Y
F020828Metagenome / Metatranscriptome221Y
F020862Metagenome / Metatranscriptome221Y
F027342Metagenome195Y
F027437Metagenome / Metatranscriptome194Y
F028669Metagenome190Y
F028765Metagenome / Metatranscriptome190Y
F031785Metagenome / Metatranscriptome181N
F032472Metagenome / Metatranscriptome180Y
F033754Metagenome176Y
F033854Metagenome176Y
F034384Metagenome175Y
F034461Metagenome / Metatranscriptome174Y
F035108Metagenome173Y
F035626Metagenome / Metatranscriptome171Y
F037171Metagenome / Metatranscriptome168N
F038003Metagenome / Metatranscriptome167Y
F038012Metagenome166Y
F038084Metagenome / Metatranscriptome166Y
F038489Metagenome165Y
F038985Metagenome / Metatranscriptome164Y
F039980Metagenome / Metatranscriptome162Y
F046965Metagenome / Metatranscriptome150Y
F048299Metagenome / Metatranscriptome148Y
F049439Metagenome146Y
F051243Metagenome144Y
F051600Metagenome143Y
F052316Metagenome142Y
F053764Metagenome / Metatranscriptome140Y
F055526Metagenome138Y
F057039Metagenome / Metatranscriptome136Y
F059631Metagenome133Y
F062313Metagenome130Y
F062643Metagenome / Metatranscriptome130Y
F062644Metagenome / Metatranscriptome130Y
F063479Metagenome / Metatranscriptome129Y
F065281Metagenome127Y
F065416Metagenome / Metatranscriptome127Y
F065766Metagenome / Metatranscriptome127Y
F067282Metagenome / Metatranscriptome125Y
F067310Metagenome / Metatranscriptome125Y
F068298Metagenome124Y
F068986Metagenome124Y
F071823Metagenome121Y
F073390Metagenome / Metatranscriptome120Y
F075851Metagenome / Metatranscriptome118Y
F076748Metagenome117Y
F076912Metagenome117Y
F078199Metagenome / Metatranscriptome116Y
F079404Metagenome115Y
F079778Metagenome / Metatranscriptome115Y
F081962Metagenome113Y
F082256Metagenome113Y
F083289Metagenome113Y
F086390Metagenome110Y
F092835Metagenome / Metatranscriptome107Y
F093003Metagenome106Y
F093243Metagenome / Metatranscriptome106Y
F094706Metagenome105Y
F096316Metagenome104Y
F096317Metagenome104Y
F096762Metagenome / Metatranscriptome104N
F096850Metagenome / Metatranscriptome104N
F098130Metagenome / Metatranscriptome104Y
F099086Metagenome / Metatranscriptome103N
F100750Metagenome / Metatranscriptome102Y
F102692Metagenome / Metatranscriptome101Y
F104139Metagenome100Y
F104259Metagenome / Metatranscriptome100Y
F105149Metagenome / Metatranscriptome100Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0255813_10002796Not Available21016Open in IMG/M
Ga0255813_10003366All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae2962Open in IMG/M
Ga0255813_10010267All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae15163Open in IMG/M
Ga0255813_10015872All Organisms → cellular organisms → Eukaryota → Opisthokonta5839Open in IMG/M
Ga0255813_10017733All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays898Open in IMG/M
Ga0255813_10020741All Organisms → cellular organisms → Eukaryota → Opisthokonta4976Open in IMG/M
Ga0255813_10022454All Organisms → cellular organisms → Eukaryota → Opisthokonta791Open in IMG/M
Ga0255813_10028522All Organisms → cellular organisms → Eukaryota → Opisthokonta2396Open in IMG/M
Ga0255813_10029410Not Available1128Open in IMG/M
Ga0255813_10029568Not Available1970Open in IMG/M
Ga0255813_10036204All Organisms → cellular organisms → Eukaryota → Opisthokonta20874Open in IMG/M
Ga0255813_10036706Not Available1058Open in IMG/M
Ga0255813_10039521All Organisms → cellular organisms → Eukaryota → Opisthokonta1689Open in IMG/M
Ga0255813_10040975All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae2707Open in IMG/M
Ga0255813_10045378All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum698Open in IMG/M
Ga0255813_10046364All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae2709Open in IMG/M
Ga0255813_10051240All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum612Open in IMG/M
Ga0255813_10054477Not Available558Open in IMG/M
Ga0255813_10055660All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays744Open in IMG/M
Ga0255813_10060218Not Available690Open in IMG/M
Ga0255813_10060882Not Available700Open in IMG/M
Ga0255813_10065339All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays522Open in IMG/M
Ga0255813_10066102Not Available2158Open in IMG/M
Ga0255813_10066269All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Solanales → Solanaceae → Solanoideae → Solaneae → Solanum → Solanum subgen. Lycopersicon → Solanum lycopersicum1631Open in IMG/M
Ga0255813_10069506All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Morganellaceae → Proteus → Proteus mirabilis723Open in IMG/M
Ga0255813_10072866All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae1661Open in IMG/M
Ga0255813_10073006Not Available3872Open in IMG/M
Ga0255813_10078345All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae930Open in IMG/M
Ga0255813_10080967All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae2108Open in IMG/M
Ga0255813_10082804All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum656Open in IMG/M
Ga0255813_10085115All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae9673Open in IMG/M
Ga0255813_10086727All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae562Open in IMG/M
Ga0255813_10087901Not Available500Open in IMG/M
Ga0255813_10088226All Organisms → cellular organisms → Eukaryota → Opisthokonta3409Open in IMG/M
Ga0255813_10090090Not Available560Open in IMG/M
Ga0255813_10090437All Organisms → cellular organisms → Eukaryota → Opisthokonta1487Open in IMG/M
Ga0255813_10091165Not Available540Open in IMG/M
Ga0255813_10093195All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata578Open in IMG/M
Ga0255813_10093610Not Available534Open in IMG/M
Ga0255813_10093721All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae4119Open in IMG/M
Ga0255813_10094158All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae2899Open in IMG/M
Ga0255813_10101931Not Available1143Open in IMG/M
Ga0255813_10102150All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae1823Open in IMG/M
Ga0255813_10104818All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Numididae → Numida → Numida meleagris2590Open in IMG/M
Ga0255813_10107736Not Available1231Open in IMG/M
Ga0255813_10110177All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Lamiales → Oleaceae → Oleeae → Olea → Olea europaea → Olea europaea subsp. europaea766Open in IMG/M
Ga0255813_10112844All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae1611Open in IMG/M
Ga0255813_10113631All Organisms → cellular organisms → Eukaryota → Opisthokonta21402Open in IMG/M
Ga0255813_10115512All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum962Open in IMG/M
Ga0255813_10116199Not Available14790Open in IMG/M
Ga0255813_10121060All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta1376Open in IMG/M
Ga0255813_10122096All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum542Open in IMG/M
Ga0255813_10123843Not Available4680Open in IMG/M
Ga0255813_10124788Not Available2154Open in IMG/M
Ga0255813_10129218All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum989Open in IMG/M
Ga0255813_10129821All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae2469Open in IMG/M
Ga0255813_10130025All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum868Open in IMG/M
Ga0255813_10132021Not Available739Open in IMG/M
Ga0255813_10134347Not Available688Open in IMG/M
Ga0255813_10136109All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus907Open in IMG/M
Ga0255813_10142033All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae1665Open in IMG/M
Ga0255813_10142082Not Available827Open in IMG/M
Ga0255813_10146225All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae2281Open in IMG/M
Ga0255813_10147032All Organisms → cellular organisms → Eukaryota → Opisthokonta2281Open in IMG/M
Ga0255813_10148278All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae665Open in IMG/M
Ga0255813_10150215All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus2119Open in IMG/M
Ga0255813_10150913Not Available1228Open in IMG/M
Ga0255813_10153286Not Available935Open in IMG/M
Ga0255813_10153878Not Available1145Open in IMG/M
Ga0255813_10156535Not Available554Open in IMG/M
Ga0255813_10160284All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae2084Open in IMG/M
Ga0255813_10162849Not Available2991Open in IMG/M
Ga0255813_10165169Not Available845Open in IMG/M
Ga0255813_10165917Not Available1406Open in IMG/M
Ga0255813_10166730All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves4657Open in IMG/M
Ga0255813_10170804All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78517Open in IMG/M
Ga0255813_10175213Not Available574Open in IMG/M
Ga0255813_10176662Not Available648Open in IMG/M
Ga0255813_10176818Not Available549Open in IMG/M
Ga0255813_10181756All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae3045Open in IMG/M
Ga0255813_10182634Not Available582Open in IMG/M
Ga0255813_10186715All Organisms → cellular organisms → Eukaryota → Opisthokonta1542Open in IMG/M
Ga0255813_10189359All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus1854Open in IMG/M
Ga0255813_10190856All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus666Open in IMG/M
Ga0255813_10191410Not Available2552Open in IMG/M
Ga0255813_10191961Not Available641Open in IMG/M
Ga0255813_10193041All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae792Open in IMG/M
Ga0255813_10196354Not Available1052Open in IMG/M
Ga0255813_10197424Not Available7370Open in IMG/M
Ga0255813_10197794All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus1607Open in IMG/M
Ga0255813_10201884All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae3377Open in IMG/M
Ga0255813_10202050All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae2136Open in IMG/M
Ga0255813_10204215Not Available879Open in IMG/M
Ga0255813_10205671All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum518Open in IMG/M
Ga0255813_10206980Not Available2236Open in IMG/M
Ga0255813_10216916All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Odontophoridae → Odontophorus → Odontophorus gujanensis1488Open in IMG/M
Ga0255813_10221069All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae1651Open in IMG/M
Ga0255813_10222912Not Available1293Open in IMG/M
Ga0255813_10223457Not Available4392Open in IMG/M
Ga0255813_10225213All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae2877Open in IMG/M
Ga0255813_10227022Not Available771Open in IMG/M
Ga0255813_10228426Not Available704Open in IMG/M
Ga0255813_10233597All Organisms → cellular organisms → Eukaryota → Opisthokonta1354Open in IMG/M
Ga0255813_10236821All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae14457Open in IMG/M
Ga0255813_10237932All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae4141Open in IMG/M
Ga0255813_10238462All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae1275Open in IMG/M
Ga0255813_10238875Not Available723Open in IMG/M
Ga0255813_10241660All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum urartu614Open in IMG/M
Ga0255813_10241856All Organisms → cellular organisms → Eukaryota → Opisthokonta586Open in IMG/M
Ga0255813_10242614All Organisms → cellular organisms → Eukaryota → Opisthokonta9390Open in IMG/M
Ga0255813_10242929Not Available1937Open in IMG/M
Ga0255813_10247748Not Available906Open in IMG/M
Ga0255813_10249699All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae831Open in IMG/M
Ga0255813_10249948All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae4344Open in IMG/M
Ga0255813_10251582Not Available2236Open in IMG/M
Ga0255813_10252785All Organisms → cellular organisms → Eukaryota → Opisthokonta8169Open in IMG/M
Ga0255813_10254745Not Available4169Open in IMG/M
Ga0255813_10255692Not Available579Open in IMG/M
Ga0255813_10259412Not Available3090Open in IMG/M
Ga0255813_10260665Not Available836Open in IMG/M
Ga0255813_10263346Not Available778Open in IMG/M
Ga0255813_10270767Not Available881Open in IMG/M
Ga0255813_10271847All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae1271Open in IMG/M
Ga0255813_10271922All Organisms → cellular organisms → Eukaryota → Opisthokonta6094Open in IMG/M
Ga0255813_10272517All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae5566Open in IMG/M
Ga0255813_10275387All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays651Open in IMG/M
Ga0255813_10276494All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae940Open in IMG/M
Ga0255813_10286714Not Available12447Open in IMG/M
Ga0255813_10292156All Organisms → cellular organisms → Eukaryota → Opisthokonta4507Open in IMG/M
Ga0255813_10292769All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae1169Open in IMG/M
Ga0255813_10292847Not Available2015Open in IMG/M
Ga0255813_10293799All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Meleagridinae → Meleagris → Meleagris gallopavo2315Open in IMG/M
Ga0255813_10297209All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae4052Open in IMG/M
Ga0255813_10298028Not Available12509Open in IMG/M
Ga0255813_10298870All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae836Open in IMG/M
Ga0255813_10300024All Organisms → cellular organisms → Eukaryota → Opisthokonta729Open in IMG/M
Ga0255813_10304456All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus1821Open in IMG/M
Ga0255813_10306103All Organisms → cellular organisms → Eukaryota → Opisthokonta16457Open in IMG/M
Ga0255813_10308065All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Phasianus → Phasianus colchicus11129Open in IMG/M
Ga0255813_10308550Not Available522Open in IMG/M
Ga0255813_10317494All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae8227Open in IMG/M
Ga0255813_10323241All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Meleagridinae → Meleagris → Meleagris gallopavo3034Open in IMG/M
Ga0255813_10324001All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus2898Open in IMG/M
Ga0255813_10325750All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei685Open in IMG/M
Ga0255813_10326456All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae616Open in IMG/M
Ga0255813_10327719Not Available528Open in IMG/M
Ga0255813_10330760All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae4101Open in IMG/M
Ga0255813_10332203Not Available3871Open in IMG/M
Ga0255813_10337802Not Available577Open in IMG/M
Ga0255813_10338849Not Available2609Open in IMG/M
Ga0255813_10346850All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Meleagridinae → Meleagris → Meleagris gallopavo2387Open in IMG/M
Ga0255813_10348633Not Available1226Open in IMG/M
Ga0255813_10350207All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria632Open in IMG/M
Ga0255813_10352076All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus2341Open in IMG/M
Ga0255813_10352551All Organisms → cellular organisms → Eukaryota → Opisthokonta1010Open in IMG/M
Ga0255813_10353603All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum1119Open in IMG/M
Ga0255813_10353696All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae882Open in IMG/M
Ga0255813_10356957All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes808Open in IMG/M
Ga0255813_10361260All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae786Open in IMG/M
Ga0255813_10369192All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae1610Open in IMG/M
Ga0255813_10374461All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus5286Open in IMG/M
Ga0255813_10376990All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae4242Open in IMG/M
Ga0255813_10383602Not Available1038Open in IMG/M
Ga0255813_10383765All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea616Open in IMG/M
Ga0255813_10383776All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae5322Open in IMG/M
Ga0255813_10385668Not Available1887Open in IMG/M
Ga0255813_10386943All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae1632Open in IMG/M
Ga0255813_10389833All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae1145Open in IMG/M
Ga0255813_10395572All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves3688Open in IMG/M
Ga0255813_10398663All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae3930Open in IMG/M
Ga0255813_10398678All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae662Open in IMG/M
Ga0255813_10399113Not Available565Open in IMG/M
Ga0255813_10400324All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae3086Open in IMG/M
Ga0255813_10402709All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae5858Open in IMG/M
Ga0255813_10403940Not Available1123Open in IMG/M
Ga0255813_10405454All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae5304Open in IMG/M
Ga0255813_10405699All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays602Open in IMG/M
Ga0255813_10409555All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays738Open in IMG/M
Ga0255813_10412076All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae704Open in IMG/M
Ga0255813_10414600All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae679Open in IMG/M
Ga0255813_10417234All Organisms → cellular organisms → Eukaryota → Opisthokonta4790Open in IMG/M
Ga0255813_10419565All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae3567Open in IMG/M
Ga0255813_10421535All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae3121Open in IMG/M
Ga0255813_10423245Not Available4299Open in IMG/M
Ga0255813_10428357All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae13151Open in IMG/M
Ga0255813_10428731Not Available766Open in IMG/M
Ga0255813_10429898Not Available1734Open in IMG/M
Ga0255813_10431073Not Available2832Open in IMG/M
Ga0255813_10432846All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae768Open in IMG/M
Ga0255813_10435536All Organisms → cellular organisms → Eukaryota → Opisthokonta4711Open in IMG/M
Ga0255813_10437351All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Perdicinae → Bambusicola → Bambusicola thoracicus12572Open in IMG/M
Ga0255813_10439344All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves3121Open in IMG/M
Ga0255813_10439945All Organisms → cellular organisms → Eukaryota → Opisthokonta1695Open in IMG/M
Ga0255813_10443450Not Available867Open in IMG/M
Ga0255813_10446180All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora → Bovidae → Bovinae → Bos703Open in IMG/M
Ga0255813_10448422All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae1718Open in IMG/M
Ga0255813_10453472All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Perdicinae → Bambusicola → Bambusicola thoracicus1998Open in IMG/M
Ga0255813_10454738All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae5998Open in IMG/M
Ga0255813_10455457Not Available914Open in IMG/M
Ga0255813_10461796Not Available1205Open in IMG/M
Ga0255813_10463562All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78527Open in IMG/M
Ga0255813_10463731All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum910Open in IMG/M
Ga0255813_10472226All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae793Open in IMG/M
Ga0255813_10472470All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum861Open in IMG/M
Ga0255813_10473033All Organisms → cellular organisms → Eukaryota → Opisthokonta12018Open in IMG/M
Ga0255813_10473679Not Available608Open in IMG/M
Ga0255813_10477858Not Available581Open in IMG/M
Ga0255813_10480009Not Available644Open in IMG/M
Ga0255813_10480487All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae5445Open in IMG/M
Ga0255813_10483335All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae1598Open in IMG/M
Ga0255813_10483583All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes1159Open in IMG/M
Ga0255813_10483809All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Odontophoridae → Odontophorus → Odontophorus gujanensis1694Open in IMG/M
Ga0255813_10487230All Organisms → cellular organisms → Eukaryota → Opisthokonta607Open in IMG/M
Ga0255813_10488181Not Available1974Open in IMG/M
Ga0255813_10488419All Organisms → cellular organisms → Eukaryota → Opisthokonta6676Open in IMG/M
Ga0255813_10489296All Organisms → cellular organisms → Eukaryota → Opisthokonta2520Open in IMG/M
Ga0255813_10491886All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Pavo → Pavo cristatus4427Open in IMG/M
Ga0255813_10494176Not Available503Open in IMG/M
Ga0255813_10516806All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae4698Open in IMG/M
Ga0255813_10519966All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae666Open in IMG/M
Ga0255813_10521129Not Available582Open in IMG/M
Ga0255813_10521973Not Available1553Open in IMG/M
Ga0255813_10523228All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata535Open in IMG/M
Ga0255813_10524030Not Available5690Open in IMG/M
Ga0255813_10524167All Organisms → cellular organisms → Eukaryota → Opisthokonta2281Open in IMG/M
Ga0255813_10528167All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae6154Open in IMG/M
Ga0255813_10531809All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum urartu751Open in IMG/M
Ga0255813_10538618Not Available1044Open in IMG/M
Ga0255813_10540847All Organisms → cellular organisms → Eukaryota → Opisthokonta1194Open in IMG/M
Ga0255813_10541691Not Available600Open in IMG/M
Ga0255813_10542258All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Morganellaceae → Proteus → Proteus mirabilis753Open in IMG/M
Ga0255813_10552447Not Available1158Open in IMG/M
Ga0255813_10554088All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae7053Open in IMG/M
Ga0255813_10555962All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Morganellaceae → Proteus → Proteus mirabilis671Open in IMG/M
Ga0255813_10556405All Organisms → cellular organisms → Eukaryota → Opisthokonta15976Open in IMG/M
Ga0255813_10559109All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae3064Open in IMG/M
Ga0255813_10563572All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Numididae → Numida → Numida meleagris2105Open in IMG/M
Ga0255813_10564507Not Available968Open in IMG/M
Ga0255813_10565333All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum616Open in IMG/M
Ga0255813_10565660Not Available3211Open in IMG/M
Ga0255813_10565776All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes518Open in IMG/M
Ga0255813_10566062All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis659Open in IMG/M
Ga0255813_10566110All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis1193Open in IMG/M
Ga0255813_10566591All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus1433Open in IMG/M
Ga0255813_10566655All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae4603Open in IMG/M
Ga0255813_10568780All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus537Open in IMG/M
Ga0255813_10569778All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus2039Open in IMG/M
Ga0255813_10572009Not Available2904Open in IMG/M
Ga0255813_10579871All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus1151Open in IMG/M
Ga0255813_10581089All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae2700Open in IMG/M
Ga0255813_10587847All Organisms → cellular organisms → Eukaryota → Opisthokonta1040Open in IMG/M
Ga0255813_10591904All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum510Open in IMG/M
Ga0255813_10592129All Organisms → cellular organisms → Eukaryota3696Open in IMG/M
Ga0255813_10592306All Organisms → cellular organisms → Eukaryota → Opisthokonta2770Open in IMG/M
Ga0255813_10594110All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes8446Open in IMG/M
Ga0255813_10595965All Organisms → cellular organisms → Eukaryota → Opisthokonta10595Open in IMG/M
Ga0255813_10598509All Organisms → cellular organisms → Eukaryota → Opisthokonta1040Open in IMG/M
Ga0255813_10602602All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Meleagridinae → Meleagris → Meleagris gallopavo810Open in IMG/M
Ga0255813_10603233All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae4564Open in IMG/M
Ga0255813_10605242All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae4070Open in IMG/M
Ga0255813_10607187All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae1288Open in IMG/M
Ga0255813_10607955Not Available762Open in IMG/M
Ga0255813_10608543All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Anseriformes → Anatidae → Anatinae → Anas → Anas platyrhynchos2187Open in IMG/M
Ga0255813_10611248Not Available1622Open in IMG/M
Ga0255813_10613240All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Morganellaceae → Proteus → Proteus mirabilis501Open in IMG/M
Ga0255813_10614171All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea505Open in IMG/M
Ga0255813_10619320All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae1795Open in IMG/M
Ga0255813_10621154All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves911Open in IMG/M
Ga0255813_10621752Not Available590Open in IMG/M
Ga0255813_10622883All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae1098Open in IMG/M
Ga0255813_10625571All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum993Open in IMG/M
Ga0255813_10628823Not Available2153Open in IMG/M
Ga0255813_10630668All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae3074Open in IMG/M
Ga0255813_10631677All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus582Open in IMG/M
Ga0255813_10635100Not Available3229Open in IMG/M
Ga0255813_10637391All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Euarchontoglires → Glires → Rodentia → Myomorpha → Muroidea → Muridae → Murinae → Rattus → Rattus norvegicus2528Open in IMG/M
Ga0255813_10638314All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae4009Open in IMG/M
Ga0255813_10644104Not Available703Open in IMG/M
Ga0255813_10648215All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays625Open in IMG/M
Ga0255813_10648320Not Available603Open in IMG/M
Ga0255813_10658595All Organisms → cellular organisms → Eukaryota → Opisthokonta3585Open in IMG/M
Ga0255813_10658623Not Available1604Open in IMG/M
Ga0255813_10660142Not Available603Open in IMG/M
Ga0255813_10660590All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae3178Open in IMG/M
Ga0255813_10660697Not Available943Open in IMG/M
Ga0255813_10662859Not Available501Open in IMG/M
Ga0255813_10666044All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus958Open in IMG/M
Ga0255813_10666819Not Available745Open in IMG/M
Ga0255813_10667538All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae6841Open in IMG/M
Ga0255813_10667617All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae2396Open in IMG/M
Ga0255813_10669272All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays652Open in IMG/M
Ga0255813_10671377All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum1067Open in IMG/M
Ga0255813_10673708All Organisms → cellular organisms → Eukaryota2209Open in IMG/M
Ga0255813_10675334All Organisms → cellular organisms → Bacteria → PVC group → Chlamydiae → Chlamydiia → Chlamydiales → Chlamydiaceae → Chlamydia/Chlamydophila group → Chlamydia625Open in IMG/M
Ga0255813_10681048All Organisms → cellular organisms → Eukaryota → Opisthokonta716Open in IMG/M
Ga0255813_10686418All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum557Open in IMG/M
Ga0255813_10691295All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae2303Open in IMG/M
Ga0255813_10697196Not Available1425Open in IMG/M
Ga0255813_10697868All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter calcoaceticus/baumannii complex → Acinetobacter baumannii697Open in IMG/M
Ga0255813_10699234Not Available669Open in IMG/M
Ga0255813_10700018All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae1208Open in IMG/M
Ga0255813_10709549Not Available558Open in IMG/M
Ga0255813_10710207All Organisms → cellular organisms → Eukaryota → Opisthokonta1389Open in IMG/M
Ga0255813_10711614All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus1206Open in IMG/M
Ga0255813_10720677Not Available1165Open in IMG/M
Ga0255813_10724882All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae1422Open in IMG/M
Ga0255813_10725435All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves7700Open in IMG/M
Ga0255813_10727108All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae4042Open in IMG/M
Ga0255813_10727267All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus720Open in IMG/M
Ga0255813_10734227Not Available1972Open in IMG/M
Ga0255813_10738141Not Available1018Open in IMG/M
Ga0255813_10739828Not Available521Open in IMG/M
Ga0255813_10741128Not Available513Open in IMG/M
Ga0255813_10741411All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae1056Open in IMG/M
Ga0255813_10742140All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus1171Open in IMG/M
Ga0255813_10743224All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae1604Open in IMG/M
Ga0255813_10744145Not Available1566Open in IMG/M
Ga0255813_10745033All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae3217Open in IMG/M
Ga0255813_10746933All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus656Open in IMG/M
Ga0255813_10754885All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum938Open in IMG/M
Ga0255813_10755325All Organisms → cellular organisms → Eukaryota → Opisthokonta4150Open in IMG/M
Ga0255813_10756531All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter johnsonii699Open in IMG/M
Ga0255813_10758314All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78564Open in IMG/M
Ga0255813_10758410Not Available5204Open in IMG/M
Ga0255813_10764188All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum urartu701Open in IMG/M
Ga0255813_10764569All Organisms → cellular organisms → Bacteria750Open in IMG/M
Ga0255813_10769512Not Available7756Open in IMG/M
Ga0255813_10772363All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae15744Open in IMG/M
Ga0255813_10773201All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays706Open in IMG/M
Ga0255813_10773420All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays681Open in IMG/M
Ga0255813_10774737All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae1654Open in IMG/M
Ga0255813_10774852Not Available2276Open in IMG/M
Ga0255813_10776151All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora → Cervidae → Muntiacinae → Muntiacus521Open in IMG/M
Ga0255813_10776262All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum706Open in IMG/M
Ga0255813_10776586All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae3814Open in IMG/M
Ga0255813_10777715Not Available768Open in IMG/M
Ga0255813_10781357Not Available625Open in IMG/M
Ga0255813_10786051All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Tetraoninae → Lagopus → Lagopus muta4543Open in IMG/M
Ga0255813_10787066Not Available1348Open in IMG/M
Ga0255813_10787936All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae603Open in IMG/M
Ga0255813_10787947Not Available1754Open in IMG/M
Ga0255813_10789427All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Staphylococcaceae → Staphylococcus → Staphylococcus aureus701Open in IMG/M
Ga0255813_10794597All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae618Open in IMG/M
Ga0255813_10795952All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae949Open in IMG/M
Ga0255813_10795986All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora648Open in IMG/M
Ga0255813_10797056All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae3220Open in IMG/M
Ga0255813_10802315All Organisms → cellular organisms → Eukaryota → Opisthokonta1092Open in IMG/M
Ga0255813_10803637All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus2136Open in IMG/M
Ga0255813_10808475All Organisms → cellular organisms → Eukaryota2519Open in IMG/M
Ga0255813_10810602All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae661Open in IMG/M
Ga0255813_10815349Not Available2875Open in IMG/M
Ga0255813_10816721Not Available697Open in IMG/M
Ga0255813_10818645All Organisms → cellular organisms → Eukaryota → Opisthokonta7444Open in IMG/M
Ga0255813_10819438All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae1602Open in IMG/M
Ga0255813_10823118All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae1072Open in IMG/M
Ga0255813_10824349Not Available510Open in IMG/M
Ga0255813_10828172All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae852Open in IMG/M
Ga0255813_10828571All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays748Open in IMG/M
Ga0255813_10828607All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae3173Open in IMG/M
Ga0255813_10830165All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae2192Open in IMG/M
Ga0255813_10831998All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum685Open in IMG/M
Ga0255813_10834705All Organisms → cellular organisms → Eukaryota → Opisthokonta4045Open in IMG/M
Ga0255813_10835623Not Available597Open in IMG/M
Ga0255813_10838039All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum558Open in IMG/M
Ga0255813_10838784Not Available835Open in IMG/M
Ga0255813_10839586Not Available1248Open in IMG/M
Ga0255813_10839866Not Available2441Open in IMG/M
Ga0255813_10842479Not Available1982Open in IMG/M
Ga0255813_10844306Not Available9252Open in IMG/M
Ga0255813_10845400Not Available2022Open in IMG/M
Ga0255813_10848710All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus830Open in IMG/M
Ga0255813_10850703All Organisms → cellular organisms → Eukaryota → Opisthokonta25185Open in IMG/M
Ga0255813_10851014All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei555Open in IMG/M
Ga0255813_10852990All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae7119Open in IMG/M
Ga0255813_10854697All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora → Bovidae → Caprinae → Ovis → Ovis aries507Open in IMG/M
Ga0255813_10856127Not Available842Open in IMG/M
Ga0255813_10856486All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae549Open in IMG/M
Ga0255813_10858106All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus6233Open in IMG/M
Ga0255813_10858854All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae1055Open in IMG/M
Ga0255813_10860019Not Available3835Open in IMG/M
Ga0255813_10863767All Organisms → cellular organisms → Eukaryota → Opisthokonta6780Open in IMG/M
Ga0255813_10865333Not Available3176Open in IMG/M
Ga0255813_10867614All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae1213Open in IMG/M
Ga0255813_10869570Not Available563Open in IMG/M
Ga0255813_10873682Not Available756Open in IMG/M
Ga0255813_10875459All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae2200Open in IMG/M
Ga0255813_10877170All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae3034Open in IMG/M
Ga0255813_10879403All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus507Open in IMG/M
Ga0255813_10879866All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum608Open in IMG/M
Ga0255813_10881033All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus2541Open in IMG/M
Ga0255813_10884069All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus581Open in IMG/M
Ga0255813_10888722All Organisms → cellular organisms → Eukaryota → Opisthokonta4421Open in IMG/M
Ga0255813_10896103All Organisms → cellular organisms → Eukaryota → Opisthokonta1623Open in IMG/M
Ga0255813_10906217All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays741Open in IMG/M
Ga0255813_10907660Not Available3783Open in IMG/M
Ga0255813_10911250All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae1746Open in IMG/M
Ga0255813_10911784All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus1348Open in IMG/M
Ga0255813_10912523All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Numididae → Numida → Numida meleagris3748Open in IMG/M
Ga0255813_10914452Not Available574Open in IMG/M
Ga0255813_10916962All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae8349Open in IMG/M
Ga0255813_10921071Not Available1624Open in IMG/M
Ga0255813_10928079All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays771Open in IMG/M
Ga0255813_10928327All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus8550Open in IMG/M
Ga0255813_10932335All Organisms → cellular organisms → Eukaryota → Opisthokonta4293Open in IMG/M
Ga0255813_10933660Not Available1285Open in IMG/M
Ga0255813_10934404All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Charadriiformes → Scolopacidae → Limosa → Limosa lapponica → Limosa lapponica baueri970Open in IMG/M
Ga0255813_10934503All Organisms → cellular organisms → Eukaryota → Opisthokonta681Open in IMG/M
Ga0255813_10936793Not Available2227Open in IMG/M
Ga0255813_10937605Not Available917Open in IMG/M
Ga0255813_10943219All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora549Open in IMG/M
Ga0255813_10943662All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Pavo → Pavo cristatus1364Open in IMG/M
Ga0255813_10944462All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae1807Open in IMG/M
Ga0255813_10945453All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae2556Open in IMG/M
Ga0255813_10945837Not Available3768Open in IMG/M
Ga0255813_10946241All Organisms → cellular organisms → Eukaryota → Opisthokonta2078Open in IMG/M
Ga0255813_10949282All Organisms → cellular organisms → Eukaryota → Opisthokonta620Open in IMG/M
Ga0255813_10951205Not Available1476Open in IMG/M
Ga0255813_10953804All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum644Open in IMG/M
Ga0255813_10956861All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae1217Open in IMG/M
Ga0255813_10960098All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus1021Open in IMG/M
Ga0255813_10960768All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria604Open in IMG/M
Ga0255813_10964777Not Available579Open in IMG/M
Ga0255813_10965120All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea abies661Open in IMG/M
Ga0255813_10968884All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis745Open in IMG/M
Ga0255813_10969353All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae2411Open in IMG/M
Ga0255813_10971998All Organisms → cellular organisms → Eukaryota → Opisthokonta3961Open in IMG/M
Ga0255813_10972856All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum666Open in IMG/M
Ga0255813_10975833All Organisms → cellular organisms → Eukaryota → Opisthokonta10903Open in IMG/M
Ga0255813_10977414All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae2609Open in IMG/M
Ga0255813_10981198All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → Bacteroides uniformis916Open in IMG/M
Ga0255813_10983838All Organisms → cellular organisms → Eukaryota → Opisthokonta1212Open in IMG/M
Ga0255813_10985027Not Available2884Open in IMG/M
Ga0255813_10987390All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae8714Open in IMG/M
Ga0255813_10987978All Organisms → cellular organisms → Bacteria537Open in IMG/M
Ga0255813_10993393All Organisms → cellular organisms → Eukaryota → Opisthokonta1713Open in IMG/M
Ga0255813_10994257Not Available1201Open in IMG/M
Ga0255813_10996732All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays575Open in IMG/M
Ga0255813_11001100All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae11795Open in IMG/M
Ga0255813_11001578All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae12587Open in IMG/M
Ga0255813_11001831All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays732Open in IMG/M
Ga0255813_11002909All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Cuculiformes → Coccyzidae → Piaya → Piaya cayana9181Open in IMG/M
Ga0255813_11012599Not Available576Open in IMG/M
Ga0255813_11017323All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus5140Open in IMG/M
Ga0255813_11017832All Organisms → cellular organisms → Eukaryota → Opisthokonta984Open in IMG/M
Ga0255813_11018219All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta710Open in IMG/M
Ga0255813_11018655Not Available687Open in IMG/M
Ga0255813_11021132All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata882Open in IMG/M
Ga0255813_11024765All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae989Open in IMG/M
Ga0255813_11027707All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus2657Open in IMG/M
Ga0255813_11028060Not Available563Open in IMG/M
Ga0255813_11028376Not Available1118Open in IMG/M
Ga0255813_11028624All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae759Open in IMG/M
Ga0255813_11028940Not Available2445Open in IMG/M
Ga0255813_11029564All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Strigiformes → Strigidae → Athene → Athene cunicularia3492Open in IMG/M
Ga0255813_11029967All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays579Open in IMG/M
Ga0255813_11033531All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae581Open in IMG/M
Ga0255813_11034449All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum762Open in IMG/M
Ga0255813_11036700Not Available756Open in IMG/M
Ga0255813_11039459Not Available536Open in IMG/M
Ga0255813_11039755Not Available1818Open in IMG/M
Ga0255813_11041526All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus687Open in IMG/M
Ga0255813_11042867Not Available959Open in IMG/M
Ga0255813_11044312Not Available1256Open in IMG/M
Ga0255813_11058645All Organisms → cellular organisms → Eukaryota → Opisthokonta1645Open in IMG/M
Ga0255813_11063175All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea1248Open in IMG/M
Ga0255813_11064177Not Available2183Open in IMG/M
Ga0255813_11072389All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae6814Open in IMG/M
Ga0255813_11073439All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae2560Open in IMG/M
Ga0255813_11074491All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae1072Open in IMG/M
Ga0255813_11077121All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae580Open in IMG/M
Ga0255813_11077830All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae673Open in IMG/M
Ga0255813_11078428All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae2881Open in IMG/M
Ga0255813_11082509All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays582Open in IMG/M
Ga0255813_11082934Not Available1886Open in IMG/M
Ga0255813_11089843All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora → Bovidae → Caprinae → Ovis → Ovis aries549Open in IMG/M
Ga0255813_11089982All Organisms → cellular organisms → Eukaryota → Opisthokonta502Open in IMG/M
Ga0255813_11092899All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae2360Open in IMG/M
Ga0255813_11095790All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum772Open in IMG/M
Ga0255813_11102295All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae1467Open in IMG/M
Ga0255813_11102531Not Available2048Open in IMG/M
Ga0255813_11104990Not Available602Open in IMG/M
Ga0255813_11106864Not Available1512Open in IMG/M
Ga0255813_11107939All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae752Open in IMG/M
Ga0255813_11112711Not Available711Open in IMG/M
Ga0255813_11113094All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae655Open in IMG/M
Ga0255813_11123497All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae911Open in IMG/M
Ga0255813_11124007All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae3449Open in IMG/M
Ga0255813_11125599All Organisms → cellular organisms → Eukaryota → Opisthokonta2212Open in IMG/M
Ga0255813_11127678Not Available2661Open in IMG/M
Ga0255813_11131392Not Available2716Open in IMG/M
Ga0255813_11133702All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus604Open in IMG/M
Ga0255813_11137904Not Available1035Open in IMG/M
Ga0255813_11139114Not Available1277Open in IMG/M
Ga0255813_11142508All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Salmonella → unclassified Salmonella → Salmonella sp. hn-f5516Open in IMG/M
Ga0255813_11145859Not Available1495Open in IMG/M
Ga0255813_11147865Not Available5389Open in IMG/M
Ga0255813_11149471All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus2395Open in IMG/M
Ga0255813_11150966All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae1560Open in IMG/M
Ga0255813_11155817All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae5639Open in IMG/M
Ga0255813_11158789All Organisms → cellular organisms → Eukaryota → Opisthokonta1483Open in IMG/M
Ga0255813_11159208All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae6964Open in IMG/M
Ga0255813_11160479All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae4046Open in IMG/M
Ga0255813_11165421Not Available506Open in IMG/M
Ga0255813_11166356All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae2750Open in IMG/M
Ga0255813_11169167Not Available797Open in IMG/M
Ga0255813_11171565Not Available539Open in IMG/M
Ga0255813_11177590All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae10382Open in IMG/M
Ga0255813_11177958All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea680Open in IMG/M
Ga0255813_11178377All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae550Open in IMG/M
Ga0255813_11184379All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae705Open in IMG/M
Ga0255813_11186321Not Available2694Open in IMG/M
Ga0255813_11186576All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus618Open in IMG/M
Ga0255813_11188275All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae768Open in IMG/M
Ga0255813_11193529All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus4138Open in IMG/M
Ga0255813_11194339Not Available913Open in IMG/M
Ga0255813_11196704All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus1610Open in IMG/M
Ga0255813_11197224All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum urartu585Open in IMG/M
Ga0255813_11198145Not Available713Open in IMG/M
Ga0255813_11202325All Organisms → cellular organisms → Eukaryota → Opisthokonta23357Open in IMG/M
Ga0255813_11203212Not Available720Open in IMG/M
Ga0255813_11203289All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae6896Open in IMG/M
Ga0255813_11203984All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays623Open in IMG/M
Ga0255813_11206971Not Available1761Open in IMG/M
Ga0255813_11208557All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae3524Open in IMG/M
Ga0255813_11210156All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae4036Open in IMG/M
Ga0255813_11211411All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus1544Open in IMG/M
Ga0255813_11216806All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae6709Open in IMG/M
Ga0255813_11218538All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus988Open in IMG/M
Ga0255813_11220881All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum642Open in IMG/M
Ga0255813_11221003Not Available624Open in IMG/M
Ga0255813_11222613Not Available1995Open in IMG/M
Ga0255813_11224867Not Available3064Open in IMG/M
Ga0255813_11225531Not Available1263Open in IMG/M
Ga0255813_11225982Not Available1166Open in IMG/M
Ga0255813_11226423All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae4486Open in IMG/M
Ga0255813_11227413Not Available3585Open in IMG/M
Ga0255813_11230407All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae1377Open in IMG/M
Ga0255813_11230644All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae5855Open in IMG/M
Ga0255813_11231944Not Available602Open in IMG/M
Ga0255813_11232308All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus1406Open in IMG/M
Ga0255813_11234408Not Available920Open in IMG/M
Ga0255813_11235148All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Passeriformes → Sylvioidea → Zosteropidae → Zosterops → Zosterops borbonicus3331Open in IMG/M
Ga0255813_11237192Not Available562Open in IMG/M
Ga0255813_11239074Not Available1977Open in IMG/M
Ga0255813_11243058All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays987Open in IMG/M
Ga0255813_11246124All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus586Open in IMG/M
Ga0255813_11248127All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae5868Open in IMG/M
Ga0255813_11254665All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78809Open in IMG/M
Ga0255813_11255120All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae748Open in IMG/M
Ga0255813_11257653All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae644Open in IMG/M
Ga0255813_11260981All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus2731Open in IMG/M
Ga0255813_11264886Not Available11092Open in IMG/M
Ga0255813_11265649All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae1323Open in IMG/M
Ga0255813_11265825Not Available723Open in IMG/M
Ga0255813_11265827All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae1345Open in IMG/M
Ga0255813_11266988All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves1212Open in IMG/M
Ga0255813_11267089Not Available647Open in IMG/M
Ga0255813_11270653All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae3418Open in IMG/M
Ga0255813_11272742All Organisms → cellular organisms → Eukaryota → Opisthokonta565Open in IMG/M
Ga0255813_11276668All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae1895Open in IMG/M
Ga0255813_11284259All Organisms → cellular organisms → Eukaryota → Opisthokonta2209Open in IMG/M
Ga0255813_11289511All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae1656Open in IMG/M
Ga0255813_11289635All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus702Open in IMG/M
Ga0255813_11295412All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae568Open in IMG/M
Ga0255813_11301947All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae2784Open in IMG/M
Ga0255813_11302517All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves9584Open in IMG/M
Ga0255813_11309932All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae876Open in IMG/M
Ga0255813_11314258All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae778Open in IMG/M
Ga0255813_11315344All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae2373Open in IMG/M
Ga0255813_11317359All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae1307Open in IMG/M
Ga0255813_11319248Not Available699Open in IMG/M
Ga0255813_11319859All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78613Open in IMG/M
Ga0255813_11319925All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus576Open in IMG/M
Ga0255813_11321379All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae1083Open in IMG/M
Ga0255813_11322073All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae883Open in IMG/M
Ga0255813_11323952Not Available2780Open in IMG/M
Ga0255813_11324749All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata772Open in IMG/M
Ga0255813_11326169All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum urartu576Open in IMG/M
Ga0255813_11327641All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus908Open in IMG/M
Ga0255813_11329308Not Available600Open in IMG/M
Ga0255813_11331173All Organisms → cellular organisms → Eukaryota → Opisthokonta7702Open in IMG/M
Ga0255813_11331380All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae508Open in IMG/M
Ga0255813_11332787All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae10435Open in IMG/M
Ga0255813_11333892Not Available1028Open in IMG/M
Ga0255813_11334349All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays505Open in IMG/M
Ga0255813_11334559All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae918Open in IMG/M
Ga0255813_11337008All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum1228Open in IMG/M
Ga0255813_11339082Not Available1736Open in IMG/M
Ga0255813_11339920All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae6013Open in IMG/M
Ga0255813_11341734Not Available1418Open in IMG/M
Ga0255813_11345634All Organisms → cellular organisms → Eukaryota → Opisthokonta2459Open in IMG/M
Ga0255813_11353165All Organisms → cellular organisms → Eukaryota → Opisthokonta746Open in IMG/M
Ga0255813_11354651All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum urartu726Open in IMG/M
Ga0255813_11356359Not Available1934Open in IMG/M
Ga0255813_11356680All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae844Open in IMG/M
Ga0255813_11358673Not Available563Open in IMG/M
Ga0255813_11360646All Organisms → cellular organisms → Eukaryota → Opisthokonta6749Open in IMG/M
Ga0255813_11364041All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum640Open in IMG/M
Ga0255813_11368648All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae2903Open in IMG/M
Ga0255813_11369015All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae733Open in IMG/M
Ga0255813_11379295All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Passeriformes8384Open in IMG/M
Ga0255813_11380430All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus3431Open in IMG/M
Ga0255813_11380994Not Available881Open in IMG/M
Ga0255813_11381237All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays1041Open in IMG/M
Ga0255813_11383027Not Available3024Open in IMG/M
Ga0255813_11383592All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus1380Open in IMG/M
Ga0255813_11386261All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Meleagridinae → Meleagris → Meleagris gallopavo3892Open in IMG/M
Ga0255813_11386924All Organisms → cellular organisms → Eukaryota → Opisthokonta955Open in IMG/M
Ga0255813_11387928Not Available570Open in IMG/M
Ga0255813_11389367Not Available515Open in IMG/M
Ga0255813_11392109Not Available1396Open in IMG/M
Ga0255813_11392634Not Available512Open in IMG/M
Ga0255813_11392964All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus612Open in IMG/M
Ga0255813_11396503All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Phasianus → Phasianus colchicus3309Open in IMG/M
Ga0255813_11402756All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Perdicinae → Coturnix → Coturnix japonica1562Open in IMG/M
Ga0255813_11403204All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae5255Open in IMG/M
Ga0255813_11404410All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae2541Open in IMG/M
Ga0255813_11404724All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae7860Open in IMG/M
Ga0255813_11405308All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae562Open in IMG/M
Ga0255813_11407765All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora621Open in IMG/M
Ga0255813_11410282All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae1450Open in IMG/M
Ga0255813_11410482Not Available3333Open in IMG/M
Ga0255813_11412495All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae3603Open in IMG/M
Ga0255813_11417509Not Available1342Open in IMG/M
Ga0255813_11423377All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae4275Open in IMG/M
Ga0255813_11425818All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae4854Open in IMG/M
Ga0255813_11427997All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae2367Open in IMG/M
Ga0255813_11429281Not Available1367Open in IMG/M
Ga0255813_11433089All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Charadriiformes → Scolopacidae → Limosa → Limosa lapponica → Limosa lapponica baueri7861Open in IMG/M
Ga0255813_11434216Not Available3308Open in IMG/M
Ga0255813_11437212All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis897Open in IMG/M
Ga0255813_11437516All Organisms → cellular organisms → Eukaryota → Opisthokonta2561Open in IMG/M
Ga0255813_11439828All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays705Open in IMG/M
Ga0255813_11442218All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae9903Open in IMG/M
Ga0255813_11442506All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Salmonella → unclassified Salmonella → Salmonella sp. hn-f5722Open in IMG/M
Ga0255813_11443051All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae1430Open in IMG/M
Ga0255813_11443428All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Morganellaceae → Proteus → Proteus mirabilis630Open in IMG/M
Ga0255813_11444314All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae4291Open in IMG/M
Ga0255813_11447085All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus640Open in IMG/M
Ga0255813_11450170Not Available513Open in IMG/M
Ga0255813_11454161All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae11083Open in IMG/M
Ga0255813_11454427Not Available1866Open in IMG/M
Ga0255813_11455620Not Available9698Open in IMG/M
Ga0255813_11462447Not Available574Open in IMG/M
Ga0255813_11462838All Organisms → cellular organisms → Eukaryota → Opisthokonta1854Open in IMG/M
Ga0255813_11466332All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Meleagridinae → Meleagris → Meleagris gallopavo6039Open in IMG/M
Ga0255813_11467550Not Available1144Open in IMG/M
Ga0255813_11468884Not Available1665Open in IMG/M
Ga0255813_11474609All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Charadriiformes → Scolopacidae → Calidris → Calidris pygmaea2550Open in IMG/M
Ga0255813_11477032All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae9906Open in IMG/M
Ga0255813_11478182All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae4495Open in IMG/M
Ga0255813_11486114All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae6488Open in IMG/M
Ga0255813_11490674Not Available4479Open in IMG/M
Ga0255813_11491078All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78567Open in IMG/M
Ga0255813_11493153All Organisms → cellular organisms → Eukaryota → Opisthokonta501Open in IMG/M
Ga0255813_11496508Not Available1350Open in IMG/M
Ga0255813_11505794All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae4333Open in IMG/M
Ga0255813_11510580Not Available718Open in IMG/M
Ga0255813_11510869All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae2353Open in IMG/M
Ga0255813_11520522Not Available632Open in IMG/M
Ga0255813_11521254Not Available2665Open in IMG/M
Ga0255813_11525103Not Available891Open in IMG/M
Ga0255813_11525338All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum594Open in IMG/M
Ga0255813_11526561All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays522Open in IMG/M
Ga0255813_11526856Not Available576Open in IMG/M
Ga0255813_11527524All Organisms → cellular organisms → Eukaryota → Opisthokonta1634Open in IMG/M
Ga0255813_11527871All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus1223Open in IMG/M
Ga0255813_11528315All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae1880Open in IMG/M
Ga0255813_11529117All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus2207Open in IMG/M
Ga0255813_11529955All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Passeriformes → Corvoidea → Corvidae → Corvus → Corvus moneduloides3443Open in IMG/M
Ga0255813_11531579All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78593Open in IMG/M
Ga0255813_11531680All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus832Open in IMG/M
Ga0255813_11532889All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae1391Open in IMG/M
Ga0255813_11534319All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus9104Open in IMG/M
Ga0255813_11542302Not Available5513Open in IMG/M
Ga0255813_11545548All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae3462Open in IMG/M
Ga0255813_11550791All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae12799Open in IMG/M
Ga0255813_11556094All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae770Open in IMG/M
Ga0255813_11558623Not Available1292Open in IMG/M
Ga0255813_11558634All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae3106Open in IMG/M
Ga0255813_11558741Not Available505Open in IMG/M
Ga0255813_11565919All Organisms → cellular organisms → Eukaryota → Opisthokonta2618Open in IMG/M
Ga0255813_11570746All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea741Open in IMG/M
Ga0255813_11573789Not Available552Open in IMG/M
Ga0255813_11578792All Organisms → cellular organisms → Eukaryota → Opisthokonta1420Open in IMG/M
Ga0255813_11586045Not Available1766Open in IMG/M
Ga0255813_11587881All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78691Open in IMG/M
Ga0255813_11589760Not Available1756Open in IMG/M
Ga0255813_11591633All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays605Open in IMG/M
Ga0255813_11596108All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum598Open in IMG/M
Ga0255813_11597337All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora → Bovidae → Bovinae → Bos → Bos grunniens791Open in IMG/M
Ga0255813_11605590All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum734Open in IMG/M
Ga0255813_11606613All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae1547Open in IMG/M
Ga0255813_11606895All Organisms → cellular organisms → Eukaryota → Opisthokonta534Open in IMG/M
Ga0255813_11608055All Organisms → cellular organisms → Eukaryota → Opisthokonta528Open in IMG/M
Ga0255813_11613452All Organisms → cellular organisms → Eukaryota → Opisthokonta2640Open in IMG/M
Ga0255813_11614698All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus597Open in IMG/M
Ga0255813_11615887Not Available676Open in IMG/M
Ga0255813_11617699Not Available2662Open in IMG/M
Ga0255813_11624594All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae1118Open in IMG/M
Ga0255813_11626058All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae2633Open in IMG/M
Ga0255813_11628746All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae1553Open in IMG/M
Ga0255813_11632550All Organisms → cellular organisms → Eukaryota → Opisthokonta1531Open in IMG/M
Ga0255813_11632838All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum650Open in IMG/M
Ga0255813_11634211All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae721Open in IMG/M
Ga0255813_11639947Not Available1061Open in IMG/M
Ga0255813_11644365All Organisms → cellular organisms → Eukaryota → Opisthokonta1653Open in IMG/M
Ga0255813_11649385All Organisms → cellular organisms → Eukaryota → Opisthokonta2400Open in IMG/M
Ga0255813_11650749Not Available648Open in IMG/M
Ga0255813_11650977All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae8808Open in IMG/M
Ga0255813_11652833All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae2390Open in IMG/M
Ga0255813_11654227Not Available4514Open in IMG/M
Ga0255813_11655566All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae1087Open in IMG/M
Ga0255813_11658542All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae1262Open in IMG/M
Ga0255813_11658566All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae969Open in IMG/M
Ga0255813_11661193All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae4144Open in IMG/M
Ga0255813_11662974All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae1390Open in IMG/M
Ga0255813_11664893Not Available2170Open in IMG/M
Ga0255813_11668108All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora542Open in IMG/M
Ga0255813_11668165All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum679Open in IMG/M
Ga0255813_11676192All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae1208Open in IMG/M
Ga0255813_11676876Not Available3140Open in IMG/M
Ga0255813_11676893All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Euarchontoglires → Glires → Rodentia → Myomorpha → Muroidea → Muridae → Murinae → Rattus → Rattus norvegicus2717Open in IMG/M
Ga0255813_11678640All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays543Open in IMG/M
Ga0255813_11679951All Organisms → cellular organisms → Eukaryota → Opisthokonta5421Open in IMG/M
Ga0255813_11680177All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae2912Open in IMG/M
Ga0255813_11683287All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes788Open in IMG/M
Ga0255813_11692750All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae584Open in IMG/M
Ga0255813_11693448All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae1267Open in IMG/M
Ga0255813_11695398Not Available4690Open in IMG/M
Ga0255813_11697497Not Available1782Open in IMG/M
Ga0255813_11698800All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae1656Open in IMG/M
Ga0255813_11699957Not Available1844Open in IMG/M
Ga0255813_11700695All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Testudinata → Testudines → Cryptodira → Durocryptodira → Testudinoidea → Emydidae → Chrysemys → Chrysemys picta → Chrysemys picta bellii7161Open in IMG/M
Ga0255813_11702937All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae6324Open in IMG/M
Ga0255813_11706737Not Available3764Open in IMG/M
Ga0255813_11710671All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum1232Open in IMG/M
Ga0255813_11711085All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae548Open in IMG/M
Ga0255813_11711751Not Available1781Open in IMG/M
Ga0255813_11712867Not Available665Open in IMG/M
Ga0255813_11716927Not Available835Open in IMG/M
Ga0255813_11719492All Organisms → cellular organisms → Eukaryota → Opisthokonta500Open in IMG/M
Ga0255813_11721791All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae945Open in IMG/M
Ga0255813_11721968All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae2572Open in IMG/M
Ga0255813_11727925All Organisms → cellular organisms → Eukaryota → Opisthokonta509Open in IMG/M
Ga0255813_11729013All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays528Open in IMG/M
Ga0255813_11729698Not Available520Open in IMG/M
Ga0255813_11729948All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus2272Open in IMG/M
Ga0255813_11734235All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum urartu750Open in IMG/M
Ga0255813_11736000All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum urartu654Open in IMG/M
Ga0255813_11743679All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum773Open in IMG/M
Ga0255813_11749349All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae889Open in IMG/M
Ga0255813_11751485Not Available1581Open in IMG/M
Ga0255813_11753196Not Available2325Open in IMG/M
Ga0255813_11754314Not Available686Open in IMG/M
Ga0255813_11755259All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum614Open in IMG/M
Ga0255813_11755282All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae3016Open in IMG/M
Ga0255813_11757415Not Available2764Open in IMG/M
Ga0255813_11758059All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum1117Open in IMG/M
Ga0255813_11759388All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae2466Open in IMG/M
Ga0255813_11767727All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum851Open in IMG/M
Ga0255813_11768275All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae1654Open in IMG/M
Ga0255813_11768461All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Morganellaceae → Proteus → Proteus mirabilis618Open in IMG/M
Ga0255813_11776459All Organisms → cellular organisms → Eukaryota → Opisthokonta1117Open in IMG/M
Ga0255813_11777203Not Available3766Open in IMG/M
Ga0255813_11782794All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae6794Open in IMG/M
Ga0255813_11784168All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Meleagridinae → Meleagris → Meleagris gallopavo897Open in IMG/M
Ga0255813_11793534All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus5825Open in IMG/M
Ga0255813_11796781Not Available4109Open in IMG/M
Ga0255813_11798251All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae5592Open in IMG/M
Ga0255813_11804865All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Morganellaceae → Proteus → Proteus mirabilis966Open in IMG/M
Ga0255813_11806227All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Odontophoridae → Odontophorus → Odontophorus gujanensis1006Open in IMG/M
Ga0255813_11811969All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae653Open in IMG/M
Ga0255813_11812485All Organisms → cellular organisms → Eukaryota → Opisthokonta2650Open in IMG/M
Ga0255813_11814895All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae809Open in IMG/M
Ga0255813_11823149All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus1436Open in IMG/M
Ga0255813_11824830Not Available564Open in IMG/M
Ga0255813_11832434All Organisms → cellular organisms → Eukaryota → Opisthokonta2205Open in IMG/M
Ga0255813_11833969Not Available2158Open in IMG/M
Ga0255813_11840228All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae2688Open in IMG/M
Ga0255813_11856295All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora562Open in IMG/M
Ga0255813_11861795Not Available549Open in IMG/M
Ga0255813_11862333Not Available1937Open in IMG/M
Ga0255813_11863044All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → Bacteroides uniformis600Open in IMG/M
Ga0255813_11863716Not Available617Open in IMG/M
Ga0255813_11864718Not Available1031Open in IMG/M
Ga0255813_11866523All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae3486Open in IMG/M
Ga0255813_11870916Not Available713Open in IMG/M
Ga0255813_11871519Not Available547Open in IMG/M
Ga0255813_11876644All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae2219Open in IMG/M
Ga0255813_11877957All Organisms → cellular organisms → Eukaryota → Opisthokonta4583Open in IMG/M
Ga0255813_11889257All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae7198Open in IMG/M
Ga0255813_11889450All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Morganellaceae → Proteus → Proteus mirabilis513Open in IMG/M
Ga0255813_11893022All Organisms → cellular organisms → Eukaryota → Opisthokonta520Open in IMG/M
Ga0255813_11893654Not Available1262Open in IMG/M
Ga0255813_11895778All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum752Open in IMG/M
Ga0255813_11896426All Organisms → cellular organisms → Eukaryota → Opisthokonta884Open in IMG/M
Ga0255813_11897063All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae661Open in IMG/M
Ga0255813_11900346All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus12893Open in IMG/M
Ga0255813_11902198All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae5222Open in IMG/M
Ga0255813_11903387All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae3567Open in IMG/M
Ga0255813_11906351Not Available732Open in IMG/M
Ga0255813_11906901All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae10156Open in IMG/M
Ga0255813_11908452All Organisms → cellular organisms → Eukaryota569Open in IMG/M
Ga0255813_11915014Not Available1178Open in IMG/M
Ga0255813_11924733All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Meleagridinae → Meleagris → Meleagris gallopavo11467Open in IMG/M
Ga0255813_11924984All Organisms → cellular organisms → Eukaryota → Opisthokonta802Open in IMG/M
Ga0255813_11927542All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora → Bovidae1985Open in IMG/M
Ga0255813_11929714All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae2755Open in IMG/M
Ga0255813_11930920All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae642Open in IMG/M
Ga0255813_11936933All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus930Open in IMG/M
Ga0255813_11937967All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata5004Open in IMG/M
Ga0255813_11938592All Organisms → cellular organisms → Eukaryota → Opisthokonta3497Open in IMG/M
Ga0255813_11940554All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae4827Open in IMG/M
Ga0255813_11943074All Organisms → cellular organisms → Bacteria520Open in IMG/M
Ga0255813_11944212All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria650Open in IMG/M
Ga0255813_11946301Not Available611Open in IMG/M
Ga0255813_11947592Not Available1811Open in IMG/M
Ga0255813_11954235All Organisms → cellular organisms → Eukaryota → Opisthokonta1543Open in IMG/M
Ga0255813_11954998All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae4434Open in IMG/M
Ga0255813_11956847Not Available897Open in IMG/M
Ga0255813_11957592Not Available1059Open in IMG/M
Ga0255813_11959031All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae963Open in IMG/M
Ga0255813_11959673All Organisms → cellular organisms → Eukaryota → Opisthokonta3515Open in IMG/M
Ga0255813_11960871All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae3895Open in IMG/M
Ga0255813_11962453All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae727Open in IMG/M
Ga0255813_11963745All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae1927Open in IMG/M
Ga0255813_11964581All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae907Open in IMG/M
Ga0255813_11968561Not Available729Open in IMG/M
Ga0255813_11968840All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78544Open in IMG/M
Ga0255813_11969776All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae2438Open in IMG/M
Ga0255813_11973359All Organisms → cellular organisms → Eukaryota → Opisthokonta13808Open in IMG/M
Ga0255813_11978131Not Available684Open in IMG/M
Ga0255813_11978955All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Clostridiaceae → Clostridium → unclassified Clostridium → Clostridium sp.739Open in IMG/M
Ga0255813_11980850All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves7282Open in IMG/M
Ga0255813_11981458All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae1589Open in IMG/M
Ga0255813_11984919All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae810Open in IMG/M
Ga0255813_11989910Not Available1565Open in IMG/M
Ga0255813_11992169All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum502Open in IMG/M
Ga0255813_11993578All Organisms → cellular organisms → Eukaryota → Opisthokonta6296Open in IMG/M
Ga0255813_11995511All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum556Open in IMG/M
Ga0255813_11999227All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae1690Open in IMG/M
Ga0255813_12007850All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora → Bovidae → Bovinae → Bos551Open in IMG/M
Ga0255813_12016059All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa4401Open in IMG/M
Ga0255813_12017402Not Available4095Open in IMG/M
Ga0255813_12018225Not Available2211Open in IMG/M
Ga0255813_12019289All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae11301Open in IMG/M
Ga0255813_12020200Not Available2534Open in IMG/M
Ga0255813_12020805All Organisms → cellular organisms → Eukaryota → Opisthokonta1697Open in IMG/M
Ga0255813_12021224All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus571Open in IMG/M
Ga0255813_12022799Not Available1705Open in IMG/M
Ga0255813_12023469Not Available1874Open in IMG/M
Ga0255813_12023707All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae2053Open in IMG/M
Ga0255813_12030170All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Morganellaceae → Proteus → Proteus mirabilis666Open in IMG/M
Ga0255813_12030809All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae649Open in IMG/M
Ga0255813_12033238All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum urartu1585Open in IMG/M
Ga0255813_12034360All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus985Open in IMG/M
Ga0255813_12035945Not Available4141Open in IMG/M
Ga0255813_12038878All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae19759Open in IMG/M
Ga0255813_12046388All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae1026Open in IMG/M
Ga0255813_12050226Not Available1035Open in IMG/M
Ga0255813_12051011All Organisms → cellular organisms → Eukaryota → Opisthokonta10880Open in IMG/M
Ga0255813_12052316Not Available1581Open in IMG/M
Ga0255813_12056342All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae1428Open in IMG/M
Ga0255813_12058871Not Available526Open in IMG/M
Ga0255813_12059413All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae1398Open in IMG/M
Ga0255813_12059643All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae3583Open in IMG/M
Ga0255813_12059794Not Available768Open in IMG/M
Ga0255813_12063914Not Available643Open in IMG/M
Ga0255813_12064457All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae1065Open in IMG/M
Ga0255813_12067752Not Available1061Open in IMG/M
Ga0255813_12068940All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Hordeinae → Hordeum → Hordeum vulgare → Hordeum vulgare subsp. vulgare842Open in IMG/M
Ga0255813_12069328All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae2264Open in IMG/M
Ga0255813_12076481All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus2919Open in IMG/M
Ga0255813_12078882Not Available700Open in IMG/M
Ga0255813_12079146Not Available4225Open in IMG/M
Ga0255813_12080255All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae1776Open in IMG/M
Ga0255813_12080452Not Available4744Open in IMG/M
Ga0255813_12080525All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Tetraoninae → Lagopus → Lagopus muta1282Open in IMG/M
Ga0255813_12080941Not Available2922Open in IMG/M
Ga0255813_12082397All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves10451Open in IMG/M
Ga0255813_12084632All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae2429Open in IMG/M
Ga0255813_12085137Not Available2111Open in IMG/M
Ga0255813_12085442Not Available572Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0255813_10002796Ga0255813_100027969F001813VPGGVERAFGCCVEGHGLAGTIGEGRMVGLDDPVGLFQP
Ga0255813_10003366Ga0255813_100033661F038489MAWVEKDHNNHPVSTPCYVQGHQPADHAAQSHIQPGLE
Ga0255813_10010267Ga0255813_100102671F004815LEAFKARLDVALGSLVCWLATLHIAGGWNWMSIVVLFNPGHSMIL
Ga0255813_10015872Ga0255813_100158722F004001VESPSLEVFKKRGAVTLRDMDSGHGGFGLVVRLGDLGGLFQP
Ga0255813_10017733Ga0255813_100177331F096762EAASIEDLNLESTIEHIDKMLLDMATEEATTAAEEAMAAVSGKGKEIADDTSEDETFMFQNLVGQELSKTEIEELKEYAKSCGYKPGALLFGGIDDEKLNCIRDQTGAKIISTLSKSIGFPKLETDISRYRRQHIVGSLFYSNFKVNYFSLNFYCF
Ga0255813_10020741Ga0255813_100207416F004815RLDVALGSLGCWLATLHIAGGWNWMSVVVFFNPGHSRIL
Ga0255813_10022454Ga0255813_100224541F038012MIIEFQPPCYVQGRQPPDQAAQSHIQPGLECLQGWGIHNLLGQPVSVCYN
Ga0255813_10028522Ga0255813_100285224F038012MTIQFQTPCYVQGRQPPDQAAQSHIQPGLECLQGWGIHSLLG
Ga0255813_10029410Ga0255813_100294101F011632KGGQALEWAAQRGGRVTDPGVVQRAFGCCVEGLGLARTMGEGRMVGLDDPVGLLQP
Ga0255813_10029568Ga0255813_100295681F001813GVQRVFGCCVEGHGLAGTIGEGRMVGLDDPVGLFQP
Ga0255813_10036204Ga0255813_1003620422F028669MYAQCEIKQERFICWSDQLIKNVNTHNGGWTLLRVGVRGKGRRAIER
Ga0255813_10036706Ga0255813_100367062F011632MGCQRGGGVTESGGVQRAFGCCVEGHGLVSATGYGRMVGLDDPVGLFQP
Ga0255813_10039521Ga0255813_100395213F038489MAWAEKDHNDHFISTPCYVQGRQPADQAAQSHIQPGLERLQGWGIY
Ga0255813_10040975Ga0255813_100409753F005658MAWVEKDHSAHPVPTPCYVQGRQPAAQAAQSHIQPGLECLQGWG
Ga0255813_10045378Ga0255813_100453781F079404GTPKKASEDWPWEWFYIEDAPLPDPVRIGLPEFSAAPLKKRLNWRLRSPQREDDRSVQYLMGRIRLLAHSGLTMIGVMATCIMRGVQPLQYRGHPMWDFNGENDATRHSRKGPGSTADLVKILSGLYKGEKEDFLRTSPLNGFSMNNPRSWVSGRLYIRSVLSKLSVSFCDFDAGTAPGRKRYK
Ga0255813_10046364Ga0255813_100463645F005658MAWVAKEHSSHSVPTPCYVQGRQPAAQAAQSHIQPGLECLQGWG
Ga0255813_10051240Ga0255813_100512402F020828LKQLVELHKVAEQALKGFIVWLWPGEALPGSYFGLVRRLVEACPRLEVIKPSVCIEGARRALARAKVHWGKLDGEKLVRDRPPPGKEHCKPENYYKDVLAGARLMADECTKDVIFE
Ga0255813_10054477Ga0255813_100544771F038985MILTTGAMPKKCHLGPQNGSGSSGPEKLLKIVSCAETEKMKEEMVGPQVE
Ga0255813_10055660Ga0255813_100556601F038003EKTTDVVSPQRANPKRTDDASTLAKNLLGVSLVPEITVQSVPDATSPPSIDQEVPSVFHLVPFRFSFDPPSDPASVSAFIKAYPNLPGYHMWSTWDRLTVVSTYGPPGSEEDDEPDSGWDFSGLGNPSAMRDFMTACDYCLSDCSDDGHSLDDEGCGPSRECFHVDLGGLDEGNHLGMLEDGDPPRPVPRVDILRELVVVPVPEGGHDPQLEQIREM
Ga0255813_10060218Ga0255813_100602181F011632QRGGGVTDPGGVQGTSGRWVEGHGLMRTIGEGRMVGLDDPVGLFQP
Ga0255813_10060882Ga0255813_100608821F011735GKFKSMWYGPYIVKKVLKKGVYTLVDFEGNELPEPRNGLYLKKYYA
Ga0255813_10065339Ga0255813_100653391F012765KDLTIKDLRASKKLAAQELETARLATKALEDSCTVLKAQRDKAMDKAIRAGRILMXRPGVIVPDDIIADVNAAPNSLSRPSSSVAPEKNITK
Ga0255813_10066102Ga0255813_100661021F001813VEGTFGCCVEGHGLVRTIGDGWMVGLDDPVGLFQPW
Ga0255813_10066269Ga0255813_100662693F001813GVQGTFVCCIEGHGLMRTISDGWIVGLGDPVGLFQPW
Ga0255813_10069506Ga0255813_100695062F105149VGVVAINFFEFGSLLFEVTKIFRNFFRGRNMFRKMYQGGPSRKQGPRLAMRDADKEPPRDAQVRACEWPSEDFMDQAGIKEEFNAYVRNTDLVSFEADKCRQYHYLTDSFVRRFEFSSSRNSQTVLFDLYENSYTMDLEDFNTACKLPQWGSPSEPRKSELRNFLASITVGDSREITQAT
Ga0255813_10072866Ga0255813_100728661F068298VLEWAAQRGGGVTNPGSVRGTFGCCVEGHGLVRTIGDV
Ga0255813_10073006Ga0255813_100730064F038084VEIHTVKAFGVINKTEVGVFLQLSSCFNDPTDVGNLISGSSAFSKSSLYNWKFSVHVLLKPGMENFEHYFTSV
Ga0255813_10078345Ga0255813_100783451F038012MIIEFQPPCYVQGCQPADQAAQSHIQPGLECLQGWGIHSLLGQPVSVRHHPLCEKLLPN
Ga0255813_10080967Ga0255813_100809671F068298ALEWAAQRGGGVTDPGGVQGTFGCCTEGHGLVGRYWR
Ga0255813_10082804Ga0255813_100828041F020828VSDAATFYRAEEGSSTEKVFWSQYAEAGHPVPLRDQLKQLVELHKVAEQAMKGLIVRLWPKEAMPGSYFGLVRQLVDACPWVEVIKHSACIEGARRALARAKVHWGKMDAEKRMTDAPPPGKEYRTPEMYYKGVLKGA
Ga0255813_10085115Ga0255813_100851151F005658MAWVERDHNAHPVPTPCYVQGHQPAAQAAQSHTQPGLE
Ga0255813_10086446Ga0255813_100864461F104139INEVWEGVNPGCIPSCHSGALHAPEHPWFGPAFPPGAPSLFQAVT
Ga0255813_10086727Ga0255813_100867271F094706VGRMTKSRCGKLYIDDAGWGPEAGSIEYGYRVPFGGIHVFIGKIGEPGPEPDICTDIIETTQRARPTRVQPAMKRAFVGFIHGAESEDRSVSGGETVVYSDGESSTGETNSMYQLQDVRLGGCSDGDGIPDPYE
Ga0255813_10087901Ga0255813_100879011F001813TGGGVTEPGGVQRTFGCCVEGRGLARTIGDERMVGLDDPVGLFQP
Ga0255813_10087995Ga0255813_100879957F004001MARKVEESPSLKVSKNCVDVALRDVVSGHGRGGLLVGLDGLSCLFQP
Ga0255813_10088226Ga0255813_100882265F038012MIIEFQPPCYVQGHQPPDQAAQSHIQPGLECLQGWGIHNLLGQPVPVRH
Ga0255813_10090090Ga0255813_100900901F076912LEKSTPLCDGEGSNADKVQDSETSLLVSKKADKNYIEDTETTPKSCLDVVFELLATTAGTSSSNSLPESVRLLESQLQVERHRSDVMRQEAEGLRKSLQNSDAYFLVQQQALEDLSAKQEKVNELAKHLASIMGTQDIVS
Ga0255813_10090437Ga0255813_100904372F001813QGTFGRCVEGCGLVRAVGDGGMVGWGDPVGLFQPW
Ga0255813_10091165Ga0255813_100911651F093243MLLPYIPAEDQDAYILTKELTRIEFKYHRGRIRVKDNPYIVEREC
Ga0255813_10093195Ga0255813_100931951F098130MPGPHPRRRPVRDDVQPTHVRDWAPPGWHWEVLPGGARRLMRNPAPGPVVDPDLVWWRSRGPVSVRRDPAPSEVVRRRVREEDEHVHRYMVVLEGGRFSNTWQFLKGSHFSYDPVRVPSLWVSTARTA
Ga0255813_10093610Ga0255813_100936101F014346MLEKTLESSLGSKEIQPVHPKGNQSQIFIGQTDAEAETPILW
Ga0255813_10093721Ga0255813_100937215F005658MAWVEKAHNAHPVPTPCYVQGRQPAAQAAQSHIQPGLECLQGWG
Ga0255813_10094158Ga0255813_100941581F068298QALEWAAQRGGGVTEPGGVQRAFGCCVEGHGLARTIGDG
Ga0255813_10101931Ga0255813_101019311F011632KDRQAVGWAAQRGGGVTDPGGVQGAFRCYVEGHGLMRTNGDGWMVGLGDPVGLFQPW
Ga0255813_10102150Ga0255813_101021501F011632KGGQALEWAAQRGGGVTEPGGVQRAFGCCVEGHGLVRTIGDGWMVGLDDPVGLFQPW
Ga0255813_10104818Ga0255813_101048183F004001VSPSLQVFKERVDVALRDMVSGHGGDGLKVGLDDPSGLSQP
Ga0255813_10107736Ga0255813_101077362F033854MAAEKQSDQMLSDMEVCMKQRWIAEFFHAEIMASIHIHXHLLNVYGDQTVDESTV
Ga0255813_10110177Ga0255813_101101772F038985GPQNDFGSSGPKKLRKLVSCAETEKLKETMVGVQME
Ga0255813_10111409Ga0255813_1011140925F004001VGSASLEVFRKCRDVALRDVASGHGGDGLLVGIVDLCGLYQL
Ga0255813_10112844Ga0255813_101128441F004815LDVALGSLGCWLATLHTAGGWNWMSIAVLCNPGHSMVL
Ga0255813_10113631Ga0255813_1011363118F004815MRKNEFCPVLEAFKARLDVALGSLVGGLGTLHIAGGWNWMIFEVLFNPGHSAML
Ga0255813_10115512Ga0255813_101155123F035108VKKPTNNVMSVGMLTGRPVEEMPGSAGDLLSELSHLHEQVRQVMQGVAQALWPSASLPEGIVELTEKLKGARRHFRLWKILACHQGAMEAWAMVKTRYTKTGPNHMAEVGPVGPNGKEIPVS
Ga0255813_10116199Ga0255813_101161991F004001LEVFKSRVDVALRDVSHGHGEGGLMVGVGDLSGLFHP
Ga0255813_10121060Ga0255813_101210601F011735VLQNGAYEIIDYEGQPLEQPRNGLYLKKYYAXVIHVXF
Ga0255813_10122096Ga0255813_101220961F020828VFWSQYAEAGHPVPLSDQLKQLVELHKVAEQAMKGLIGRLWPGEVLPESYFGLVRRLVDACPWLEVIKRSVCIEGARRALACAKVHWGKLDAEKLVTNGPPEGKEHRMPEMYYKGVLKGSRLVANECFKDLIFE
Ga0255813_10123843Ga0255813_101238438F004001VVDSLSLEVLQNHGDVALRDVDSGHGGGGLLVGLGGLSGLFQM
Ga0255813_10124788Ga0255813_101247881F001813GGGVTEPGGVQRAFGCCVEGHGLARTIGEGRMVGLGDPVGLFQP
Ga0255813_10129218Ga0255813_101292181F035108MLTGRPAEEMPGSAGDLLPELSQLHEQVRQVMQGIAQALWPSASPPGGMGELIEKLKGARRRFRLWKISACRQGAREAWAMVKTRYTKAEPNHMAEVGPVGPDGKEIPVSLVYDQVELAAKYSQQDCKLDSLLDGIEEEFSQSK
Ga0255813_10129821Ga0255813_101298211F004815LQAFKARLDVALGNLGCWLVTLHIAGGWNWMSTVLLFNPGHSVIL
Ga0255813_10130025Ga0255813_101300251F035108MSVGVLTGRPAEEMPGSTGDQLPELVQLFERVRRYMSGVVQALWPSVSLPEGLGELAEKLQGARRRLRLWKISACRQGAREAWAMVKTRYPKADPNHMAEVGPAGPDGKEIPVSLMYGQVELAAKYSQQDCKLDSLLDGIEEEYNQSV
Ga0255813_10132021Ga0255813_101320211F053764MVNTEIRLILFFAAKDGEAQYSQKKQDQELTVAQILNSLLQNSDLN
Ga0255813_10134347Ga0255813_101343473F004001LSMEMFKNHGDVTLRDMVSGHGGDELVFGLGDVSVFFQP
Ga0255813_10136109Ga0255813_101361091F028669MYTRCEIKKQQFKCWSDQFITNVNKGGEERGRRTLLLLGVMGKGRTRIEKIESRSKGVFTGTN
Ga0255813_10142033Ga0255813_101420331F004815ARLDVALGSLGCWLATLHIAGGWNWMVIVVLFNAGRSVIL
Ga0255813_10142082Ga0255813_101420821F011632WAAEGGGGVTEPGGVERAFGCCVEGHGLARTIDDGRMVGLDDPGGLSESMIL
Ga0255813_10146225Ga0255813_101462254F011632GQALEWAAQRGDGVIDPGGVQRAFGCCVEGHGLARTIGEGRMVGLDDPVGLFQP
Ga0255813_10147032Ga0255813_101470321F038012MFIQFQPSCYVQGRQPADQAAQSHIQPGLECLQGWGIHSLLGQP
Ga0255813_10148278Ga0255813_101482781F005658MAWVEKDHNGHLVSTPCYVQGHQPADQAAQSHNQPGLECLQGRGVHNLLGQPIP
Ga0255813_10150215Ga0255813_101502151F028669MYARHEIKKQRFKCWSDQFITNVNKGDEERGGRTLLRIGVMGKGRQVIEKVERSKNCVKR
Ga0255813_10150913Ga0255813_101509131F001813GVTEPGGVQRAFGCCVEGHGLVRTIGDGQMVGLDDPVGLFQP
Ga0255813_10153286Ga0255813_101532861F001813ALCFLGVQRAFGCCVEGHGLARTTGDGWIVGLDDPVGLFQT
Ga0255813_10153878Ga0255813_101538783F011632QALEWAAQRGGGVTNPGGVQRMFGCCAEGHGLARTIGDGWMVGLDDPMGLFQP
Ga0255813_10156535Ga0255813_101565352F001813GGGVTDTGGVQGLFGHCVEGHGLVRTIGDGGVVGLGDPVGLFQPW
Ga0255813_10160284Ga0255813_101602841F004815LQAFKARLDVALGSLGCWLATLHIAGGWNWMSTVLLCNPGHSRIL
Ga0255813_10162849Ga0255813_101628495F011632WAAQGGGGVTEPGGVQGMFGCCVEGHGLVRTIGDGWMVGLGDPFPTLVIL
Ga0255813_10165169Ga0255813_101651691F068298WAAQAGDGVTHHGGVQRAFGCCVEGHGLVRTIGDG
Ga0255813_10165917Ga0255813_101659172F011632WAAQRGGGVTDPGGVQRAFECCVKGHGLAGTIGEGRMVGLDDPVGLFQP
Ga0255813_10166730Ga0255813_101667306F001813EPGGVQRAFGCCVEGHGLAGTIGEGRMVGLDDPVGLFQP
Ga0255813_10170804Ga0255813_101708041F035626MASSIINNDAVQGETFLPGQIFVFGGFALWANSLGHLEQIGSYAPGHQVRFGSLKYTTDIRGDLIFDGFEPRPSMPHCHDGHDLALLPDSALDSEKESTP
Ga0255813_10175213Ga0255813_101752131F004001VVESLSLEAFKKCADVVLGDVVSGHGEDVLSVGLDDLSGLF
Ga0255813_10176662Ga0255813_101766621F051243PLFRDVIQRTGEGNGTRLQYSCLENPMNGGAWKAAVHGVAEGRTRLSDFTFTFHALEKEMATHFSVLAWRIPGTAEPGGLPSMGSHRVRHD
Ga0255813_10176818Ga0255813_101768181F075851MARVRSTARVEREGDEAEGAETVPISEAMKRSGLMTSEDIPAAEAEQADIEEAGTDDDYNIVVPSKPSHLEFGKSTISKADFPKMVKSGYFSEDEKKMVRFGGEEITP
Ga0255813_10181756Ga0255813_101817561F004815PSLEAFKARLDVALGSLGWWLVTLRKAGGWNQMVIVVL
Ga0255813_10182634Ga0255813_101826342F006329MELELHVTDVVDDHKIKMEKMRLKIRKIRKYAIDSVAWYHYAVGSIVTLVAIFIAFVVAFKFFI
Ga0255813_10186063Ga0255813_101860636F033854MAAVGQSDKVMSDTGVWMKQRWVTEFLHAEKMAPTDIHXLLLNAYGDQRVDV
Ga0255813_10186715Ga0255813_101867151F038012MTIQFQPPCYVQGRQPPDQAAQSHIQPGLECLQGWGIHSLFRQPVPLE
Ga0255813_10189359Ga0255813_101893591F038489MAWVERDHSNHPVSTPCYVQGRQPLDQAAQRHIQPGIEC
Ga0255813_10190856Ga0255813_101908564F038489MAWVEKDHNDHLISTPCYVQGRQPPDQAAQSHIQPGLEC
Ga0255813_10191410Ga0255813_101914103F001813RGGGVTEPGGVQRAFGCCVEGHGLVRTIGEGRMVGLDDPVGLFQP
Ga0255813_10191961Ga0255813_101919611F011632RGGGVTEPGGVQRAFGCCVEGHGLARTIDEGRMVGLDDPVSLFQP
Ga0255813_10193041Ga0255813_101930411F005658MAWVEKAHSAHPVPTPCYVQGRQPAAQAAQSHIQPGLEC
Ga0255813_10196354Ga0255813_101963541F001445LHFHALDKEMAAHSSVLSWRIPGTGEPGGLQPMGLHRVGHD
Ga0255813_10197424Ga0255813_101974241F011632RGGGVTDPGGVQRAFGCCVEGHGLARTIGEGRMVGLDDPVGLFQP
Ga0255813_10197794Ga0255813_101977943F005658MAWGEKDHSAHPVPTPCYVQGRQPPDQAAQSHIQP
Ga0255813_10199962Ga0255813_101999621F093003GDEKSIVPEDPVKQERFKRRLMATANSLKKNQQQLQADQDLLADRWTEVLVAEEHELERPSKSYPKRRLLPHLEEEALKPHSLVYDASDRPLRGRAREAFQPKDQTAPVRHSVKNTMARGNTEDLRDILDSKAKIARSIYGTRRRAPTRDDDRRVGYTKSTSGRAVCSKKHSYELGQDIARHRGAAHPLCFTDEVMNHEFPKGFKPVNIESYDGTT
Ga0255813_10201884Ga0255813_102018841F005658MAWVEKDHNAHLVSTPCYVQGHQPADQAAQSHVQPGLECLQGWGIHNLLGQPKIMYNI
Ga0255813_10202050Ga0255813_102020501F005658MAWVEKDHNAYPVPTPCYVQGRQPAAQAAQSHIQPGLECLQGW
Ga0255813_10204215Ga0255813_102042151F020637MDGGAWWAAVHGVAKSQTRLSDFPFTFHFHELEKEMATHSSVLAWRIPGTGSLEWVAIS
Ga0255813_10205671Ga0255813_102056711F020828GSSTEKMFWSQYTGTEHPMPLSDQLKQLVELHKAAGQAMKGFIVRMWPGDSLPNSYFGLVRWLVDACPRLEVIKRSVCIEGARWAFARVKVQWAKLDAMKLIKEGPPQGKEHRTPEIYYEGVLKGAHLVADECSKDVIFE
Ga0255813_10206980Ga0255813_102069801F004001MVELRSLEVWKNHVDVALRDVVSGHGGNGLEVGLDDLWIFS
Ga0255813_10216916Ga0255813_102169161F028669MYARCEIKKQQFKCWSDQFITNVNKGDEERGGRTLLRIGVMGKGRRAIEKIERGKNCVKR
Ga0255813_10221069Ga0255813_102210691F038012MIIEFQPPCCGQGHQPADQAAQSHIQPGLERLQGWGIHSLLGQPVPVRHH
Ga0255813_10222912Ga0255813_102229121F001813GGGVTEPGGVQGTFGRCVEGHGLARSIGDGWMVGLSDPVGLFQP
Ga0255813_10223457Ga0255813_102234575F001813AQGGGGVTEPGGVQRAFGCCVERHGLARIIGDGRMVGLDDPVGLFQP
Ga0255813_10225213Ga0255813_102252131F004815LDVALGSLVCWLATLHTAGGWNWVITVVLFNPGHSTVL
Ga0255813_10227022Ga0255813_102270221F011632EWSALGSGGVTEPGGVEGTFGCCVEGHGLVRTIGEGRMVGLGDPVGLFQP
Ga0255813_10228426Ga0255813_102284262F007510MDGAWKTEVHGVVKSQTRLSDFTFTFHFHALEKEMATHSSVLAWRIPGTGEPGGLPSMGSHRVRHD
Ga0255813_10233597Ga0255813_102335972F038012MIILFQPPTNVQRHQTADQAAQSHIQPGLECLQGWGIHDLRGQPVVVM
Ga0255813_10236528Ga0255813_1023652811F004001VVESLSLKVFKNHGDVALRDMVSGHGGVGLMAGLDAVSGLFQP
Ga0255813_10236821Ga0255813_102368211F096316MAWVEKDHNDHRFSTPCYVQGHHPPDQAAQSHLQPGPECLQGWGIHSLLGQPVQ
Ga0255813_10237932Ga0255813_102379321F096316MAWAEKDHNDNLIPTPRYVQGRQPAAQAAQSHIQPGLECLQGWGIHSLLGQPVQCVTTLWGKN
Ga0255813_10238462Ga0255813_102384621F005658MAWVEKDHNAHLVSTPCYVQGRQPADQAAQSHIQPGLECLQGWGIHSL
Ga0255813_10238875Ga0255813_102388752F062313MTEDEMAGWHHRVDGHEFEWTLGVGDGQGGLECCYSWGHKEADMTE
Ga0255813_10241660Ga0255813_102416601F059631LNISVFIVVCEAFLRVRPHFGLWPKTFNVKPKVVRGSQAECGGVMAGKMANVLWLEGSFVESLKGWQSGWFYITELRDPEWLAAPKFRYGPPMRLTSWKETGLSWGKKGELTGLQTCVQTLVNKKLRFVNMVQVMLVRRILPCQQRAFNLWEFDPAQHQTLSRLFDTIYEEAWRVLFKGAEAPASATEDRGFSSQRQAGEVSYF
Ga0255813_10241856Ga0255813_102418563F014346VVLKETLESPLDCKEIQLVHPKGDQSWVFIGRTDVEAETPI
Ga0255813_10242614Ga0255813_102426141F001813TNSPDPGGVQRAFGCCVEGHGLAGTIGEGRMVGLDDPVGLFQP
Ga0255813_10242929Ga0255813_102429291F001813DPGGVQGTFGRCIEGHGLVRAIGHGWMVGLGDPVGLFQTW
Ga0255813_10247748Ga0255813_102477481F011632MSLNLNLCNYGGGVTEPDGAQRAFGCCVEGHGLARSIGEGRMVGLDDPVGLFQP
Ga0255813_10249699Ga0255813_102496991F038012MIIEFQPPYYVLGHQSLGQAAQSHIQPGLECLQGWGAHSLLGQPVSVRQHPLGEK
Ga0255813_10249948Ga0255813_102499485F038012MTIEFQPPCYVQGHQPPDQAAQSHIQPGLECLQGW
Ga0255813_10251582Ga0255813_102515824F001813GVTEPGGVQRAFGCCVEGHGLARTIGEGRMVGLDDPVGLFEPW
Ga0255813_10252785Ga0255813_1025278514F038012MIIEFQPPCYVQGHQPPDQAAQSHIQPGLECLQGWGIH
Ga0255813_10254745Ga0255813_102547453F004001VGSPSRELFKKCVGVVLRDMVSRHGGDGLMVELGDLR
Ga0255813_10255692Ga0255813_102556921F001445METHSSVLAWRIPGTGEPGGLPSMGSHRVSHDRSDLAAAV
Ga0255813_10259412Ga0255813_102594123F001813VEWAPQEGGEVTDPGGVQGTFGHCVEGCDLVRTTGDGWMVGLGDPVGLFQPW
Ga0255813_10260665Ga0255813_102606651F007510MDGGAWKAAVHGIAEGRTRLSDFTLTFHFHALEKEMATHSSVLAWRIPGTGEPGELLSLELPRVGHD
Ga0255813_10263346Ga0255813_102633462F083289LECEEGDAAYAESVCATEELKFYKDKVDPEDMTSLKKPTTEHDPALKFKSADDTKMVDFVPGDSSKQFII
Ga0255813_10269540Ga0255813_102695402F005658MAWVEKDLKDHLVSTPYYMQGHQPLDQAAQSHIQPGLECLQGWGIHNLLG
Ga0255813_10270767Ga0255813_102707672F001813GVTDPGGVQRAFGCCVEGHGLVRTIDEGRMVRLDNPVGLFQP
Ga0255813_10271847Ga0255813_102718471F004815PKEAVDVPSLEAFKARLDVALGSPRLVTLHTAGGWNWMSTVVLFNPGHSMIL
Ga0255813_10271922Ga0255813_102719227F004001FLREVMESPSLEVFKNCVVVALRDMGKGHGGDGLMLGLHDLSGLFQS
Ga0255813_10272517Ga0255813_102725179F038489MAWVEKDHNAHPVSTPCYVQGCQPPDQAAQSHIQPEYKGPV
Ga0255813_10275387Ga0255813_102753871F033754RSGRQADVRTPSWTESPTDQEVAEAGALLTEVGLLKERGLTAEAVVTDFVFKNIQPLKDRAYPAYLYRGLADPTRVTNRRIPSVDLVSRLEMILRGKVSNVGAPVAYSAWNLPSPKDFTLFVSNPPVTDSNLGLRVRPSAEDVRSLVASLGEIPDDERQIYFEVPLNPSDADINDMLDLLAEDSSDAAPDGTLAVVPLPEVDATLDVPKPVSTRPR
Ga0255813_10276494Ga0255813_102764943F005658MFDFRMAWVAKEHNAHPVPTPCYVQGRQPAAQAAQSHIQPGLECLQGWGI
Ga0255813_10286714Ga0255813_102867141F001813GGVTDPGGVQGTFGCCVEGHGLAGTIGEGRMFGLDDPVGLFQP
Ga0255813_10292156Ga0255813_102921561F001813WWCSKRVGCCVEGHGLARTIGEGRMVGLDDPVGLFQP
Ga0255813_10292769Ga0255813_102927691F001813GGVQRAFGCCVEGHGLVRTIGDGRMVRWDDPVGLFQP
Ga0255813_10292847Ga0255813_102928471F011632WAAQGGGGVTEPGGVQGMFGCCVEGHGLVRTIGNGXMVGLGDPVGLFQP
Ga0255813_10293799Ga0255813_102937991F033854MAAEGQSDTVASDMEVQIKERCGIAFLHAENMTPIDIHXRLLNVSGVQSVNVST
Ga0255813_10297209Ga0255813_102972091F004815LQAFKARLDVALGSLGCWLATLHIAGGWNWMSIVVLFNPGHSMIL
Ga0255813_10298028Ga0255813_102980281F005658MAWVEKDHNAHPVPTPCYVQGRQPAAQAAQSHIQPGLECLQGWGIHS
Ga0255813_10298870Ga0255813_102988701F034384RLESRVTIVVDYLARLKVATSRIDTALWPGETLQNDLESVMTRLNEVPSRLQEWKKSSARCGADVALSLVRVHCKDAREDKLASLKVANTKKHDFRSFMETFIAAATRIADGIDLDEFVAPSSPPPEE
Ga0255813_10300024Ga0255813_103000241F038012MAWVEKDHTIIKFQPPCYVQGRQPLDQAAQRHIQPGLECTQXQGIHNLLRQPVP
Ga0255813_10304456Ga0255813_103044562F028669VHTWCEIKKQRFKCWSDQLITNVNKGDEERGGRTLLWIGVMGKGRQAIEKIGNRSKGVFIGIN
Ga0255813_10306103Ga0255813_103061031F005658MACVEKDHNAHLIPTPCCVQGQPPAQAAQSHIQPGLECLQGWDILS
Ga0255813_10307824Ga0255813_103078241F093003LAAEEHKLERPSKSYPKHRLLLRLEKEALDAAERPPRGRDREASRLSTQAAPRTKAREYAPDLRDMLEDKARKTRSIYGSRGHPTARDGNRHASHKFGRAEHSRQGSLELRHDIAQYRGAAHPICFTDEIMDHQIPEGFKPVNIESYDGTTDPAVWIEDYLLHIHMARGDNL
Ga0255813_10308065Ga0255813_103080651F004001VESLSLEVFKNCRDVALRDVVRGQGGDGWGLDLDGLSGLFQPKQCYDSI
Ga0255813_10308550Ga0255813_103085501F002994NMQQKQKLNELISAIQDKDQLLDTQEDFLIKENKKHVKVKNAYALEVEKCEKLSSELSTCHETIDNLRNENANLLAKVDSNACDVSIPNPRNDNVDLLAKIEELNISLASLRDENEKLLAKAKDFDVCNATISDLRSKNDILHAKVVELKSC
Ga0255813_10317494Ga0255813_103174941F096316MAWVEKDHSDHPLPTPCYVRGRQPAAQAAQSHIQPGLECLQGWGTHSLLGQPVQCVTTLWGKNF
Ga0255813_10323241Ga0255813_103232412F068986MAAMKVMLPILLWWPTVSVADVGGMAVEVEPSHQCSVTFCCHARDGSREAVS
Ga0255813_10324001Ga0255813_103240013F028669MYARHEIKKQRFKCWSDQFITNVNKGDEERGGRTLLQIGVMGKGRRAIEKIERSKNCVKR
Ga0255813_10325750Ga0255813_103257501F076748MRFIKLPGDSPPLYVSKSSFSQSDSSWFDWNDEEAVLFPNLKAGIT
Ga0255813_10325750Ga0255813_103257502F076748MRFIQLPGDSPPLYVSKSSFLKSDTSWFDWKDEEAVSFPNWETGIT
Ga0255813_10326456Ga0255813_103264562F005658HRMVWVEKDHNDHRVSTPCNVQGHQPPDQAAQSHIQPGLECLQGWGIHNLSLEK
Ga0255813_10327719Ga0255813_103277191F038084VVSYSHLFQNFPQFVAIHTGKGFGIVNKAKVDVFQELSCFGDDPADVGNLISGSSAFSKTSLNIWKFIVHILLKPGLENFEHYLTSV
Ga0255813_10330760Ga0255813_103307602F001813MEEMHWNGLPRGGGVTDPGGVQGTFGRCVEGHGLVRTTGDGCMVGLGDPVGLFQPW
Ga0255813_10332203Ga0255813_103322036F001813GVTEPGGVQRAFGCCVEGHGLARTIGDGRMVGLDDPVGLFQP
Ga0255813_10336663Ga0255813_103366634F004001MEVFKNSGDVAPRNMVSGHGGDGLMVDLDDLHGLFQP
Ga0255813_10336674Ga0255813_103366741F093003MPLSEDEVSLGDEEFIVPEDPVEQERFKRRLIATANSLKKKQQQLRADQDLLTGRWTEVLAAEEYGLERPTKIYPKRRLLPQLEEEALKPTLPAHDVADRPPRGRDKAAYQPEVQPAPRRQSNKNTKARGNTQDLRDVLENKAKHARSIYGSRGRASTREDDRHAGYTKSKSVRAEYSRQDSYELRRDIARHRGAAHPLCFTDEVMDHEFPEGFKPVNFESYDGTTDPAVRIEDFLLHIHMAC
Ga0255813_10337802Ga0255813_103378021F020637MDGGAWKAAVHGVAKSQTRLSDFTFTFHFHALEKEMATHSSALAWRIPGTR
Ga0255813_10338849Ga0255813_103388492F033854MAAEGQSDKLASDMEVCVKQRHTTEFLNAEKITPIDFHGHLLNIYGDQRE
Ga0255813_10343354Ga0255813_1034335414F011632QKSGQALEWAAQRGGGVTSPGSVQGTFGRCVEGHGLVGSIADRRTVGLDDLVQPW
Ga0255813_10346850Ga0255813_103468504F001813VQGTFGCCVEEHGLVRTIDDGQMVGLDDPVGLFQP
Ga0255813_10348633Ga0255813_103486331F001813VQGTFGHCVEGHDLVRTIGDGWMVGLGDPVGLFQPW
Ga0255813_10350207Ga0255813_103502071F002002MEEMQETGVQFLGWEDPLEEEMATGSSILVWEISWTEEAGELQSMESQELGVTEHA
Ga0255813_10352076Ga0255813_103520762F005658MAWVEKEHNAHPVPTPCYVQGRQPADQAAQSHIQPGLECLQG
Ga0255813_10352551Ga0255813_103525512F028669MYAWHEIKKQWFKCWSDQFITNVNKEDEERGGQTLLRIGVMGKGRREIEKIE
Ga0255813_10353603Ga0255813_103536032F034384MNVLRLESRVAGVVDYLARLKVAMSRIDTSLWPRTTLQNDLESLMTRLNEVPGRVAEWKKSSARCGADVALSLVRVHCKEAREEKLAAIQVANTRKHNFQDFMETFIAAATRIADGIDLDEFVAPSSPPPEE
Ga0255813_10353696Ga0255813_103536961F005658MAWVEKDHNDHPVPTPCYVQGRQPADQAAQSHIQPGLECLQGW
Ga0255813_10356957Ga0255813_103569571F038012MIIRFQPPCYVQGRQPPDQAAQSHIQPGLECLQGWG
Ga0255813_10361260Ga0255813_103612601F034384VETGLDPINSPVKDEAVMNVLRLESRIAAVVDYLARLKAATSRIDTSLWPEETLQNDLESLMTRLNEFPSRVQEWKKSSARCGADVALSLVRVHYKEAREDKLVSLKVANTRKHDFRSFMETFIAAATRIADGIDLDEFVAPSSPPQEG
Ga0255813_10369192Ga0255813_103691922F004815PSLQAFKARLDVALGSLGCWLATLHIAGGWNWMSIVVLFNPGHSVIL
Ga0255813_10369364Ga0255813_103693645F096316MAWVEKDHNAHPVPTPCYVQGHQPADQAAQSHIQPGLECLQGWGIHSLLGQPVPVRHHPL
Ga0255813_10374461Ga0255813_103744615F004815LPKEAVDAPSLEACKARLDVALGSQVCWLVTLHIAAGWNWMSIVVLFNPCHSTIL
Ga0255813_10376990Ga0255813_103769907F004815LNRLPKEAVDAPSLEACKARLDVALGSLVWWLVTLRIAGGWNQMVIVVLFNPGHSMIP
Ga0255813_10383602Ga0255813_103836022F001813GVTNPGAIQGTFGRCVEGRGLVRTVGEGWMVGLGDPVGLFQPL
Ga0255813_10383765Ga0255813_103837651F002471VDINACSEHLVSISKLNDELASLNAQLKTSKSEFKKLKFARDAYTIGRHPSIKDGLGFKREVKNLTSHKTPISTKEKGKAPMANSVKKNHAFMYYDRRYSRNAFRGHDVFDSHAYDSYAMTASSSHVMHGRNVFRRNVVHQIPRRNVVHNASRKVVNEPSEIYCALNASFAICRKDKKIVARKLGAKCKGDKTCIWVPKDICTNL
Ga0255813_10383776Ga0255813_103837764F033854MAAEGHSDTVASDMEMCMKQRCVIEFFHVEKVAPIDIHXCLLDIYGDQTVDVSTVGQ
Ga0255813_10385668Ga0255813_103856683F068298WAAQRGGGVTDPGGVQGMFGCCVEGHDLVRTIGDG
Ga0255813_10386943Ga0255813_103869431F005658MAWVEKDHNAHPVPTPCYVQGRQPAAQAAQSHIQPGLECLQGWG
Ga0255813_10386943Ga0255813_103869433F005658MEWVEKDHSAHPVPTPCYVQGRQPAAQAAQSHIQPGLECL
Ga0255813_10389833Ga0255813_103898333F005658MAWVEKDHNDHLVPTPCYVQGHQPADQAAQSHIQPGLECL
Ga0255813_10393373Ga0255813_103933737F004001SLEVFESRVDVALRDVGSGHGGGGLVVGPDDLRGLFQPQ
Ga0255813_10395572Ga0255813_103955724F001813PRGKAKEWSAQGGGGVTNPGGVQGTFGRCVEGHGLVRTIGDGWMVGLGDPVGLFQPW
Ga0255813_10398663Ga0255813_103986634F001813VTEPGGVQRAFGCCVEGHGLTRTIGEGQMVGLDDPVGLFQP
Ga0255813_10398678Ga0255813_103986781F011632AAQRGGGVTDPGGVQGTFGCCVEGHGLTRTIGEGQMVGLDDPVGLSQS
Ga0255813_10399113Ga0255813_103991132F004001SLEVFQSRVDVALRDVVSGHGGDGLEVGLGDLKALFQP
Ga0255813_10400324Ga0255813_104003241F033854MAAEGQSDKMASDMKVFKKQRCDISFLHVEKMAPTDIHRHLLNIYGEQTMDVN
Ga0255813_10402709Ga0255813_104027091F005658MAWVEKAHSAHPVPTPCYVQGRQPAAQAAQSHIQPGLECLQGWGIHS
Ga0255813_10403940Ga0255813_104039401F001813GVQGTFGHCVEGHGLLRTIGDGWMVGLRDLVGLSQPWXFCDFPCGE
Ga0255813_10405454Ga0255813_104054543F033854MAPNMEVSMKQRCVTEFLQVEKMAPSDIRSSLLNVYGDQTVDVSTVMR
Ga0255813_10405699Ga0255813_104056991F002471KTSKNDFDKLKFARDAYTIGRHPSIKDGLGFKREAKNLTSHKAPIPAKEKGKAPMATSAKRNHAFLYHDRRQTRNVSHDAFDSYVYDSHAMFAPSSSYVYDRNVTRRNVVPKRNAIHHVPRRNVIHAPRKIANEPSTIYCALNASFAICRKDRKVIARKLGAKCKGDKTCIWVPKEIVTNLVGPNKSWVPKSQA
Ga0255813_10409555Ga0255813_104095551F010678PTKVKSLETEEEKMTEPILVEEVSAVAPEASPKVLDYIVRHASGKKLSEEEIFEADHYAKELKYPKGALVFNGTNEEDFLYCLPDNKELSVCREMARSMGFPKLEAGLCAMTKDDLADSLAYNSLKVWELDVCKFYNL
Ga0255813_10412076Ga0255813_104120762F096316MAGVEKDHNAHLVSTPCYVQGHHPPDQAAQSHIQPGLECLQGWGIHSLLGMRCRTALDN
Ga0255813_10414600Ga0255813_104146001F034384RNLRRLESRIDGGVDYLARLKVAMAWIDPTLWPEATLQNDLESLMTRLNEIPDRVQEWKKSSARCGADVALSLVRVHCKEVRQDKLASIKVANTSRHDFRSFMETFIAAATRIADGVDLDEFVEPASPPPAE
Ga0255813_10417234Ga0255813_104172348F011632LEWAAQRGGGVTEPGGVQRAFGCCVEGHGLARTIGDGRMVGRDDPVGLFQP
Ga0255813_10419565Ga0255813_104195651F038489MAWVEKDHDAHPVSTPCYVQGCQPADQAAQSHIQPGLECLQ
Ga0255813_10421535Ga0255813_104215351F005658MAWVEKAHSAHXVPTPCYVQGHQPPDQAAQSHIQPGLECLQGWGIHSL
Ga0255813_10423245Ga0255813_104232456F004001VVESPSLEVFKSRVDVALRDVGSGHSGGGLRFGLGDLSGLFQTFFFL
Ga0255813_10428357Ga0255813_104283571F001813PGGVQGMFGRCVEGHGLVRTIGDGWMVGLGDPVGLFQPW
Ga0255813_10428731Ga0255813_104287312F001813PGGVQGTFGCCVEGHGLVRTIGEGQMVGLDDPAGLFQPW
Ga0255813_10429898Ga0255813_104298981F001813PGGVQGTFGHCVEGHGLVRTTGDGWMVGLRDLVGIFQPW
Ga0255813_10431073Ga0255813_104310731F076912LGKSALLSNGKGSNADKVQDSDTSLLVSNKADKTAKEDYLEDSETTPKSCLGLVFELLATTACTSYSNSLSESVRFLESQLQAERHRSAVLRQEAEGLRKSLEHSDAYFLVQQQALEDLSAKQEKVNKLAKHLASIMGTQDIVS
Ga0255813_10432846Ga0255813_104328463F004815LQAFKARLDVALGSLGCWLATLHIAGGWNWMSTVVLFNPGHSIIL
Ga0255813_10435536Ga0255813_104355366F005658MAWVEKDHNDHPVPTPCYVQGRQPADQAAQSHIQPGVECLQ
Ga0255813_10437351Ga0255813_1043735117F004001SLEVFKNCVAVALRDVVSGHGGDGLVVGLGHLSSLF
Ga0255813_10439344Ga0255813_104393443F004001WNRLLRELRESPSLEVFKNSEDVALRDMASGHSGDGLVVEFNDLRGLFQT
Ga0255813_10439932Ga0255813_104399325F004001SLEVFKKRRDVALRKVVSRHGGDGLMVELDYLNRLLQS
Ga0255813_10439945Ga0255813_104399452F038012MIIEFQPPCYVQGRQPPDQAAQSHIQPGLECLQGWDI
Ga0255813_10443450Ga0255813_104434503F001813VQRTFGHCVEGHGLMRPIGDGWMVGLDDPVGLFQPL
Ga0255813_10446180Ga0255813_104461802F014346VVLEKTLESPLDCKEIQPVHFEGDQPWDFFGRNDAKAETPVLWPPHA
Ga0255813_10448422Ga0255813_104484221F096316MAWVEKDHNEHLVSTPCYVQGRQPAAQAAQSHIQPGLECLQGWGIHSLLGQPVQCITTLC
Ga0255813_10453162Ga0255813_104531621F068986MPPTLLNCPATSEADVGGMAVEVEPSHQYPVTFCCCVIDGSRG
Ga0255813_10453472Ga0255813_104534722F001813EWAAQGGGGVTDPGGVQGTFGHCVEGHGLVRTIGDGWMVGLGDPVGLFQPW
Ga0255813_10454738Ga0255813_104547381F005658MAWVEKDHNDHVVSTPCYVQGHQPPDQAAQSHIQPGLEFPQGRGIHNLLGEPVP
Ga0255813_10455457Ga0255813_104554572F096850MEEVKKPTKEKTSEVLSPAANVETVKNQKVPAVTPKRKRMANVLDVLETIKSSSTPPKKAAVTPETTAETSGSKIPEQGAEAEAGPSEPAKGKPLESEAEKITKPTFEETGVVTPEASPKIRDYIFRHASGKKLSEKEEQEAQHYAQKLKYPKGALIFNGSGEEDFLYCLPDSKEISVCREMSKSFGFPTLEDGLSVLSKNDLADSLAYNSLKVRQMKFLYFS
Ga0255813_10461212Ga0255813_104612123F104139SLFHCQPLNEVWKGVEPGSTPDSHSGTLHAPELPWVGAAFPPGAQSLLQALT
Ga0255813_10461796Ga0255813_104617962F001813QRTFGCYVEGHGLVGTIGEGRMVGLGDPVCLFQPW
Ga0255813_10463562Ga0255813_104635621F032472GQIFVFGGFVPRANSLGHLEQIDSYAPGHQVRFGSLNFMADIRGGLIFDGFEPQPSVPHCLDGHDIALPPNSALEAAHASVPTIDSEPTAPIEDQRLDAASGAAISEAIEPNSSPALRMARDSEEPDSSPNSEPPAPLPIESDWAPAMEFTTADIFQHSPFWRDPEFF
Ga0255813_10463731Ga0255813_104637312F020828VSDAAQFYQAEDGSSTEKLFWSQYAEAEHPVPMSDQLKQMVELHKAADQAMKGFIVRLWPGDALPNNFFGLVRRLVDACPRLEVVKRSVCIEGAHRAFARVKMQWVKLDAVKLIKEGPPEGKDHRHPEMYYEGVLPGARLIADEC
Ga0255813_10472226Ga0255813_104722261F011632EILLLXKGGQALEWAAQRGGGVTEPGGVQRAFGCCVEGHGLARTIGDGQMVGLDDPVGLFQP
Ga0255813_10472470Ga0255813_104724701F079404KASEEWPLEWFYIEDVPLPDPVRIGLPEFDNVPLKKHLSWRPRSPQKENDKDVLYLMNRIMLLAHSGLTMIEVMATCITRGVQLLQYRGHPMWDFNGEDDATRCGRKGSDSAATLTKILSALYKGEEEEFLRVNPQVGFSMYDPPSWVSEQLRLPVCFILPWLDR
Ga0255813_10473033Ga0255813_1047303313F038012MIIEFQPPCYVQGHQPPDQAAQNYIQPGLECLQGWGIHSLLGQPVPVR
Ga0255813_10473679Ga0255813_104736791F053764GHHQMVNTEIRLIIFIAAKDGEALYSQQQDWELTVAQIMNSCMV
Ga0255813_10477858Ga0255813_104778582F020492MGLQAVLLTSAALTAEVKTLKENLERSENKRGHVKKQLEEK
Ga0255813_10480009Ga0255813_104800091F007510MDRRAWWAAVHEVAKSQTRLSDFTFTFNFHAMEKAMTTHSSTLDWKIPWTEGPGRLQSMGLLGVEHN
Ga0255813_10480487Ga0255813_104804871F096316MAWVEKDHSAHLVPTPCYVQGRQPADQAAQSHIQPGLECLQGWGIHSLLGQPVQCV
Ga0255813_10483335Ga0255813_104833352F005658MAWIEKDHSAHPVPTPCYVQGRQPADQAVQSHIQPGLECLQG
Ga0255813_10483583Ga0255813_104835831F033854MTAGGQSDKMATDMEVCMKQIYVIEFLHVEKIARMDIHQRLLNVYGDQTEDMSTVRWDGGGAFQQW
Ga0255813_10483809Ga0255813_104838091F028669MYARHEIKKLRFKCWADQFITNVNKGDEERGGQTLLRIGVMGKGRRAIEKIERGKNCVKR
Ga0255813_10487230Ga0255813_104872302F014346VVLEKTLESPLDCMEIQPVHSKGDQSWVFFGRTDVEAETLILCPPDVK
Ga0255813_10488181Ga0255813_104881812F001813VQGAFRRCVEGHGLVRTIGEGWMVGLSDPVGLFQPW
Ga0255813_10488419Ga0255813_1048841910F004815SLEAFKTRLDVALGSLGCWLATLHIAAGWNWMSIVGLFNPGHPMML
Ga0255813_10489296Ga0255813_104892962F038012MIIEFQPPCYVQGRQPPDQAAQSHIQPGLECLQGWGIYNLPGQPAP
Ga0255813_10491886Ga0255813_104918861F004001VMVESSSLEVFKKCGDEALRDVVSGHGGEGLVIGLADLGGLF
Ga0255813_10494111Ga0255813_104941115F004001MVESLSLELFKKRLDVALKDMVSGHGGDGLTVGLDDVRALFQP
Ga0255813_10494176Ga0255813_104941761F038985MPKKRHLGPQNGSGSSRPEKLLKRVSCVETEKLKEIIVGGQVE
Ga0255813_10516806Ga0255813_105168061F038012MIIEFQPPCYVQGHQPPDQAAQSHIQPGLECLQEWG
Ga0255813_10519966Ga0255813_105199661F011632GQALEWAAQRGGGVTDPGGVQRAFGCCVEGHVLVRTIGEGRMVGLHDPVGLFQPW
Ga0255813_10521129Ga0255813_105211291F104259LGGRKGKGWRVQLYLDIGGLYLPLGVLSLPLHLEAVATFGSHYFH
Ga0255813_10521973Ga0255813_105219731F001813GVQGPLGHCVEGHGLVRTIADGWMVGLGDLVRLFQPW
Ga0255813_10523228Ga0255813_105232282F098130RPVRDDVLVQRSHVRDWAPPGWHWEVLPSRARRLVRNPAPGPVVDPDLVWWRSRGPVSVRRDPAPPEVVRRRVREEDEHVHRYMVALEGGRFSNTWQFLQGSHFSYDPVRVPSLWVSTARAAGTASVLDSSVVFDL
Ga0255813_10524030Ga0255813_105240307F004001VGESPSMEVLRNYGDVALRDVVGGHGGDGLMVGQGDLRGLFQP
Ga0255813_10524167Ga0255813_105241671F011632MIQALEWAAQRGGGVTNPGGVQGTFGRCVEGHGLMRTTGDRWMVGLSDPVGLFQPL
Ga0255813_10528068Ga0255813_105280681F001813TDSGGVQRAFGCCVEGLGLVRTIGEGRMVGLDDHVDLFQPL
Ga0255813_10528167Ga0255813_105281677F005658MAWVEKDHNAHPVPTPCYVQGHQPADQAAQSHIQPGLECLQGWG
Ga0255813_10531809Ga0255813_105318091F059631AMAGKMANAIWFEGSFVETLKGWQSGWFYITEPRDLELTAVPEFRSGPPTRLVSWKETGLSWGDEKEVTGLQTCIQSLVNKPVWLVNVIQVMLVRRILPCQQRDFNLWEFDPAQHQTLNRLFNMTYEDAWKVLFKGAEAPASASEDRGYSSQHHANKVSHLHLLQDV
Ga0255813_10538618Ga0255813_105386182F011632AQRGGGVTEPGGVQRAFGCCVEGHGLARTIGEGQMVGLDDPVGLFQP
Ga0255813_10540847Ga0255813_105408471F068298VEWAAQRGGGGTDPGDFQGMSGCCVEGHGLARTIGDE
Ga0255813_10541691Ga0255813_105416911F068298LEWAAQRGGGVTDPGGVQRAFGRCGEGRGLARTIGDG
Ga0255813_10542258Ga0255813_105422581F086390SQSVMFDIYDKSYTMDLEDFTTTCKLPLWGSVNEPSKYEYKDFLVNITVGESRDIAQVTIGSIHFPSIHYFALFIDRCINGKDEACHMCVCDLCVLKSAVLGDKEYNLGAIVARRLHNNGLVGDLFGGIYATRMANYLGIPVHENDTELPPTYLDHNAMLSHQFLERNEQFLQYRLIYDRRNIVHVTLPAPYLFDYQAKGRYVVTREEAAEH
Ga0255813_10552447Ga0255813_105524471F006329ATDPIVERLNLVEREHEYLKEKLKRIEGEKMELELHVADVVDDHKIKMEKMRLKMRKIIKYAIDSEAWYHYAVGSIVTLVAILIVFVVAFKCFS
Ga0255813_10554088Ga0255813_105540887F096316MAWVEKDHNDHLIPTPCYVQGRQPADQAAQSHIQPGLECLQGWGIHSLLGQPVQCVTTPWGK
Ga0255813_10555962Ga0255813_105559621F105149MLRRMYQGGSSTKQGPRIAIRDQDVILPRDANVRACEWPSDDFMVEAGFKGEFDAYVRNAELEDSLQDKCSQYFQLTDSFVRRFKYNCTRNSPSVLFDIYDTSYTMDLEDFTNACKLPQWGNNNDPHKSEFRDFLASITVGESRDI
Ga0255813_10556405Ga0255813_105564051F001813EGTFGRCVEGRGLVRTIGGGWMVGLGGPVGLFQPW
Ga0255813_10559109Ga0255813_105591091F005658MAWVEKLHNAHPVPTPCYVQGRQPAAQAAQSHIQPGLEC
Ga0255813_10563572Ga0255813_105635724F004001VESPSLEVFKNCVDVALRDMVSVLGGDGLMVGLDDLKGFFHPL
Ga0255813_10564507Ga0255813_105645072F034461MLGYDFEIIYKKGKLNVFVDALSRKDEEVATLLCAISIIQPDWITEARDEWK
Ga0255813_10565333Ga0255813_105653331F027342AGGTGRRGEARAPALVTKHEALELDSKTRESELAAALESAKNAKAEAQKALQEIDAMKKIAAGKAFNMQSKHVKVNYLLLTRVRSSPGAFADLPRSVSDAAKFYWAEEGSSTEKLLWAQYTRTEHAMPVSDQLKQLVELHKAAEQAMRGLIVRMWPGDSFPNSYFGLVRRLVDACPRLEVIRRSVCIEGARDLRMAMGRVWIGLN
Ga0255813_10565660Ga0255813_105656602F033854MAAEGQSDKVAYDMEVHVKQRYALECLHEEKNAPNDIHRHLLNIYGDQSVHVSTVR
Ga0255813_10565776Ga0255813_105657761F028669MYARREIKKQRFKCWSDQFITNVNKGDGERRGRTLLRIGVMGKGRRAIEKIERGKN
Ga0255813_10566062Ga0255813_105660621F037171MYVCARIENDPVEEPEEPAGEAPEQQSFGGGKCPLTYICPIHYLIHLPLYTFMPKD
Ga0255813_10566110Ga0255813_105661101F008539LSDSRIHEFHQRSFIPLCVSTLRLIFHSWKCDVYQFPFHLLLCFHFLVLNNFSNFLLVSIPTMIDQSNESNPVDSHHLVFRAWLSRFGIGKEVYYTKCLTEGHPCLVSFDCGSENNIVSQRLVEKLQLPATFHLDQA
Ga0255813_10566110Ga0255813_105661102F002932CMKLFIGTYQGGVLLPRNVIDGLQPLESNKYQVEFDPGRRELVSTCEKIKFLHKIIINLH
Ga0255813_10566591Ga0255813_105665913F028669MYARCEIKKQRFKCWSDQFITNVNKGDGERGGRTLLRIGVMGKGRRAIEKIERGKNC
Ga0255813_10566655Ga0255813_105666551F038012MIIEFQPPCYVQGCQPPAQGAQSHIQPGLECLQGWGIHNLLGQPVPVRHHP
Ga0255813_10568780Ga0255813_105687801F028669MYARREIKKQRFKCWSDQFIINVNKGDGERGGRTLLRIGVMGKGRRAIEKIERGKNC
Ga0255813_10569778Ga0255813_105697782F028669MYARCEIKKQRFKCWSDQLITGVNKGDEERGGRTLLRIGVMGKGRRAIEKIERG
Ga0255813_10572009Ga0255813_105720092F004001VELGSLEVLRDCADVDVVSGHGRDGLVVRLGDLRGLFQPQ
Ga0255813_10579871Ga0255813_105798712F004815FKARLDVALGSLVWWLVTLHIAGGWIWMMIVVLFNPGHSMIL
Ga0255813_10581089Ga0255813_105810893F005658MAWVEKDHNAHPVPTPCYVQGHQPAAQAAQSHIQPGLECLQGWGIH
Ga0255813_10587847Ga0255813_105878473F038012MAIEFQPPCYVQGRQPPDQAAQSHIQPGLECLQGWGIHSLLGQPVSVHRHPLYVYIY
Ga0255813_10588871Ga0255813_105888711F001813KSGQALEWAAQGGGEVTDPGGVQGTFRCFVQGHGLVRTTGDGWVVGLDDLVSLSQPW
Ga0255813_10591904Ga0255813_105919041F027342YLSLTRIRSSPGAFADLPRSVSNAAAIYRAEEGSSTEKVFWSQYAEAGHPVPPSDQLKQLVTLHKVAEEAMKSLIVRRWPGQAMPGSYFGLVRRLVDACPWVEVIKHSACIEGARRALAHAKVHCGKMDAQKLVTDPPPEGKEHRTPEMYYKSVLKGALLSRGALRAFMT
Ga0255813_10592129Ga0255813_105921291F004001ESPSLEVFKSRVDVALRDVGSGRGGLMVGLGDLKGFLQL
Ga0255813_10592306Ga0255813_105923061F038012MIIDFQPPCYVQGCQPLDEAVQSHIQPGLECLQGWGIHNP
Ga0255813_10594110Ga0255813_105941108F033854MAAEGQSDKMAFDVKLSIKQRCVIEFLHEEKIAPIDFHQCLLNVDGDQMEDVSTVRWKKEGNYHT
Ga0255813_10595965Ga0255813_1059596515F005658MAXVEKDHNAHPVPTPCYVQGHQPADQAAQSHIQPGLECLQGWGIHSLLG
Ga0255813_10598509Ga0255813_105985092F011632AAQRGGGVTEPGGVQRAFGCCVEGHGLVRTIGDGWMVGLGDPVSLFQPW
Ga0255813_10602602Ga0255813_106026021F068986VISPILXCWPAATETDAGGMAVEVEPSHQYPVTFCCHVTDDSSGATXQYDV
Ga0255813_10603233Ga0255813_106032331F096316MAWVEKDHSAHPVSTPCYVQGCQPADQAAQSHIKPGLECLQGWGIHSLLGQPVQCVTTLWVKNFLLIT
Ga0255813_10605242Ga0255813_106052421F096316MAWVEKDHNAHLVSTPCYVQGRQPADQAAQSHIQPGLECLQGWGIHSLLGQPVPVNI
Ga0255813_10607187Ga0255813_106071871F001813VQRAFGCCVEGHGLVGTIGDGQMAGLDDPVGLFQP
Ga0255813_10607955Ga0255813_106079551F038985VDLKKRHLGGQNFSGSSRPKKLPKIVNCATIKENEKLKEKMVGVKLE
Ga0255813_10608543Ga0255813_106085431F004001SPSLEVFQSRVDVALRDVVSGHGGDGRAVGPGDLRGLFQP
Ga0255813_10611248Ga0255813_106112481F001813VTEPGGVERAFGCCVKGHGLARTIDEGWMVGLDDPVGLFQH
Ga0255813_10613240Ga0255813_106132401F086390INGKDEACHMCVPDLCVLKSVVLGDKQYNLGAIVACRLHNNGLVGDLFGGIYATRVANYLGIPVHENDRELPPTYLDYDAMVKHRFVLRNEQFLQYRLIFDRRSAVHVTLPAPSLFDYKAKRRYVVTREEAAEHEGRMEAAHQHATAQNTFVAASQYDPSYNYGYQP
Ga0255813_10614171Ga0255813_106141711F002994EVEKCEKLSSELSTCHETIDNLRNENASLIAKVDSNACDVSIPDLRNDNVSLLAKIEELNVSLASLRNENEKLIAKAKDLDVCNASISNLRDENAILHAKIVELNDCKPSTSSVDHVSICTRCRDINIDAIHDHLAMIKQQNDHIDKLDVKIAEHELESKKFKFARSM
Ga0255813_10619320Ga0255813_106193204F096316MAWVEKDHNDHPVPTPCYVQGHQPAAQAAQSHIQPGLECLQGWGIHSLLGQPVQCVTT
Ga0255813_10621154Ga0255813_106211541F011632LEWAAQRGGGVTKPGGVQRAFGCCVEGHGLARTIGERRMVGLDDPVGLFQP
Ga0255813_10621752Ga0255813_106217521F020289IDKGPTEDEMVEWHHQLDGHEFEQAPGDGEGQESLGCCSPWDRKESDTTK
Ga0255813_10621934Ga0255813_106219347F001813AAQGSGGVTDPGGIQGTFGRCVEGRGLVRTIGDGWMTGLDPQDPVGLFQPW
Ga0255813_10622883Ga0255813_106228831F096316MAWGEKDHNDHLDPTPCYVQGRQPAAQAAQSHIQPGLECLQGWGIHSLLGQPVQCVTTL
Ga0255813_10625571Ga0255813_106255711F020828ADLPRSVSDVAAYYRAEEGSSTEKVFWPQYAEAEQPVPLSDQRQQLVELHKVAEQAMKGLIARLWPGEVMPGSYFGLVRRLVDACPWIEVVKRSICIEGARRALAHAKVHWGKLDAEKLLTEAPPPGKEYRTPEMYYNGVLKGSRRIADECSNDVTFE
Ga0255813_10628823Ga0255813_106288232F004001VESPSLEVFKNCVDVTVRDVVSGHGGGGLVVERGHLRGLF
Ga0255813_10629299Ga0255813_106292993F004001MEVFKNHGEVALRDMDNGYGGDGLMIGLDDYSGLFHRGSLK
Ga0255813_10630668Ga0255813_106306682F096316MAWVEEDHSAHPVPTPCYVQGRQPAAQAAQSHIQPGLECLQGWGIHSLLGQ
Ga0255813_10631677Ga0255813_106316771F028669MYTWSDIKKQRSRCWSDQFITNLNKGDEERGGQTLLWIGVMGKGRKAIERIGNRSKESL
Ga0255813_10635100Ga0255813_106351001F011632EWAAQRGGGVTEPGGVQRAFGCCVEGHGLAGTTGEGXTVGLDDPVGLFQP
Ga0255813_10637391Ga0255813_106373912F068298LCKVVLKGGQALEWAAQRGGGVTDPGGVQGTFGCGVEGHGLARTIGNG
Ga0255813_10638314Ga0255813_106383144F005658MAWVEKDHNAHPVPTPCYVQGHQPAAQAAQSHIQPGLECLQGWGIHSL
Ga0255813_10642433Ga0255813_106424331F001813DPGGVQRAFECCIEGRGLAGTIGDGQMVGLGDPVGLFHP
Ga0255813_10644104Ga0255813_106441041F011632WAAQRGGGVTDPGDVQRAFGCSVEGHGLARTIGDGRMVGLDDPVGLFQP
Ga0255813_10648215Ga0255813_106482151F002471LNDEVASLNAQLKTSKSEFDKLKFARDAYTIGRHPSIKDGLGFKREVKNLTSHKASISIKEKGKAPMANSIQKNHAFLYHDRRYSRNVHHDRSCNDIVSHAYDSNAMFASSSSMMYDRSLARKNVIHHVPRRNAHVPRKTSNEPSTIYHALNASFAICRKDRKIVARKLGAKCKGDKTCIWVPKEIVTNLVGPNNSWVPKTQA
Ga0255813_10648320Ga0255813_106483201F014592FEEILNSRGDICAFSGARGIATILEGKGCEHVKILSQSEATLSTEDIKDPSAEASAVGGKFFTDIWDNGGREMAQEIIQKSEKGIHEARKVAEAAEKNAEPEGQIGTSE
Ga0255813_10658595Ga0255813_106585951F004001VVKSLSPEVSQHRVDVALRDVVSGHGGGGLVVGLDDLSGLFQPE
Ga0255813_10658623Ga0255813_106586231F001813PGGVQGTFGCCVAGYGLVRSIGEGWMVGLGDLLGLFQPW
Ga0255813_10660142Ga0255813_106601421F096317VLNVNKQAVLLAAAARTAEIAGLMQDLERAQGELSLTRRQLEESKGE
Ga0255813_10660590Ga0255813_106605902F005658MAWVEKDHNAHPVPTPCYVQGHQPPDQAAQSHIQPGLEYLQGCGIHNLPGQQY
Ga0255813_10660697Ga0255813_106606973F001813GGGGVTNPGGVQGTFGCCVEGHGLVGTIGEGWMVGLGDSMGLFQPW
Ga0255813_10662859Ga0255813_106628591F011735KLGIWKFEPLWHGPYIFKRVLAKGAYELVDYDGIPFAQPRNGLYLKCYYA
Ga0255813_10666044Ga0255813_106660442F004815FKARLDVALGSLGCWLATLHIAGGWNEMSIVGLSNPGRSMSLWF
Ga0255813_10666819Ga0255813_106668191F014592DICAFSGARGIATILEKKGCEHIKILAQSEAALSFEDARDPSAEASIISGKFFTDIWDNGGREMAGEIIRRSEKGIHDAREVAEAAEKSAEAEGQLGIN
Ga0255813_10667538Ga0255813_106675386F096316MAWVEKDHNAHPVPTPCCGQGRQPPDQAAQSHIQPGLECLQGWGIHSPLGQPVPVL
Ga0255813_10667617Ga0255813_106676174F038489MAWVEKDHSDHLVSTPFHRQGHQPADQAAQSHIQPGKETV
Ga0255813_10669272Ga0255813_106692721F055526ADEQKKKRRRLRRVSSFDEDACTLAPAAEEVTATGLADIDPNGCAPPAADPNEDAVCAVAVEDEEEENETPLTRKNSRQFVASGGSSGVPSPALSALIGLQELSMANFDQALEDMVPENLLLEPADVDATETCAAVPDAGLRSSRASSTLEHDLEGRGADLDCPDPMEVAESPSTLEVVTADSLDLKNGADTCPAPEDVAGDDLARVKSVSHCPAP
Ga0255813_10671377Ga0255813_106713771F081962VVTKLKAVYTLVEQLYTGSQRALAVVALSNEVPTHLAEVLRRLAVLPQRIQELRRASARSGAIAALSRAKAFLPELDPAGIALGYPSLKEDGSAFDQKDFAACVKAVRPVATIIGNDTDLTKYQPGYNAENQRIPTPRYEAINLIPPARQHTFAPEINPDGLIDEEAQFEALSGINWKSSTFEALGSAEAEDEPGTSTQQAS
Ga0255813_10673708Ga0255813_106737083F001813PGGVQRAFGCCVEGHGLVRTIGEGRMVGLDDPVGLFQP
Ga0255813_10675334Ga0255813_106753342F028669MYARPEIKKQRFKCWSDQFITNVNKGDGERGGRTLLRIGVMGKGRRAIEKIE
Ga0255813_10681048Ga0255813_106810481F001445FNFHIKAFDKEMATHSIILAWRIPGMGEPGGLPSMGSQRVRHN
Ga0255813_10686418Ga0255813_106864181F081962MLIKLKAVYTLVEQLYSRSRRALAVVALSTPHPLLLQDVLKSLAFLPQWIQDLRRSSSRAGAVAALSRAKAWLPELDPADLALGYPSLKEDGIVFDDHDFTVCVKSIRPVATLVGNDTDLTSYAPGYDSENRRIPNTPYDQISLIPPIHKHTFAPEVDPSG
Ga0255813_10689954Ga0255813_106899541F096316MESQNPRMASVAKDHSAHPVPTPCYVQGRQPAAQAAQSHIQPGLECLQGWGIHSLL
Ga0255813_10690831Ga0255813_106908311F033854MAIEGQSDRMASDMEVHMKQRYVTEFLHTEQMALIDIHQCLLTVYGDQTVDVSTMRQCMVCFSTGNSDS
Ga0255813_10691295Ga0255813_106912953F068298SSLEWATQRGGGVTDPGGVQGTFQCCVEGHGLVRTIGDG
Ga0255813_10693854Ga0255813_106938541F001813AQGGSRATDPRGVQGMFERCVEGHGLVRTIDDGWMVGLGHPVGLLQPW
Ga0255813_10697196Ga0255813_106971961F001813GGVTEPGGVQRAFGCCVEGHGLARTIGDGRMVGLDDPVGLFQP
Ga0255813_10697868Ga0255813_106978681F007409MSEDKKVVGDSKLSLSEEMHLGFLQSMSKTNTEKITKEILEGLSEDTGDSDNYDVDSGGEDSEDRPWRPSHSVFGKSGIKENHLVNMRG
Ga0255813_10699234Ga0255813_106992341F001813TDPGGVQGTFGRCVEGHGLARSIGDEWMVGLGDPVSLFQPW
Ga0255813_10700018Ga0255813_107000181F011632LLXKGGQALEWAAQXGGGVTDPGGVQRASGCCVKGHGLAGTIGEGQMVGLDDPVGLFQP
Ga0255813_10709549Ga0255813_107095492F038985MLFVGGEMPKKRRLGPQIGSGSSVAKKLLKIVSCAETEKLKEKMENSKGQKT
Ga0255813_10710207Ga0255813_107102071F011632MGGQALEWAAQRGGGVTDPGGVQGTFGHCVEGRGFMRTIGDGWMVGLGDPVGLFQP
Ga0255813_10711614Ga0255813_107116141F028669MYARREIKKQRFKCWSNQFITNVNKGDEERGGRTLLRIGVMGKGRRAIEKIERSKNCV
Ga0255813_10720677Ga0255813_107206771F001813QRGGGVTDPAGVQGTFGCCGEGHGLVRTIGDGRMVGLGDAVGLFEP
Ga0255813_10724882Ga0255813_107248821F004815QAFKARLDVALGSLGCWLATLHIAGGWNWMSTVGLFNPGHSRIL
Ga0255813_10725435Ga0255813_107254351F011632LEWAAQRGGEVTDPGDVKRTFGWCVEGHGLVRTIGDGWMIGLGDPVRLFQP
Ga0255813_10727108Ga0255813_107271089F005658MAWVEKDHNAPPVPTPCYVQGRQPAAQAAQSHIQPGLECLQGW
Ga0255813_10727267Ga0255813_107272671F038489MTWVEKDHNDHXVSTPCYVQDRQPPDQAAQSHIQP
Ga0255813_10734227Ga0255813_107342271F065281MAKKSIVTSIRLNEDDYLKLKALKEEYGISWTKLVAYINEILEQDMKEKK
Ga0255813_10738141Ga0255813_107381411F001813GQALKWAARRGGGATDPGGVQGTYGHCVEGRGLMTTIGDGWMVELGDAVGLFQPW
Ga0255813_10739828Ga0255813_107398281F001813VQRTFGCCVEGCGLLRTIGDGRMVGLDDPVGLFQP
Ga0255813_10741128Ga0255813_107411282F096317MQASLLAAAARTAEVAALKRDLERSKEELGLTKRQLEEKEGKKYLV
Ga0255813_10741411Ga0255813_107414111F004815APSLEALKARLDVALGSLGWWLATLHTAGGWKEVIIVVLFNPGHSMIL
Ga0255813_10742140Ga0255813_107421401F028669MYAQSEIKKQQFKFWSDQFITNVNKVDEERGGWTLLWIRVMGKGRRAIEKIERGKNCVKR
Ga0255813_10743224Ga0255813_107432241F005658MAWVAKDHNAHPVPTPCYVQGRQPADQAAQSHIQPGLEC
Ga0255813_10744145Ga0255813_107441452F001813PGGVQGTFGCCVEGHGLVRTTGDGWMVGLGDPVGLFQPW
Ga0255813_10745033Ga0255813_107450333F011632MGGQALEWAAQRGGGVTNPGGVQRAFGCCVEGHGLVGTIGEGRMGGLDDPVGLFQP
Ga0255813_10746933Ga0255813_107469331F028669MYAQREIKKQRFKCWSDQFITNVNKGDEERGGQTLLRIGVMGKGRRAIEK
Ga0255813_10754885Ga0255813_107548852F035108MLTGRPAEEMPGSTGDLLPELMQLHERIRQAMRGVSQALWPAHSMPEGLRELAEKLKGARWRFRLWKISACRKGAREAWAMVKTRFTKSDPNHMAEVGPVGPDGKEIPVSLVYGQVELAAKYSQQDCKLDSLLDGIEEEYNQSE
Ga0255813_10755325Ga0255813_107553251F038012MIIEFQPPCYVQGRQPPDQAAQSHIQPGLECLQGWG
Ga0255813_10756531Ga0255813_107565311F034461MLGYDFEIIYKKGKQNVVADALSRKDEDVEAFLCAISIIQPEMIIEATIKWKNDEEMWTLIKNL
Ga0255813_10758314Ga0255813_107583141F035626MAPLIINNDTVQGETFLPRQIFVFGGFALRANSLGHLEQIESYAPGHQVRFGSLNYTADIRGDLIFDGFEPQPSAPHYLEGHDLTLPPNSVLEAAHALVPTFDSEPAALIEDERLDVTSGAAIEPNTSPTLRA
Ga0255813_10758410Ga0255813_107584101F001813DPSGVQRAFGCCVKGHGLAGTIGEERTVGLDDPVGLFQP
Ga0255813_10764188Ga0255813_107641881F059631SAFIVVCEALLCIRPHFSLWLKTFNVKPKVVKGTQAECGGAMLGKMPNVLWFEGAFVDSVKGWRSGWFYITEPRDPEWAAAPEFRSGIPTQLTSWKEKGLLWGNPKELTGLRACIQKLVSNKLRLVDVVQVMLIRRILPCQERAFNLWEFNPEQHQALSGLFDTTYEGAWRVLFKGAKAPASATEDRGFRSQRQADEVSDSTPLRDTCC
Ga0255813_10764569Ga0255813_107645691F020289MLGWHHQLYGHEFEQALGVGDGQGSLACCSPWGGKELDTTE
Ga0255813_10766865Ga0255813_1076686514F004001VFQNCVDVALRDVVSGHGGGELVVGLGDPGGLFQPLCFYKMI
Ga0255813_10769512Ga0255813_107695125F004001VESPSLEVFKNCVDVALRDRGSRHGGDGSMVRIGDLGGVFQP
Ga0255813_10772363Ga0255813_1077236319F005658MAWVEKDHNAHPVPTPCYVQGRQPADQAAQSHIQPGLECLQGW
Ga0255813_10773201Ga0255813_107732011F003406MTEWFYVKNDLTVREDIKGIIMRPIWQSFGLRRPKVEMNEAAEECQRAFGAVCSFIGTRDLVQEHIAFRVWPLAEKWEMPQETVKEADEGGLIRLKYTFKFGDKFVEPDDDWLKSIENLSDELLGAYSKAEDTAMSAAFGGQKKKRLNRVFDAIGFVYPDYCYPIRRQKRKNTTSAEEATIVPSEPE
Ga0255813_10773420Ga0255813_107734201F015450LQATEGLLAEAEAKIIELNTKLLRQSEQFEQEKEELNAKLEAETQQNSDLKRLLAGLQEKCLEFSNKCIQRLRKIFHSVGASSEKFTPSAEDLPKTFEHIEGEIDELDEVIAGHGDFCAWVASRGTAAAFLKAGCDHGKIVNRPNFTLSPSILDDIPDLARSISNRFVKMIWTKGGREKAGDEARSHLEPVRNHTLCLPLPSSSILTYKSLIRVG
Ga0255813_10774737Ga0255813_107747371F004815APSLQAFKARLDVALGSLVCWLVTLHTAGGWNWMSTVVLFNPGHSVIL
Ga0255813_10774852Ga0255813_107748522F001813CQGGGEVIDPGGVQEMFGCCVEGHGLARTIGEERMVGLDDPEGLFQP
Ga0255813_10776151Ga0255813_107761511F020637MDGGAWWAAVHGVARSRTRLSDFTFTFHFHALEKEMATHSSVLAWRIPGAGEPGGLTSM
Ga0255813_10776262Ga0255813_107762621F035108GMLTGRPEEEMPASAGGLLQDLSQLHERARQVMQGIAQSLWPSSSLPNGMGELVDMLQGARQHFRLWKISACRQGAREAWAMVNTRYTKLDPNHMAEVGPARSDGQEIPVSLVYDQVALAAKYSQQDCKLDSLLDGIEDEYNQSK
Ga0255813_10776586Ga0255813_107765865F005658MAWVAKDHSAHPVPTPCYVQGRQPAAQAAQSHIQPGLECLQGWG
Ga0255813_10777715Ga0255813_107777151F001813QGTFGHCVEGHGSVRSFGDGWIVGLGDSVSLFQPW
Ga0255813_10781357Ga0255813_107813571F014346MVLEKTLESPLDCKEIQPVHPKGNQSXIYIGRTDAEAETPILCHLMQ
Ga0255813_10783680Ga0255813_107836803F004001LEVLKSRVDVALRDVVSGHGRGGLLVGLDDLGGPFQT
Ga0255813_10786051Ga0255813_107860511F001813LEWAAHRGGGVTDPGGVQGTFGCCVEGHGLVRTIGDGWMVGLGDPVGLFQPW
Ga0255813_10787066Ga0255813_107870661F004001VGSLSLEAFRNSADVALRDVVSGHGGDGLMVGLDDLS
Ga0255813_10787936Ga0255813_107879361F005658MAWVAKDHNAHPVPTPCYVQGHQPADQAAQSHIQPGLE
Ga0255813_10787947Ga0255813_107879471F011632LEWAAQRGGGVTEPGGVQRAFGCCVEGHGLARTLGEGRMVGLDDPVGLFHP
Ga0255813_10789427Ga0255813_107894272F100750LNIMVTSILEEHKIDVFTGNLKDNIQHEVCILEPDSLEKAFRLARKVECKIMATRRPTTQFYKEGSVATPRFPQPIRLTPQKLEEKRAKRALLQL
Ga0255813_10794597Ga0255813_107945971F067310PGRVQEWKKSSARCGADVALCLARVHCKDAREDKLAALRVANTKKHDFRSFMETFIAAATRIADGIDLDEFVAPSSPPQEG
Ga0255813_10795952Ga0255813_107959521F096316MAWVAKEHSAHPAPTPRYVQGRQPAAQAAQSHIQPGLECLQGWGIHSLLGQPVQCVTTLWGKN
Ga0255813_10795986Ga0255813_107959862F014346VVLEKTLESPLDCKEIQPVHPKGDQTSMFIVRTHAEAETPILL
Ga0255813_10797056Ga0255813_107970561F005658MACVEKNHNAHPVPTPCYVQGRQPAAQAAQSHIQPGLEC
Ga0255813_10802315Ga0255813_108023152F038012MIMEFQPFCYVQGHQPLVQAAQSHIQPGLECLQGWGIHNLLGQPVPVCK
Ga0255813_10803637Ga0255813_108036372F001813TEPGGAQRAFGCCVEGHGLARTIGEGRMVGLDDPVGRFQP
Ga0255813_10808475Ga0255813_108084751F011632CFADGRALAWAAQRGGGVTEPGGVQRAFGCCVEGHGLVRTIGDGQMVGLDDPEGLFQL
Ga0255813_10810602Ga0255813_108106021F096316MVHSAHPVPTPCYVQGRQPAAQAAQSHIQPGLECLQGWGTHSLLGQPVQC
Ga0255813_10815349Ga0255813_108153491F001813VTEPGGVQRAFGCCVEGHGLARTIGEGRMVGLDDPVGLFQH
Ga0255813_10816721Ga0255813_108167212F057039MGLEMVVQVVEWERIYEMDVVEVVVVVEVDGRDSMELGMEDMEGNIEDIVDFPNKVLANHVAKIGFGVEMAKVAKEGVCPN
Ga0255813_10818645Ga0255813_108186451F005658MAWVEKYLKDQLVSTSCNVQGRQPAHQAAQSHIQPGLECLQGWGIHSLLG
Ga0255813_10819438Ga0255813_108194381F005658MAWVEKDHDGHLVPTPRYVQGRQPPDQAAQSHIQPGLECLQGWGIHSLLG
Ga0255813_10820818Ga0255813_108208182F093003GHDREASRPSTQAAPCTKAREYAPDLRDMLEDKARQTRSIYGSRGRPMARNDNRHVGYGKYGHAEHSRQSSFELRRDIAQYRGAAHPLCFTDEVMDHQIPEGFKPMNIEPYDGTTDPAVWIEDYLLHIHMTRGDDLHAIKYLPLKLKGPARHWLNSLPAESIGCWKT
Ga0255813_10823118Ga0255813_108231183F004815LEAFKARLDVALGSLGCWLVTLHIAGDWNWMSIVVLFNPGHSMMIL
Ga0255813_10824349Ga0255813_108243491F038084MLIAIFQNFPQFIVIHTVKGFGIVNKAEINVFLELYCFYDDPADVGNLISGFSAFSETSSNIRKFTVHILLKLVLRISN
Ga0255813_10827116Ga0255813_108271161F104139HCQPLNEVWAGMDPGSTPSSHSDVLLAAELPWVGPAFPPGAQSLLQALT
Ga0255813_10828172Ga0255813_108281721F004001MELFKNRVDVALRDAVSAYGGDDLMVGLDHLSGLFQPS
Ga0255813_10828571Ga0255813_108285711F003406MKEWFYVKNDLKVREDIKDIIMCPIWQRFGLRKPKVEMDEVAEECQRAFGVVCSFIGTRDLIQEHIAFRVWPLADNWEMPKETVKETDEGGLVRLKYTFKYGDKFVEPDDDWLKSIETVSDELLGVYSKAEDTALSAAFGGRKKKRLNRVFDAIGFVYPDYHYLVRGQKRKGTASTKETASAAPSEPAPKRKRVKVLTHRPRYIELATVPELV
Ga0255813_10828607Ga0255813_108286071F005658MAWVEKDHSDHPVPTPCYVQGRQPAAQAAQSHIQPGLECLQGWGIHSLLG
Ga0255813_10830165Ga0255813_108301651F096316MAWIAKVLVAHPVPTPCRVQGRQPAAQAAQSHIQPGLECLQGWGIHSLLG
Ga0255813_10831998Ga0255813_108319981F020492MRMQAALLTSTALTAEVDVLKQNLERSENELGRAKKQLEDKEGM
Ga0255813_10834705Ga0255813_108347051F038012MIVEFQPPCYVQGHQPPDQAAQSHIQPGLECLQGW
Ga0255813_10835623Ga0255813_108356231F038985MSKKHHLGPQNDSESSGPEKMTKIVNCAKIKESEKLKETMVGFQAE
Ga0255813_10838039Ga0255813_108380391F020828MKGLIVRLWPKEAMPGSYFGLVRRLVDACPRLEVIKRSVCIEGARMALARAKVHWGKMDAKKLVKDGPPEGKPHRIPEKYYDGVMKGACLVADECTKDMILE
Ga0255813_10838784Ga0255813_108387842F001813QRGGGVTEPGGVRKVFGCCVKGHGLAGTIGEGRMVGLDDPVGLFQP
Ga0255813_10839586Ga0255813_108395863F001813TDPGGVQRAFGCCVEGHGLARTIGDGQMVGLDDPVGLFQP
Ga0255813_10839866Ga0255813_108398661F001813QRGGGVTEPGGVQRAFGCCVKGHGLARTIDEGRMVGLDDHVGLFQP
Ga0255813_10842479Ga0255813_108424791F001813GGGVTEPGGVQGTFECCVEGHGLVRTIDEGRMVGLGDPVGLFQHW
Ga0255813_10844306Ga0255813_108443065F004001VVVESPSLGVLKNSGDVALGEMDSGYGGDGLTDGLDDLSGLFQP
Ga0255813_10845400Ga0255813_108454001F001813DPGGVQKVCGRCVEGHGLVRTIGERRMVGLDDPVGLFQP
Ga0255813_10848710Ga0255813_108487102F028669MYARCEIKKQLFKCWSDQFITNVNKGDEERGGRTLLWIGVMGKGRRAIEKIERSKNCVKQ
Ga0255813_10850703Ga0255813_1085070331F038489MAWVEKDLKNHPVSTPCYVQGHQPPDQAAQSHIQPG
Ga0255813_10851014Ga0255813_108510141F076748FIQLPGVSPPFYVSKSTFLQSDSSFFDWNDEETVIFPNWETGIT
Ga0255813_10852990Ga0255813_108529901F038489MAWVEKDHHNHPVSTPCYVQGHQPPDQAAQSHIQPGLEYLQGW
Ga0255813_10854697Ga0255813_108546971F038084VVWYSHLFQNFPQFIVIHTVKGFGIVNKSEIDVFLELFCYFNDPADVDNLISAFSAFFKISLNIWKFMVHVLLKPGLENFEHYFTSLLDECNCVVV
Ga0255813_10856127Ga0255813_108561272F004001VFQNHVDVVLRDMVSGHGGDGSAVGLDDLRGLFKP
Ga0255813_10856486Ga0255813_108564861F005658MYHRMAWVEKAHNAHPVPTPCYVQGRQPAAQAAQSHIQPGLECLQGWG
Ga0255813_10858106Ga0255813_108581068F005658MAWVEKDHSAHPVPTPCYVQGRQPADQAAQSHIQPG
Ga0255813_10858854Ga0255813_108588541F096316MAWVEKEYNDHRFPTPCYVQGRQPADQAAQSHIQPGLECLQGWGIHSLLGQPVQCVTTL
Ga0255813_10860019Ga0255813_108600198F004001VSPCLEVFKTHGDVALDDIINGHGEDGVEVGLGDLSGVLQT
Ga0255813_10863767Ga0255813_108637671F011632AQRGGGVTEPGGVQRAFGCCVEGHGLVRTIGEGWMVGLSDPVGLFQP
Ga0255813_10865333Ga0255813_108653333F011632AQRGGGVTEPGGVQRAFGCCVEGHGLARTIGEGQMDGLDDPVGLFQP
Ga0255813_10867614Ga0255813_108676141F004815FKARLDVALGSLGCWLPTLHIAGGWNWMSTVGLCNPGHAAIL
Ga0255813_10869570Ga0255813_108695701F038985MIKIAANFHTKKRRLGPQNGSGSSGPKKLLKIVSCEKKLKEIMVGPQVE
Ga0255813_10873682Ga0255813_108736821F001813GVTDPGDFQGMSGCCVEGHGLVRTIGDLWMVGLGDPVGLFQPW
Ga0255813_10874356Ga0255813_108743561F038489VDDHRMAWVKRDHNDHLVSTPCYVQGHQPAAQAAQSHIQPG
Ga0255813_10875459Ga0255813_108754594F004815ARLDVALGSLGCWLATLHIAGGWNWMSIVGLCNPGHSVIL
Ga0255813_10877170Ga0255813_108771703F096316MAWVEKDRNAHPDPTPCYVQGHQPADQAAQSDIQPGLECMQGWGIHSLLGQPVPVHH
Ga0255813_10879403Ga0255813_108794031F028669MYARREIKKQRFKCWSDQFITNVNKGDGERGERTLLRIGVMGKGRRAI
Ga0255813_10879866Ga0255813_108798661F027342DLPRSVSDAAAFYRAEEGSSTEKVFWSQYAEAGHPVPLSDQLKQLVEHHKADEQAMKGLTVRLWPGGALPGSYFGLVRRLVEACPRLEVIKHSVCIEGARRALACAKVHWGKLDAEKLVKDGPPSGKEHRKPENYYKDVLKGARLVADECTRDVIFE
Ga0255813_10881033Ga0255813_108810333F028669MYARREIKKQRFKCWTDQFITNVNKGDGERRGRTLLRIGVMGKGRRAI
Ga0255813_10884069Ga0255813_108840691F028669MYARREIKKQQFKCWSEQFITNVNKGDEERGGRTLLRIGVMGKGRRAIEKIER
Ga0255813_10888722Ga0255813_108887226F038012MIIEFQPPCYVQGCQSLDQAAQSKIQPGLECVQGWGIHNLLGQPVPVYDGL
Ga0255813_10896103Ga0255813_108961032F014346MDAFERMVVLEKTPEGPLARKEIQPVHSEGDHPRDFFGRTDAKAETPVLWPPHAKS
Ga0255813_10904440Ga0255813_109044401F032472LDAQFGPPYPRSASSDTDVGAFIESSFVSSPIGPMAPSIINNDAVQGETFLPRQIFVFGGFALRANSLGHLEQIESYAPGHQVRFGSLNFTADIRGDLIFDGLEPQPSAPHCYDGHDLALPPNSALVAAQESALAFSPEPIAQIEDLWLDTASGASTSTAMEPNTSLVPYKARDSEVPDSLPDSEPPAAPPTESGWAPIMEFTAADIFQHSPFGDI
Ga0255813_10906217Ga0255813_109062171F020862EAEVEKSSNLQKSLKELQDRCLEFSNRCVQRLKQVFNSVGASSEKFSPSVEDLPGTFEHIEGEVDALDEVIARHSDFYALLASRGTAVAFMKTVCTHGKIVNRPNFSLSPADLIDIPSLARSIGNRFITQIWTKGGRSLAGDEAQSHLKPIINSYLMLTFSLKLEFTL
Ga0255813_10907660Ga0255813_109076603F004001MVESPSLEVLKKRGDVARRDTVSGHGGDGLMIELHDLSSLFQP
Ga0255813_10911250Ga0255813_109112501F001813MMYVDFGCCVEGHGLAGTIGEGRMDGLDDPVGPYQP
Ga0255813_10911784Ga0255813_109117842F028669MYARREIKKQRFKCWSDQFITNVNKGDGERGGRTLLRIGVMGKGRRAIEKI
Ga0255813_10912523Ga0255813_109125232F004001VTQWHRLLREAVESPSLEVLKNCGDVALRDVVSGHGGDGLVVGLGDLKGLL
Ga0255813_10914452Ga0255813_109144521F068298MVVAQGGGGVTDPGGVQGAFGCCVEGHGLVRTIGDGW
Ga0255813_10916962Ga0255813_1091696210F038012PTPCYVQGRQPAAQAAQSHIQPGLECLQGWGIHSLLGQPVHKDIKQ
Ga0255813_10921071Ga0255813_109210714F004001ESLSLEVFKNWGGVALRDVVSGHGEVGLMVGLDDLSGLFQP
Ga0255813_10928079Ga0255813_109280791F038003SGIDLALEANTSAVSPQHANPKQTNDASTLAKDLLGVALVPETTVQSAPDATSSPPVDQEVPTNSHLVPFGFSFDPPSDLASVEAFIEACTNPPGYHMRSPWDRLTAVSTYGPSGSEEDDEPDFCWDFSGLGNPSAMRDFMTACDYCLSDCSNGSRSFGDEDCGPSRECFHVDLGGPGEGNHLGIPENGDPPRPAPRVDILRELAVVPVPAGGQDAQLEQIREMQARLDDVRTSFGS
Ga0255813_10928327Ga0255813_109283277F005658MAWVEKDHNDHLIPTPCCVQGRQPAAQAAQSHIQPGLE
Ga0255813_10932335Ga0255813_109323354F004001VESLPLEVFKNHMDVALRDYHNGHAAGGLMVGLGDLSGLSQP
Ga0255813_10933660Ga0255813_109336602F001813TGMSCPERWGVTKPGGVQRVFGCYVEGHGLARTIGVGQLVGLDDPVGLFQP
Ga0255813_10934404Ga0255813_109344041F001813GGGGVTDPGGVQGTFGCCVEGHGLVRTVGDGWMVGLGDPVGLFQPW
Ga0255813_10934503Ga0255813_109345031F033854MVAEGQSDKMAPDMEVRMKQRCVMEFPLVEKIAPIGIHGCLLDVYGDLPVDVSTAFQQWKHQS
Ga0255813_10936793Ga0255813_109367931F001813VTDPGGVQGTFGHCVEGHGLVRTIGDGWMVGLGDPVGLFKP
Ga0255813_10937605Ga0255813_109376051F011632LEWTAQRGGGVTEPGGVQRAFGCCVEGHGLARTIGDGRMVGLHDPVDLFQS
Ga0255813_10943219Ga0255813_109432191F002002VAQTVKNPPAMQETQVQSLGQEDPFEKGMATHSSILGWRIPRAKEGSGLQSMESQNLTSLSD
Ga0255813_10943662Ga0255813_109436624F038489MAWVEKDLIDHLVSTPCYVQGRQPAAQAAQSHIQPGL
Ga0255813_10944462Ga0255813_109444622F004815AFKARLDVALGSLGCWLATLHIAGGWNSMSILDLFNPGPSVIL
Ga0255813_10945453Ga0255813_109454531F005658MAWVEKDHSAHPVPTPCYVQGHEPPDQAAQNHIQPGLE
Ga0255813_10945837Ga0255813_109458371F028669MYALREIKKQQFKCWSDQFITNVNKGDEERRGRTLLRIGVMGKGRRAIKMIERSKNCVQR
Ga0255813_10946241Ga0255813_109462412F068298QALEWAAQRGGGVTDPGGVQRAFGCCVEGHGLARTIGDG
Ga0255813_10949282Ga0255813_109492821F002002MVEAMEKNLPAMQETWVQSLGWEDLLEKGIATHSCILAWRISWTVQSVGLQRVGHN
Ga0255813_10951205Ga0255813_109512051F001813VQRAFGCCVQGHGLARTIGEGQMVGLDDPVGFFQS
Ga0255813_10953804Ga0255813_109538041F020828SDQLKQMVQLHKVAEQTIKGLIVRLWPGEALPGSYFGLVRRLVDACLRLEIIKRSICIEGARRAFARAKVHWGKLDAEKLVKDGPPEGKEHRRPEMYYEGVLKGARLVAEECTMDVIFE
Ga0255813_10956861Ga0255813_109568612F011632LIRKGGHALEWAAQRGGGVTNPGGVQRAFGCCVEEHGLAGTIGEGRMGGLDDPVGLF
Ga0255813_10960098Ga0255813_109600981F001813QRGGGVTEPGGVQRAFGCCVEGHGLVGTIGEGQMVGLDDPVGLFQP
Ga0255813_10960201Ga0255813_109602011F104139NEVWEGGDPGSTPPSHSGALLTTELPWVGPAFLPGAQSLLQAIT
Ga0255813_10960768Ga0255813_109607682F048299TRVQSLGWEDPLEEEKATYSSILGWRIPMDREPGRLRSMGSQRVEHD
Ga0255813_10964777Ga0255813_109647771F051243VEEGNGKPLQYSCLENPMDRGAWWAAVHGVSKSQTRLSNFSFTFHVDALEKEMATHSSVLAWRIPGTAEPGGLLSMESHRVGHD
Ga0255813_10965120Ga0255813_109651201F093243MLLQYIPTEDQDADILTKALTKRKLEYHRDMIGVKDNPFLVEREC
Ga0255813_10968884Ga0255813_109688841F007068FNYGSENNVVSQRLVEKLQLPTTFHLDQAWIKFSTWQCVKEVLCDIAPMDSCHLLLGWAWLRFKTLHLDERSLYLRQEGHQKK
Ga0255813_10969353Ga0255813_109693531F004815RLDVALGSLVCWLVTLHIAGGWNWMSFVGLFNPGHSVIL
Ga0255813_10971998Ga0255813_109719981F005658MAWVEKALNDHPVPTPCYVQGHQPAAQAAQSHIQP
Ga0255813_10972856Ga0255813_109728561F079404QVGGAEIWRIAETGYLSGTPKKTSKEWPSEWFYMEDVPLPAPVRRGLPKFDNVPLKKRRSWRPRSPQEEDNGEVLDLMNRIKALAQSGLTVIEVMSICIMRGVQPLQYRGHPLWCFNGEDDANHCRRKGSDNAAALAKILFELFKGEEEEFIRIKPRDGFSMYNPPSWVSYTSLLPFFPYSSSQVLTLPFYGRNCEKL
Ga0255813_10975833Ga0255813_109758332F004815VALGSLVCWLVTLHIAGGWNPMVTVVLFNPGHSMIV
Ga0255813_10977414Ga0255813_109774142F004001MVDSPSLEVFKNHVDVALRDVVSGHGGVGLVGGLGDLSDLFQP
Ga0255813_10981198Ga0255813_109811982F093243MLLQYIPTEDEDADILTKELAKRKFEYHKSRIGVADIPFLVEREC
Ga0255813_10983838Ga0255813_109838381F005658MAWVEKDHNDHLVTAPCYVQGRQPPHQAAQSHIQPGPECLQGWDIHNLL
Ga0255813_10985027Ga0255813_109850272F033854MTDGSAEQANKMAPDTDLCMKQRCGIELLHAEKIAPIDIHARLLNIKGDQTVGVSTVR
Ga0255813_10987390Ga0255813_109873901F005658MAWVEKDHNDHLVPTPCYVQGRQPAAQAAQSHIQPGLECLQG
Ga0255813_10987978Ga0255813_109879781F014346VVLEKTLESPLDCGEIQLVHSEGDQPWDFFGRNDAKAETP
Ga0255813_10993393Ga0255813_109933933F005658MAWVEKDLKDHVVSTPCSVRGRQPPDQAAQSHIQPGLECLQGWGIHNLL
Ga0255813_10994257Ga0255813_109942571F001813GVTDPDGVQGTFGHYVEGHGVVRTIGDGWMVELGHPVALFQPW
Ga0255813_10996732Ga0255813_109967321F002471HPSIKDGLGFKREAKNLTSHKAPIPAKEKGKAPMAGSAKNNHAFMYHDRRHTRNANRSYNVFDSYVYDSHDMFASSSFYVHDRNVGRRNVVHNMPRRNVVNVPRKVMNEPSTIYHVVNASFAICRKDRKIVARKLGAKCKGDKTCIWVPKTIVTNLVGPNKSWVHKTQA
Ga0255813_11001100Ga0255813_1100110017F005658MAWVEKDHSAHPVPTPCYVQGRQPADQAAQSHIQPGLECLQGWGIHNIPGQPV
Ga0255813_11001578Ga0255813_110015781F004815VDAPSLQAFMARLDVALGSLGCWLVTLHIAGGWNWMSTVVLFNPGHFMIQ
Ga0255813_11001831Ga0255813_110018311F062644QTLEDMVPEDLLSEPVDDGAMEACVDVPDAGARSSRASSTLERDLEGREADLDCPGLMEVAKGPSTLEVVTAESLDLKNGADTCPAPEEVAGDDLAQVKSVSHCPAPEGVAGDDPAQVGSANCVPTPEGARAGSPSCTSMDVHAGSPPHSGCMVVAQTLDQGVALEDSVPADRAFGSVEGTVLIPTGPLQAASGGGLAPGYQLISPDLGIRSFFSNLQVLCCTLA
Ga0255813_11002909Ga0255813_110029094F004001MSLVAFKNHVDVALRDVVSGHGGDGSAVGLDDIRGFFQP
Ga0255813_11012599Ga0255813_110125992F053764MVNTKIRLIIFFAAEDGEALYSQQKQDRELTLAQIMNSLLPNSDLN
Ga0255813_11017323Ga0255813_110173237F005658MAWVEKDRSDHLITPPSYVQGRQPADQAAQSHIQPGLQCLQGWGIH
Ga0255813_11017832Ga0255813_110178321F001813VTEPGGVQRAFGCCVEGHGLVRTIGEGRMVGLDDPVGLFQP
Ga0255813_11018219Ga0255813_110182191F002798MVSDNREDKIQFIRDGLNKESLDDILLSLETHPSGYVQGAILQLWPLFQKEHARYSLGNLTINDLVCQFIRKLDGKPILDP
Ga0255813_11018655Ga0255813_110186552F011632ECAAQRGGGVTEPGSVQRAFGCCVEGHGLARTIGEGRMVGLEDPVGLFQP
Ga0255813_11021132Ga0255813_110211321F098130TFCGHIVFVLNDIPGPHPRRRPVRDDVLLQRTHVQDWAPPGWHWEVLPGGARRLVRNPTSGPVVDPDLLWWRSRGPHSVQRQPALSEVVRRRVREEDEHVHRYMAAMDDVRFSTTWRVLWADDRRYDPVMVPSLWVCTARAPGTASGALDSSVVLDLY
Ga0255813_11024721Ga0255813_110247213F104139ARSPCQNCQPLNEAWEGVDPGSSPSSHWVTLHAPELPWAGPAFPPAAPSLLQAVT
Ga0255813_11024765Ga0255813_110247651F038012MIIEFQPLCYVQGHQPPDQAAQSHIQPGLECLQGWGIHKLYI
Ga0255813_11027707Ga0255813_110277072F004001VESPSLEVFRKCVVVALRDVVSRHGRGVLVVGLGDLGGLFQP
Ga0255813_11028060Ga0255813_110280601F034461MLGYDFEIIYKKGKLNVVADALSRKNEEVEALLCAISIIQPDWITEARDEWKKEKYVWTLIQKFQQDPSKFDT
Ga0255813_11028376Ga0255813_110283761F001813PGGVQRVFGCCVEGHGLVRTIGDGXMVGLDDPVGLFQP
Ga0255813_11028624Ga0255813_110286241F034384MIFPFDHCLDSVIALAEFCQDFEEETSRLEPNLDPVNSPVNDEVAMNVFRLESRVAAAVDYLARLKVATSRIDSTLWPRETLQNDLESLMARLNTVPGRVQEWKKSSARCGADVALCLARVHCKDAREEKLAALRVANTKKHDFRSFMETFLAAATRITDEIDLEEF
Ga0255813_11028940Ga0255813_110289401F001813VTHPGGVQRTFGCCIERHGLARTIGEGQMVGLDDPVGLFQP
Ga0255813_11029564Ga0255813_110295641F001813QRGGGVTDPGGVQRAFGCCVEGHGLVRTIGDGRMVGLDDPVGLFQPL
Ga0255813_11029967Ga0255813_110299671F031785AAAFLKAGCDHGKIVNRPNFTLTPSILDDIPDLARSISNRFVKMIWTKGGREKAGAEARSHLEPVRNHTLCLPFLVSSILTYNDLIHVG
Ga0255813_11033531Ga0255813_110335311F020828MRGLIVRMWPGEPLSGSYFGLVRWLVEACPRLEVIKRSVCIKGARRAFARAKVHCTKLDAVKLVKEGPPEGKEHRCPENYYESGLKGSRLVADECAKDVIFE
Ga0255813_11034449Ga0255813_110344491F035108MSVGVLTGHPVEEMPGSTGDLLPELLQLHEHVRQAMSGVVQALWPSVSLPEGLGGLAEKLQGVRRRLRLWKISACRQGAREAWAMVKTRYPKADPNHMAKVVPVGLDGKELPVSLMYGQVELAAKYSQQDCKLDSLLYGIEEEYNQSV
Ga0255813_11036700Ga0255813_110367001F011632LCIIAQGGGGVTEPGGVQRMFGCCAEGHGLVRTIGEGRMVGLDD
Ga0255813_11039459Ga0255813_110394591F001813GGVQRAFGCCVEGHGLARTIGERRMVGLDDPLGLFQP
Ga0255813_11039755Ga0255813_110397553F001813GGVQRAFGCCVEGHGLARTVGEGRMVGLDDPVGLFQP
Ga0255813_11041526Ga0255813_110415261F028669MYARRDINKQRFKCWSDHFITNFNKGDGERGGRKLLRIGVMGKGRRAIEKIERGKNCVKR
Ga0255813_11042867Ga0255813_110428671F001813VTNRGCVQGTFGHCVEEHGLVRTIGDGWIVELGDPVGLFQPYDIL
Ga0255813_11044312Ga0255813_110443121F001813VTKPGGVQRALGCCVEGHGSARTIGDGQMVGLDDPVGLFQP
Ga0255813_11047210Ga0255813_110472101F104139FNEGWEGGDPGSTPSGHSGALHAPELPWVGPAFPAGVQSLVQAMT
Ga0255813_11052337Ga0255813_110523371F104139PCQPFNEVWKGVEPGSTPSDHSAALHAPELPWVGPAFPPGAQPLVQAMT
Ga0255813_11058645Ga0255813_110586452F011632LEWAVQRGGGVTEPGVVQRAFGCCVEGHGLARTIGDRRMFGLGDPEGLFQP
Ga0255813_11063175Ga0255813_110631751F028765EMLACELSTCHDSISNLKSINDDLNAKLKITSKSTSCVENDVICNRCKDFDIDACSEHLVCISKLNDEVASLNAQLKTSKNEFDKLKFARDAYTIGRHPSIKDGLGFKREVKNLTSHKASISAKEKGKAPMASSAQKNHAFMYHDRRHSRNVYRSYDAFDSHAMIASSSSIMHDRNVARKSVVHHVPRRNIVHAPRKVMNEPSTIYCALNASFAICRKDKKIVARKLGAKCKGDKTCIWVPKDICTNLVGPNMSWVPKTQA
Ga0255813_11064177Ga0255813_110641772F068986LLCWPMISEVDAGGMAIEGEPSRQYSVTCCCVTDGSRGHWQNGI
Ga0255813_11072389Ga0255813_110723893F096316MAWVEKEHNAHPVPTPFYVQGRQPADQAAQSHIQPGLECLQGWGIHSLLGQPVQCITTLWVEI
Ga0255813_11073439Ga0255813_110734392F001813EPGGVQRVFGCCVEGHGLARTIGEGQMVGLDDPVGLFQP
Ga0255813_11074491Ga0255813_110744911F005658MAWVEKEHSAHPVPTPCYVQGRQPAAQAAQSHIQPGLECLQGW
Ga0255813_11077121Ga0255813_110771211F011632GGQALEWAAQRGGGVTDPGGVQRAFGCCVEGHGLARTIGEGRMVGLDHPVGLFQP
Ga0255813_11077830Ga0255813_110778301F004815PSLQAFKARLDVALGSLGCWLATLHIAGGWSWVSTVLLFNPGHCVVL
Ga0255813_11078428Ga0255813_110784281F068298QALEWAAQRGGGVTEPGGVQRAFGCCVEGHGLARTIGEG
Ga0255813_11082509Ga0255813_110825091F027437ISTLEEKHSRDQAELVQRCSDFEEKYSQSQTELAQVFAALDDANALSSSLHAQLNSEKVTYETVLCLVVLLLLA
Ga0255813_11082934Ga0255813_110829343F001813GVQGMFGSCVEGHGLVRTTGDWWMVGLGDPVCLFQPW
Ga0255813_11089843Ga0255813_110898431F038084GQVVWYSHLFQNFPQFIVIHTVKGFGIVNKAELDVFLELSCIFDDPADVGNLISGSSAFSKTSLNIRKFTVHVLLKPGLENFEHYFTSV
Ga0255813_11089982Ga0255813_110899821F002002VKNLPAVQETWVQSLGQENPLEKETATHSSILTRIIPWREEPGGLQFMGLQRVRHD
Ga0255813_11092899Ga0255813_110928991F038012MIIEFQPPCYVQGHLPVDHTAQSHIQPGLECLQGWGIHSL
Ga0255813_11095790Ga0255813_110957902F020492MGMQAVLLTSAALTAEVNALKESLERSESELGRAKKQLEDKEGE
Ga0255813_11102295Ga0255813_111022951F038489MAWVEKDHNDHPVSTPCYVQGRQPPDQAAQSHMQPGLECLRG
Ga0255813_11102531Ga0255813_111025312F001813WPPQVQGTFGGCVEGHGLLRTIGDGWMVGLGDPVGLFQP
Ga0255813_11104990Ga0255813_111049901F068298GGVTEPGGVQRAFGCCVEGHGLARTIGEGQTNGWTG
Ga0255813_11106864Ga0255813_111068642F063479MSERNRAETHWIARSTRGGGRPKSGEVDLGPPVKSGRVRGLGELHGLLAELAEALAWLEGGWSGLATVAEALAAMAGGIKLAGAKEKWLAGEGECGAKRGAPGEAL
Ga0255813_11107939Ga0255813_111079391F068298GQVLEWAAQRGGGVTEPGGVQRAFRCCVEGHGLVRTIGDG
Ga0255813_11112711Ga0255813_111127111F049439PFFLLFKAQKEDPKHKQERKSTLENKDGLIKARGNTHRKDGTKAHKREAQILPQIKLSSIHKGLKNLWSNSFQGGEDDEGLTPTKDEGTCLRKLSMFRKEVH
Ga0255813_11113094Ga0255813_111130941F065281MAKKSIVTSIRLNEDDYLKLKQLKEQYGISWTKFVSYVNELLEN
Ga0255813_11123497Ga0255813_111234971F028669MYARSEIKKQRFKCWSDQFITNVNKGDEERGGRTLLRIGVMGKGRQEIEKIERGKN
Ga0255813_11124007Ga0255813_111240071F001813TDPGGVQGTFGHCVEGHGLVRTIGDGWIVGLGDPVGLFQPW
Ga0255813_11125599Ga0255813_111255991F068298MGGQALEWAAQGGGGVTDPGGVQGKFGCCVEGHGLVRTV
Ga0255813_11127678Ga0255813_111276785F004001LPKEVMESPSLEVFKNRADVALNDVDGGDGLWVGLNDLRGLFQP
Ga0255813_11131392Ga0255813_111313921F001813VTNPGGVQGTFGRCVEGHGLARTIGDVWVVGLGDPVGLFQPW
Ga0255813_11133702Ga0255813_111337022F028669MYARREIKKQRFKCWSDQFITNVNKGDEVRGGRTLLRIGVMGKGRRVIE
Ga0255813_11137904Ga0255813_111379043F001813QGGGGVTDPGGVQGTFGHCAEGHGLVRTVGDGWMVGRGHPVGLFQPL
Ga0255813_11139114Ga0255813_111391141F076912LEKSTPLCNGRESNADKVQDSETTLLVSKKGDKNDLVDSEKTPQSCVDVVFELLASTAGTSSSNSLPESLRLLQSQLQAERHQSAVLRQEAEGLRKSLQNSDAYFLVQQQALEDLSAKQKKVNKLAKHLASIMGTQDIVS
Ga0255813_11142508Ga0255813_111425081F013401KCLMAKDGKRKKVKSKSSTKYESSSDDNASDEEDNLCTLFANLNMEQKKKLNELISAIHEKYDLLDSQEDFLIKENKKHVKVKNAYALEVEKCEKLSSELSTCHETINNLRNENAKLIAKVDSHVCDVSIPNLRNDNDDLLAKIEELNISLASLRMENEKLLAKAKELDVCN
Ga0255813_11144159Ga0255813_111441592F027342AQVGKVRQELQALTKKHESLELDSKTRAFELAAAIKNAKSAKAESQKTLQELDEVKKIAAGKAFFMQSKHINVSYLLLTRIRSSPGAFADLPRSVSDAAAFYRAEEGSSTEKVFWSQYAEAGHPVPLSDQLKQLVELHKAAEQAMKGLSVRLWPGGALPGTYFGLVWRLVEACLRLEVIKRSVCIEGARRALARAKVHWGKLDAEKLVKDGPPPGKEHRKPENYYKDVLKGACLVADECSRDVIFE
Ga0255813_11145859Ga0255813_111458591F076912LENSTALSNGKGSNADKVQDSETSLLVSKKADKNYLDDSEGTQKSCLDVVFELLATTAGTSSSNSLPESVRLLESQLQVERHRSDVLRQEAEGLRKSLQNSDAYFLVQQQVLEDLSTKQEKVNKLAKHLASIMG
Ga0255813_11147865Ga0255813_111478653F004001LDQAAQGVMESVSLEAFKKRGNAVLRDMVSGHGGDRLVVGQGDLGGIFQPV
Ga0255813_11149471Ga0255813_111494713F028669MYARCEIKKQRFKCWSDQFITNVNKGDEERGGRTLLRIGVMGKGRRAIEKIERS
Ga0255813_11150966Ga0255813_111509662F005658MAWVAKERSAHPVPTPCYVQGRQPAAQAAQSHIQPGLECL
Ga0255813_11155817Ga0255813_111558179F004815PSLQAFKARLDVALGSLGCWLATLHIAGGWNWMSTVVLFNPGHSVIL
Ga0255813_11158789Ga0255813_111587894F001813GVTEPGGVQRVFGCCVEGHGLARTIGEGQMIGLDDPVGLFQPQ
Ga0255813_11159208Ga0255813_111592082F011632MLYIYTSQALEWAAHRGGGVTDPGGVQRVFGCCVEGHGLARTIGDGRMVGLDDPAGLFQP
Ga0255813_11160479Ga0255813_111604791F004815LPKEAVDAPSLQVFKARLDVALGSLVCWLATLPIAGSWNWMVIVVLFNPGHSMIL
Ga0255813_11165421Ga0255813_111654212F006329ELHVADVIDDHKIKMDAMRLKIGNIRKYAIHTKAWYHYAVGLIVTLVVIMIAFVVALKCF
Ga0255813_11166356Ga0255813_111663561F004815LQAFKARLDVALGSLGCWLATLHIAGGWNWVSTVLLCNPGHSRIL
Ga0255813_11169167Ga0255813_111691671F093243TEDQDADILTKALTRSKFEFHRGRIGVADNPYLAEREC
Ga0255813_11171565Ga0255813_111715651F051243CPRGFLREDNGTPLQYSCLENPMDGGAWKAAVHGVAEGRTRLRDVTFSFPFHALEKEMATHSSVLAWRILGTGEPGGLPSMGSD
Ga0255813_11177590Ga0255813_111775901F005658MAWVEKDHNDHLVSTPCYVQGHQPADQAAQSHIQPGLECLQGWGIHSPLGQPV
Ga0255813_11177958Ga0255813_111779581F046965CREMIDNLRNENAILNAKVDSHVCNVSIPNLRDDNIDLLAKIDELNASLASLRLENENLIAKAKDFDVCNATISDLRTKNDLLHAKVVELKSCKPSTSNVEHVSICTRCRDVNVDAIHDHLALIKKQNDHIAQLNAKIREHDLENEKFKLARSMLYNGRRPGFKDGSGFQRGDNVKIYAPPKNLSNFVKGKAPMPQDNEGYILYPAGYPENKIKKIHSRKSHSGPN
Ga0255813_11178377Ga0255813_111783771F034384MLEANLLYQTDILTVISDRCLDSVVVLPKFCQNLEEETGRLEINLDPINSPVKDEVAMNVLRLESRVAALIDYLARLKVATSRIDTTLWPRETLQNDLESLMTRLNEVPSRVQEWKKSSARCGADVAPSLVRVHCKEAREDKLVALRVANTKKHDFRSFMETFIAAATRIADGIELDEFVAPS
Ga0255813_11184379Ga0255813_111843791F004815MDAFKARLDVALGSLGCWLAALHIAGGWNWMSTVVLFNPGHSVIL
Ga0255813_11186321Ga0255813_111863211F004001PSLEMFKNRVDVALRDVVSGHGGDGLVVGQGDLRGLFQP
Ga0255813_11186576Ga0255813_111865761F028669MYARRETKKQQFKCWSNQFISNVNKRDEERGGRTLLQIGVMRKGSSAKQKIGNRSKESL
Ga0255813_11188275Ga0255813_111882751F067310VALSLVRIHCKDAREDKLVALRVANTKKHDFRSFMETFIAAATRIADGIDLDEFVAPSSPPREG
Ga0255813_11193529Ga0255813_111935292F028669MYTQHEIKKQQFKCWSDQFITNLNQGDEERGGQTLLQIGVMGKGRRAIEKIERARIA
Ga0255813_11194339Ga0255813_111943392F011632LEWAAQRGGGVTEPGGVQRAFXCCVEGHGLAGTTGEGRMVGLDEPVGFFQP
Ga0255813_11196704Ga0255813_111967042F028669MYARREFKKQRFKCWFDQFITNVNKGDEEREGRTLLRIGVTGKGRRAIEKIGRSKNWVK
Ga0255813_11197224Ga0255813_111972241F059631HFRGNHQGVAIGWFYITEPRDADWAAALEFRSGIPTRLTSWKESGLIWGNSEELTGLQACIQKLGDKKLKLVNVVQVMLIRRILPCQQRAFKLWEFDPAQHRTLSGLFDTRYEDAWKVLFKGAEAPASATEDRGFRLQRPADEVCDFTTCFP
Ga0255813_11198145Ga0255813_111981451F007409MSEEKKVAAEMKLSLSKEMHLGFLKSMAKTNTEKITREILEGLSEDTGDSDSYDAESGGEDSEDRPWRPSHAVFGNQPLSKAILSI
Ga0255813_11202325Ga0255813_1120232523F096316MTWVEKDHNAHPVPTPCYVQGHQSPAQAAQSHIQPGLECLQGWGIHSLLGQPVQCITTLYLYVSVMALT
Ga0255813_11203212Ga0255813_112032121F065416MRSGYKELGLDLVEPLQYQHRKPQKPLMGDEKEDEGVGYLIKILFEEALEKQRNAMMDNFAQILQRL
Ga0255813_11203289Ga0255813_112032899F065281MAKKSIVSSIRLNEDDYLRLKALKEEHNLSWTRFIAYVNRLVEKDIKSNGVNNHEV
Ga0255813_11203984Ga0255813_112039842F012765MEELDNQRRQLQESSDEVARLTQLLSAKDATIKELRASKKTIARELETAQQAVKVAEEAAVTFKAQRDKALDKAIRAGRILMRRPGVVVPEDIRADVVAAPDSSNRPSSSVVPERDIGK
Ga0255813_11206971Ga0255813_112069711F001813GGGVTDPGGVQGMFGRCVEGHGLVRTIGDGCMVGLGEPVGLFQPW
Ga0255813_11208557Ga0255813_112085575F005658MDWVEKDHNAHLVSTPCYVQGRQPADQAAQSHIQPGLECLQGWDIHS
Ga0255813_11210156Ga0255813_112101561F068298WAAQRGGGVTDPGGVQGTFERCVEGHGLVRTIGDG
Ga0255813_11211411Ga0255813_112114111F004815LPKEAVDAPSLEALKARLDVDLGSLVWWLVTLHTTGGWNEMSIGVLFNPGNYMIL
Ga0255813_11216806Ga0255813_1121680612F004815MSHPLQAFKARLDVALGSLVYWLATLHIAGGWNWMSIVVLFNPGHSMIP
Ga0255813_11218538Ga0255813_112185381F005658MAWIEKDHSAHLIPTPCYVQGHQSADQAAQSHIQPGLECLQ
Ga0255813_11220881Ga0255813_112208812F027342ELDSKTRDSELSAVLESTKSAKAEAQKAFQEIDAMKKIAAGKAFYMQSKHVKINYLLLTRIRSSPGACADLPRSVSDAAAFYRAEEGSSTEKVFWSQYAEAGHPVPLSDQVNQLVELHKVAEQAMKGLIVRLWPKEAMPGSYFGLVRRLVDACPWVEVIKHSACIEGARRALARAKVH
Ga0255813_11221003Ga0255813_112210031F038985MKYPNLSFPKKHCLGPQNGFESSGPEKLAKIVNCAIIKETEKLKETMARAQVE
Ga0255813_11222613Ga0255813_112226131F011632GQALEWAAQRGGGVIKPSGVQRVFGCCVEGHVLAGTIGDGRMVGLDDPVGLFQP
Ga0255813_11224867Ga0255813_112248672F001813VLEWAVQRGGGVTDPGGVQGTFGRCVEGHGLVRTVGDGRMVELGDAVGLFQPW
Ga0255813_11225531Ga0255813_112255311F002471TSCVEIVETCTRCIDLNVYAYSKHLVSISKLNDEVASLNAHLKASKSEFDKLKFARDAYTIGRHPSIKDGLGFKREAKNLTSHKAPIPAKEKGKAPMATSAKKNHAFLYHDRRQTRNAYRSYNAYDDFSHAMFASSSSYVHNRNVGRRDVVHNMPRRNVVNIPRKVNEPSTIYHALNASFAICRKDRKVIARKLGAKCKGDKTCIWVPKEIVTNLVGPNKSWVPKTQA
Ga0255813_11225982Ga0255813_112259821F001813GGVTEPGGVQRMFGCCVEGHGLARTIGDGXMVGLDDPVGLFQP
Ga0255813_11226423Ga0255813_112264231F038489MAWVEKDHNDHLVSTPCYVQGRQPADQAAQSHIQPGLECLQ
Ga0255813_11227413Ga0255813_112274132F004001VDSLSLEVFKSCVDVALRDMGSGHGGDGLLVVLYELSDLFNCHDSTIL
Ga0255813_11230407Ga0255813_112304072F011632ILLLXKGGQALEWAAQRGGGVTEPGGVQRAFGCCVEGRGLVGTIGEGQMVGLDDPVGLFQ
Ga0255813_11230644Ga0255813_112306448F005658MAWVEKDHSAHPVPTPCYVQGRHPADQAAQSHIQPGLECLQ
Ga0255813_11231944Ga0255813_112319442F020492MCMQASLLASAALTAEVDMLKQSLEKAEQELGRAKKHLEEKEGKKCPV
Ga0255813_11232308Ga0255813_112323081F028669MYARGDIKKQWFKCWSDQFITNVNKGDEERGGRTLLRIGVLGKGRRAIEKIERGKNCVKR
Ga0255813_11234408Ga0255813_112344081F004001VVQSPSLEVFRNRVDVALRDVVSGHGGGGLMIGLDDLRGPFQP
Ga0255813_11235148Ga0255813_112351483F004001MESPSLEVFKKHGDVALSEMVSWHGGGGLMTALDDLCSLFQP
Ga0255813_11236934Ga0255813_112369341F033854MAAERQSDTMASDMEVHIKQRCVMEFLHTEKIELIDIHEHLLNVYGDQTMNVSTVRW
Ga0255813_11237192Ga0255813_112371921F073390IATILERKGCEHVKFLAQSEAALSSEDIKDPSAEASLVGGKFFTDIWDNGGREMAQEIIRKSEKGIHDARKVAEAAEKSADVEVQIGID
Ga0255813_11239074Ga0255813_112390743F011632LSTSWEYQKDEIKALEWAAQRGGGVTDPGGVQGTFGHCAEGRGLVRTIGDRWRVGLDDPVGLFQP
Ga0255813_11243058Ga0255813_112430581F015450RRQLILFQFQGKQSFLCSLLLWIMKMLLTKTVFVQSMLLSKALMMQRDLEDKKHEAIIGNLESKIKEQSVIIEKKDFELQSTEGLLAETEAKISELNSKLIGQSKQFEQEKLELNSKLEAEVQANSNLKKSLTSLQDKCLNFSNNCIQQLKKIFYSVGASSGKFTPSDEDLPKAFDHIEAEIEELDEVIAGHGDFCAWVASRGTAAAFLKAGCEHGKIVNRPNFTLSPSILDDIPDLTRSISNRFIKMIWTKGGREKAGDEARSHLEPVRNDTSELPFSFALDFYS
Ga0255813_11246124Ga0255813_112461241F028669MYARRKIKKQRFKCWSVQFITNVNKGDGERGGRTLLRVGVMGKGRRAMEKIERGKNCIKR
Ga0255813_11248127Ga0255813_112481273F001813MPPWAAQGGGGVTDPGGVQGTFGRCVEGHGLVRTIGDGRMVGLRDPVGLFQPL
Ga0255813_11254665Ga0255813_112546651F035626MAPSIIGNDAVQGGVFLPGQIFVFGSFALRANSLGHLEQIKSYAPGHQVRFGSLNYTSDILGDLIFEGFEPASGGPHSHDGHDLALPPDSGREITPVATLALDPEEITPSDG
Ga0255813_11255120Ga0255813_112551201F038489MAWVEKDHNDRLVSTPCYVQGHQPPDQAAQSHIQPGL
Ga0255813_11257653Ga0255813_112576532F067310VQEWKKSSARCGADVALSLVRVHCKEAREDKLAAIKVANTKKHDFQSFMETFIAAATRIADGIDLDSFVEPASPPPAE
Ga0255813_11260981Ga0255813_112609811F005658MAWVEKDHSAHPVPTPCYVQGRQPADQAAQSHIQPGL
Ga0255813_11264886Ga0255813_112648865F028669MNARREIKKQRFKCWSDQFITNVNKGDGERGRRTLLRIGVMGKGRRAIEKIERGMNCVKR
Ga0255813_11265649Ga0255813_112656493F004001WHRLPREVMESPSLEAFKKHGDVALRDVVSEHGGDGLIVGLGDLSSLFQL
Ga0255813_11265825Ga0255813_112658251F053764EIRLIMFFAAQDGEAPYSQQKQDQKLTAAQIMNSLLPKSDLN
Ga0255813_11265827Ga0255813_112658273F005658MAWVAKAHSAHPVPTPCYVQGRQPAAQAAQSHIQP
Ga0255813_11266988Ga0255813_112669882F011632ALEWAAQGGGGVTDPGSVQRAFGRCVEGHGLARTIGEGRMVGLGDPVGLSQPW
Ga0255813_11267089Ga0255813_112670891F038084IDVFLELPCFFHDPADVGNLISGSSALPKTSLNIWKFTVHVLLKPGLENFEHYFTSV
Ga0255813_11270653Ga0255813_112706538F038012MIIEFQPPCYVQGRQPPDQAAQSHIQPGLECLQGW
Ga0255813_11272742Ga0255813_112727421F038012MITQFQPPCYVRGRQPPDQAAQSHIQPGIECRQGGGIHSLLGQPSSVS
Ga0255813_11276668Ga0255813_112766682F011632EILLLXKGGQALEWAAQRGGGVTEPGGVQRVFGCCVKGHGLAGTIGEGRMVGLDDPVGLFQP
Ga0255813_11282374Ga0255813_112823741F093003RRLIATTRSLKKKQQQLQDDQDLLANRWTEVLAAEEYGLERPTKSYPKRRLLPQFEEEALEPTLPVQDAADRPPCARDKAAYEPEHHSAPCRQTNKNTKARGYTQDLQDELENKAGQSRSIYGSRGRATRRDDDRYAGYNKPKSGWAEYNRPDSFELRRDVARHRGAADPLCFTDEVMDHEFPEGFKPVNIESYDGTTDPAVWIEDFILHIHMARGDDLHAIKYLPLKLKGPAWHWLNSLPKDSIGSWEDLEEAFLDNF
Ga0255813_11284259Ga0255813_112842592F038012MIIEFQPPCYVQGRQPPDQAAQSHIQPGLECLQGWGI
Ga0255813_11289511Ga0255813_112895112F005658MAWVAKAHSAHPVPTPCYVQGRQPAAQAAQSHIQPGLECLQGWGIH
Ga0255813_11289635Ga0255813_112896351F028669MYAWCEIKKQRFKCWSDQFITNVNKGDEERGGRTLLRIGVMGKGRRVIEKIERSKN
Ga0255813_11295412Ga0255813_112954121F034384DVLRLESRVAAVVDYLARLKAATSRIDSTLWPEETLQNDLESLMARLNTIPGRVQEWKKSSARCGAEVALCLARVHCKDAREEKLAALRVANTKKHDFRSFMETFLAAATRIADGIDLDEFVAPSSPPQEG
Ga0255813_11301947Ga0255813_113019471F068298GGQALEWAAQRGGGVTEPGGVQREFGCCVEGHGLARTTGEG
Ga0255813_11302517Ga0255813_113025171F096316MAWVEKDHSAHPVPTPCYVQGRQPAAQAAQSHTQPGLECLLGWGIHSLLGQPVQC
Ga0255813_11309932Ga0255813_113099321F096316MAWVAKDCNALPDPTPCYVQGRQPAAQAAQSHIQPGLECLQGWGIHSLLGQPVQCITTL
Ga0255813_11314258Ga0255813_113142581F038012MNIEFQPPCYVQGHQPPDQAAQRHIQPSLECLQGRGIHNLL
Ga0255813_11315344Ga0255813_113153443F004815LDVALGSLVCWLATLHIAGGWNQMVIVILFNPGLSMVLRGLTRAE
Ga0255813_11316443Ga0255813_113164431F079778VDKVKGDEANFKAQSEIQRNEIENLQKQLAEAKLKCAIAEADRDASEYWKNYLEKSVVELRSSKERCFEKSVKCVKKIKTSFANVGAYSSEDNFIQGGPEGPIEWISSEAEAFEEILSDRGDVCAFSGVRGVAAILEKAGCKHVKILAQAEAAFSVDDTKDPSAEESLIGGKFFTDIWENGGRG
Ga0255813_11317359Ga0255813_113173591F038489MDGVEKDHNDHLVSTPCYVQGRQPADQAAQSHIQPGLECLQGW
Ga0255813_11319248Ga0255813_113192481F078199VGTLNYDFEIIYKKGKINVVVNALLIKDEEMEGFLCAI
Ga0255813_11319859Ga0255813_113198592F035626MAPSIIFNDAVQGEVFPPGQIFVFGGFALRANSLGHLEQIESYAPGHQVRFGSLNYTADIRGDLIFDEFEPQPSVPCCHDGHDLALPPDSALVAAHESALTPSSEPIAQIEDEWLDTASGAATSAAMEPNTDLVPYKARDSEVSDSLPDSEP
Ga0255813_11319925Ga0255813_113199251F033854VGQKAAEGQSGKMVSDMEAWMTQRCVIEFLHAEKIVPTDIHQHLLNVPGDQTVD
Ga0255813_11321379Ga0255813_113213792F011632GQALEWAAQRGGGVTEPGGIQRVFGCCVKGHGLARTIDEGRMVGLDDPVGLFQP
Ga0255813_11322073Ga0255813_113220731F034384VDLPRSCFLCLKVNLYAWQTFPIVVFPFDHPLDLVITLAEFCQNFEEETSRLEPNLDPVNSPVNDEVAMDVFRLESRVAAVVDYLARLKAATSRIDSTLWPEETLQNDLESLMARLNTIPGRVQEWKKSSARCGADVALCLARVHCKDAREEKLAALRVANTKKHDFRSFMETFLAAATRIADGIDLDEFVAPSSPPQEG
Ga0255813_11323952Ga0255813_113239522F068986MKAAQEVILPILLCWPTMSEAAAGGMAVEVEPSHQYSTPCCCHAKDGS
Ga0255813_11324749Ga0255813_113247492F098130MPGPHPRRRPVRDDVLLQRTHVRDWAPLGWHWEVLPGGARRLVRNPASGPVVDPDLLWWRSRGPHSVQREPAPPEVVRRRVREEDEHVHRYMAAMDVRFSNTWQVLWGDHPSYDPVMVPSLWLSTA
Ga0255813_11326169Ga0255813_113261691F020492MRMQASLLASAALTAEVDTLKQNVERSEQELGLAMQQLEEKEGTKYLIEICERRNCKK
Ga0255813_11327641Ga0255813_113276412F028669MYIRREIKKQWFKCWSDHFITNVNKGDEERGGRTLLQIGVTEKGRKVIEKIERRRKESL
Ga0255813_11329308Ga0255813_113293081F020492MQASLLASAAPTTEVDTLKQNLERSEQELGLAKQQLEEKEGKKYLIEICERCNCKK
Ga0255813_11330337Ga0255813_113303371F102692KVAEEAAVTFKAQRDKALDKAIRAGRILMRRPGVVVPEDIRADVNAAPDSSNRPSSPVVPENDIRK
Ga0255813_11331173Ga0255813_113311732F004815KARLDVALGSLVCWLATLHIAGGWNEMSIVVLFNPGHSMIP
Ga0255813_11331380Ga0255813_113313801F004815KARLDVALGSLVCWLATLHIAGGWNWMVIVVPSNPGHSVIL
Ga0255813_11332787Ga0255813_1133278715F038489MAWVEKDHTAHLVSTPCYVQGRQPPDQAAQSHIQPGLECLQGW
Ga0255813_11333892Ga0255813_113338923F001813GTSRVQGTFGRCVEGYGLVRSIGDEWIVGLGDPVGLFQPW
Ga0255813_11334349Ga0255813_113343491F038003TGSHLTPFGFSLDPPSDFTLADALVEASPNPLGFRMRSPWDRLTDVSTYGPSGSEEDGEPDFCWDFSGLGNPSAMRDFMTACDYCLSDCSDGSRSLGDEDCGPSRECFHVDLGGPSEGNHLGMPENGDLPRPEPRVDILRELVVVPVQAGGHDPQLEQIREVQARLD
Ga0255813_11334559Ga0255813_113345592F005658MAWVEKDHNAHPVPTPCYVQGHQPAAQAAQSHIQPGL
Ga0255813_11337008Ga0255813_113370081F052316GAREAWAMVKTRYTKADPNHMAEVGPVGPDGKEIPVSLVYGQVELAAKYSQRDCKLDRLLDGIEEEFSQSA
Ga0255813_11339082Ga0255813_113390821F001813MFGCCVEGHGLVSAIGDGGLVGLGDPVGLFQPWWFYDS
Ga0255813_11339920Ga0255813_113399207F004815KARLDVALGSLGCWLATLHIAGGWNWRSTVGLFNPGRAVIL
Ga0255813_11341734Ga0255813_113417341F001813TEPGGVQRAFEYCVEGHGLARTVGEGRMVGLDDPVGLFQP
Ga0255813_11345634Ga0255813_113456344F038012MTIQFKPPCYVQGRQPAHQAAQSHIQPGLECLQGWGIHSL
Ga0255813_11353165Ga0255813_113531652F001813GGVQRAFGCCVEGHGLARTVGDGRMVGLDGPVGLFQL
Ga0255813_11354651Ga0255813_113546511F059631RIRPHFGLWLKTFNVKPKVVRGSQAECGGAMAGKMANVLWFEGSFVETLKGWQTGWFYITEPRDPEWTAAPEFRSGPPMRLVSWKATGLSWGDEKEVTGLQTCIQSLVSKPIKIVNVVQVMLVRQILPCQQRGFNLWEFNPAQHQTLNRLFDTTYEDVWKVLTKGAEAPTSASEDRGYSSQRHASEVSYFHLLQDVKFFHSLTLCGI
Ga0255813_11356359Ga0255813_113563591F011632WAAQRGGGVTDPGGVQRTFGCCVEGRGLARTIDEGRIVGLDDPVGLFQP
Ga0255813_11356680Ga0255813_113566801F094706VTKPRQLAPTVGLSHDGFRFLEGRFEGLEGYAVGRMTKSRRGKLYIDDAGWGPKAGSVEYEYRVPFDGIHVFIGKIGEPGPEPDICTDLVETAQRARSARVKPAMKHAFVGVIHGGSYEDGSEFRGTTIVCSGDESSTEETESLYQLQDGLIESYSDGDSILDPSDLPNRVGIFMIGTQAALHSS
Ga0255813_11358140Ga0255813_113581401F033854MXQVAAKGQSDRKMSDIEVRMKQRCVTEFLHTEKLAPTVIHXTLLNVYGDPTV
Ga0255813_11358531Ga0255813_113585311F104139HCQPLQEVWKGLEPGSPPSGHSGTSHAAELPWVGTAFPPGAQSLLQAMS
Ga0255813_11358673Ga0255813_113586731F006329LKEKINRIEEEKMILELHVADVVNDHKIKMDAMRLKIKKIRKYAIHTEAWYHYAVGSVVTLVAVMTAFVFPLKCFT
Ga0255813_11360646Ga0255813_113606461F096316HRMAWVKKDHNDHLVSTPCYVQGCQPADQAAQSHIQPGLECLQGWGIHSLLGQPVQCVTTLWVKNFL
Ga0255813_11364041Ga0255813_113640411F035108LTGRPAEEMPGSTGDQLPELVQLHKRVRQAMSGVAQALWPSLSLPEGLGELAERLQGARWRFRLWKISAYHQGAREAWAMVKTRYKKADPNHMAEVGPVGPDGKEIPVSLVYGQVELAAKFSQQDCKLDSLLDGIEEEYNQLI
Ga0255813_11368648Ga0255813_113686483F005658MAWVEKDHNAHPVPTPCYVQGRQPPDQAAQSHIQPG
Ga0255813_11369015Ga0255813_113690151F005658MAWVAKEHSAHPVPTPCYVQGRQPAAQAAQSHIQPGLECLQGW
Ga0255813_11378877Ga0255813_113788771F071823VALEVKNPPAMQETWVPSPGQEDALAEGMATHSSILAW
Ga0255813_11379295Ga0255813_113792952F004001VAQLPREVVQSPSPEVFKNRGDMALRDVVGGHGGDGVMVGLDDLRGLFQP
Ga0255813_11380430Ga0255813_113804302F004001VGSPSLAVFKNSGDMARGDTVSGHGGDGLVVRLGDLRGLFQP
Ga0255813_11380994Ga0255813_113809943F001813GGVTAPGDVHRAFGYCVEGHVLARTIGDGRMVGLDDPVGLFQP
Ga0255813_11381237Ga0255813_113812371F073390VLEKKGCGHVKFLAQSEATLSTEDIKDPSAEASVVGGKFFTDIWNDGGRGMAREIIERSEKGIRDARRVADAAERSREPEGQLGTN
Ga0255813_11383027Ga0255813_113830271F001813RSGGVTDPGCGQGTFGRCVEGHGLMRTIGDGWMVELGDPVRLLQPW
Ga0255813_11383592Ga0255813_113835922F028669VYTRREIKKQWFKCWSDQFITNVNKGDEERGGRTLLQIGVMGKGRRAIEGSKNCVKQG
Ga0255813_11386261Ga0255813_113862611F033854VMDVLHVMDVEEQSDKMASDVEVWMKQRRSIKFLHAEKMAPTDIYRCLLKVYGEQTVYVSTL
Ga0255813_11386924Ga0255813_113869242F038012MIIWFQPPCDVQGYQPLHQAAQNHIQPGLESLQGWGIHNLLG
Ga0255813_11387928Ga0255813_113879281F011632AAQRGGGVTEPGGVQRAFGCCVEGHGLARTIGEGRMVGLDDPVGLFQP
Ga0255813_11389367Ga0255813_113893672F096317MNKQAMLLAAATRTGEIASLTQDLERAQGELGLTRRQLEDSKGE
Ga0255813_11392109Ga0255813_113921092F028669MYTPHEIKKQRSRCRSNQFITNVNKGDEERRGQTLLRIGVMGKRRQATEKIERSKN
Ga0255813_11392634Ga0255813_113926341F004001EVVESLSLEMFEKCLDVALRNVVSEHGGGGLMVGLDDLSGLFQP
Ga0255813_11392964Ga0255813_113929641F028669MYAQHEIKKQWFRCWSDQFITHINKGDEERGGRTLLRTGVMEKGRRAIEKIERSKNFVKQ
Ga0255813_11394384Ga0255813_113943842F020862VKNLGAFKHIEGEIDDLDDVIAGHGDFCALVASRGTAAAFLKSGCEHGKIINRPNFSLSPAILDDIPNLARSIANKFIKVIWTKGGREKAGDEARSHLKLVTILYLMITFSFEF
Ga0255813_11395496Ga0255813_113954961F038012MIIEFQTPCCVQGRQPADRVAQSHIQPGLECLQGWGIHSLLGQPVQCVTTPSVKNLL
Ga0255813_11396503Ga0255813_113965031F038489MAWAEKDHNAHLVSTPCYGQGCQPPDQAAQSHIQPGLE
Ga0255813_11402756Ga0255813_114027562F068986MRAAPKVMPPILLCWPTTSKVDVGGMAVEVESSHRYAVVFCICATDDSRGAV
Ga0255813_11403204Ga0255813_114032046F004815FKARLDVALGSLVCWLVTLHIAGGWNKMSIAVLFNPGHSVIL
Ga0255813_11404410Ga0255813_114044103F038489MVWVEKDHNDHLVSTPCYVQGRQPADQAAQSHIQPGLE
Ga0255813_11404724Ga0255813_114047242F004001VVKSLSLEVFKGRVVVALRDMVIGHGDDGLMVGLGDLSGLLQP
Ga0255813_11405308Ga0255813_114053081F094706QLAPTMGPAHGGFEFLKGNFEGLKGYVVGRMTKSCRGKLYIDGAGWGPDAGSIEYGYRAPFGGIHVFIGKIGEPGPEPDICTDLVETAQHASPARIQPAMKRAFVGCVHEIGSEPVSEGETVVYSDGESSTGETESLYQIHNGVFEGYSDGNSIPDLLEPPSQVVVYMAGTRPTLQSSSIAAMNTG
Ga0255813_11407765Ga0255813_114077651F014346VVLERTLESLLDCKEFQPVHPKGDQSQVFIGRTDAKAETPLLWLPDLKSRLFRKDLDAGE
Ga0255813_11410282Ga0255813_114102821F004815FKARLDVALGSLGCWLATLHIAGGWNGMSTVVLCNPGHSRILGFYDRQQ
Ga0255813_11410482Ga0255813_114104823F004001VAQLPREVVGSPSLEVFKNHGDVDSRHGGDGLMVGRGDLRGLFQL
Ga0255813_11412495Ga0255813_114124955F005658MAWGEKDHNDHLVSTPCYVQGHQPPDQAAQSHIQPGLECLQGWGIHSLLG
Ga0255813_11417509Ga0255813_114175093F068298VEWAVQRGGGVTEPGGVQRAFGCCVEGYGLVRTIGEG
Ga0255813_11419843Ga0255813_114198431F104139KPLNEVWEEVYPGSTPSSCSGALHAAELPWVGPAFPPGAPSLVQPVT
Ga0255813_11423377Ga0255813_114233771F005658MAWVEKEHSAHPVPTPCYVQGGQPAAQAAQSHIQPGLECLQGWGIHSLLGQPM
Ga0255813_11425818Ga0255813_1142581810F096316MAWVAKDHNAPPVPTPCYVQGRQPAAQAAQSHIQPGLECLQGWGTHSLLGQPVQCVT
Ga0255813_11427997Ga0255813_114279971F005658MAWVEKDHNAHPVPTPCYVQGRQPAAQATQSHSQPGLECLQGWGIHSLLG
Ga0255813_11429281Ga0255813_114292811F001813VQGKYGRCDEGHRLVRTTGDGWVVGLRDPVGLFQP
Ga0255813_11433089Ga0255813_114330897F038012MIIEFQPPCYVQGRQPPDRAAQSHIQPGLECLQGWGI
Ga0255813_11434216Ga0255813_114342165F001813VQGTFGHCVEGCGIMRTIDDGWMVGLGDPVGLFRPW
Ga0255813_11437212Ga0255813_114372122F000010VQEVLSDIAHTNSCHLLLRLAWLHFKTLNLDKGSLYLRHEGHEMKLKFMTPRQASKDQHRLKEKIEKEEI
Ga0255813_11437212Ga0255813_114372123F009316MEKLQLATSFHSNQARMKFSTGQCVKEVLCDIAPMNSCHLVLRWEWLNFKTLNLDERSLY
Ga0255813_11437516Ga0255813_114375161F068298VEWATQRGGGVTDPGGVQGTFGHCVEGHGLVRTIGDGWM
Ga0255813_11439828Ga0255813_114398281F027437MARQIPVLEEKHSQGQAELVQRCSDFEEKYSQSQTELAQVSAALNDAKTLNSTLCAQLDSEKV
Ga0255813_11439828Ga0255813_114398282F062643GSPPHTGCIVVAQALGQGVALEASVPADQVLGSVDGIELVPAGLLQAASGGGLTPGYQLISPDLGIPSFFSNLQVL
Ga0255813_11441980Ga0255813_114419801F033854MAAEGQSDKMASDMEVWMKPRCVTEFLHAEEVACIEVNQCLLNIYADQTVDACTVRQ
Ga0255813_11442218Ga0255813_1144221812F005658MAWVEKDHNARLISTPCYVQGHQPAAQAAQSHIQPGLECLQGWGIHSLLG
Ga0255813_11442506Ga0255813_114425061F046965LRNENASLIAKVDSNVCDASIPNLRDDNVKLLAKIEELNISLASLRLENENLIAKAKDFDVCKVAIANLRDKNDILRAKIVELNSCKPSTSTIEHVTICTRCRNVDIDAIHDHMALIKQQNDHIAKLDAKIAEHNLENEKFKFARSMLYNGRRPGIKDGIGFQRGDNVKINAPPKNLSNFVKGKAPMPQDNEGYILYTAGYPESKIRRIHSRKSYSGPNHAFMYKGETSSSRQPTRAKLP
Ga0255813_11443051Ga0255813_114430512F068298QALEWAAQRGGGVTDPGGVQGTFGCCVEGHGLVRSIGDG
Ga0255813_11443428Ga0255813_114434281F105149MLRKMFQGGSSKKQGPRLAMCDADEEPPRDAPVRPCEWPSENFMDRAGIKEEFNAYLRNADLVSFEEEKCSQYHNLTSTFVRRFEFSSSRNSPTVLLDLYENSYTMDLEDFNTACKLPQWGSTSEPRKSEFRDFLDSITVVESRDITQATIGSIHFPAIHYFALIIGRCINGKDEAC
Ga0255813_11444314Ga0255813_114443144F005658MAWVEKDHNDHPVPTACCVQGRQPADQAAQSHIQPGLERLQGWG
Ga0255813_11447085Ga0255813_114470851F028669MYTRREIKKQRFKRWSDQFITNVNKGDGERGGRTLLRIGVMGKGRRAIEKIERGKNCVKR
Ga0255813_11450170Ga0255813_114501702F007510TVYGVMKSQTRLSDFTLTFHFHALEEEMATHSSTLAWEIPWMEKPGRLQSMGS
Ga0255813_11454161Ga0255813_114541611F038489MAWVEKDHNDHLISTPCYVQGRQPAAQAAQSHIQP
Ga0255813_11454427Ga0255813_114544272F001813PGGVQGTFGRYVEGHGLMRTIGDGWMVGLDDPVGLFQPL
Ga0255813_11454562Ga0255813_114545623F096316MALVEKDHNDHLVPTPCYVQGRQPADQAAQSHIQPGFECLQGWGIHSLLGQPVQCVTTLWVKNFLLISNL
Ga0255813_11455620Ga0255813_1145562016F001813GGVTEPGGVQRAFGCCVEGHGLARTIGEGQMVGLDDPVGLFQP
Ga0255813_11462447Ga0255813_114624471F001813GGVTDPGGVQGTFGCCVEGHGLVRTIGDGWMVGLGDPGGLFQP
Ga0255813_11462838Ga0255813_114628382F033854MAAEGQFDKMVSGVIMCMKERYVIEFRHAEKMAPINIHQHLLNVYGDQTVDVSTVRT
Ga0255813_11466332Ga0255813_114663326F001813GGGVTDPGGVQGTFGHCVEGHGLVRTIGVGWMVGRGDPVGLFQPW
Ga0255813_11467550Ga0255813_114675501F001813NPGGVQGTFGHCVEGRGLMRTVADGWMGGLDDPVGLLHPW
Ga0255813_11468884Ga0255813_114688841F001813MRYYVPGGVQGTFGCCVEGHGLMTTIGDGWMVGLGDPVGLFQPW
Ga0255813_11470791Ga0255813_114707914F096316MAWVEKDLSAHLVSTLCYVLGHQPPEQAAQSHIQPGLECLQGWGIHSLLGQPVQCVTTL
Ga0255813_11474609Ga0255813_114746096F004001ESPSLEVFKKRVDVALRDTVSGHGGDGLTGGLADISGLFQS
Ga0255813_11477032Ga0255813_114770327F004001MEVVESPSLEVSKNRVDVALRDVVSGHGGDGLVVGLGDLRGLLQP
Ga0255813_11478182Ga0255813_114781821F011632AAQRGGGVTNPGGVQRAFGRCVEGRGLARTIGDGWMVGLDDPVGLFQP
Ga0255813_11486114Ga0255813_114861146F011632QALEWAAQRGGGVTDPGGVQRAFGCCVEGHGLARTIGEGQMVGLDDPVGLFQP
Ga0255813_11490674Ga0255813_114906745F001813VTDPGGVQGMFGCCVEGHGLMRTIGDGWMVGLGDHVGLFQPW
Ga0255813_11491078Ga0255813_114910781F032472GFDTDIGAFIESSSVSSPIGLMASSINNDAVLGETFLPGQIFIFGGFALRANSLGHLEQIESYAPGCQVRFGSLNFTADIRGDLNFDGSELQPSVSRCHDGHDLTLPPDSTLEAAHESAPTHSPEPIAQIEDGWLDTASGAANSTAMEPNTYLVPHKAHDSEVSDSLPDSEPPAPLPVETDWAPIMEF
Ga0255813_11493153Ga0255813_114931532F038084VLWYSHVFQNFPQFIVIHTVKGFGIVNKAEIDASLELSCFSHDPADVGNLISGSSAFSKTRLNTWKFMVQVLLKPGLENFEHYFAS
Ga0255813_11495993Ga0255813_114959931F032472GTQYSGRLNCGPTKLTGMEGEEVDIGAFIESSSESSPLGLMAPTIINSDAVQGETFLPGQIFVFGGFALRANSLGHLEQIDSYAPGRQVRFGSLNYMADIRGDLIFDGFEPLPSAPHCHDEHDLALPPNSALEAAPASASTLNSEPTAPIEDGWLDAASGAAIPTAIEPNTSPALCETRDSKEPDSSPDSEPSAPLPIESDWAPIMEFTAADIFQHSPFGDILKTLKSLSLSGEPWPDYSQQGWDSNDEEIQSPP
Ga0255813_11496508Ga0255813_114965081F011632AQRGGGVTEPGGVQRAFGCCVEGHGLARTIGEGRMVGLDNPVGLFQPW
Ga0255813_11505794Ga0255813_115057943F038012MIIEFQPPCDVQGRQPADQAAPSHIQPGLECLQGWGIHSLLGQPVQCVTTL
Ga0255813_11510580Ga0255813_115105801F034461MLDYDFEIIYKKGKQNVASDALSRKDEDVESLLCAISIIQLEWITKEMDEWMNDEEAWTL
Ga0255813_11510869Ga0255813_115108693F001813MALEWAAQGGGGVTDPGGVQGTFGRCVEGCGLVRTTGDGQMVGLGDPVGLFQPW
Ga0255813_11518418Ga0255813_115184183F096316MARVEKDHNDHLLSTPCYVQGHQPAAPAAQSQIQPGLEYLQGWGIHSLLGQPVQCVTTLC
Ga0255813_11520522Ga0255813_115205221F092835VLNPKERLRDGNQTSQFLPILARFVDYYSLFWGPGVISTINEPWGAFTCRSSTLTVLDDSGSFHELLLTFTAVLQLCFSL
Ga0255813_11521254Ga0255813_115212542F001813VTDPGGVRRAFGCCVEGRGLVGTIGEGRMVGLDDAVGLFQP
Ga0255813_11525103Ga0255813_115251031F001813VTDPGGVQGTFGRCVEGYSLVRTIGDGWMVGLGDPMGLFQP
Ga0255813_11525338Ga0255813_115253381F034384VETGLDPINSLVKDEAAMNVLRLESRVAGVVDYLARLKVAASRIDTTLWPGETLQNDLESLMTRLNEVPGRVQEWKKSSARCGADVALSLVRVHCKDMREDKLASLKVANTKKHDFQSFMETIIAAATWIADGIDLDEFVEPASP
Ga0255813_11526561Ga0255813_115265611F007409MSQEKEVAAGVKLSLSVEKNLGFLESIAKTNTEKITREILEGLSEDTGDSDSYDMESGGEDSEDRPWRPSHTVFGKSTIKQSHLDNMRG
Ga0255813_11526856Ga0255813_115268561F007510AVHGVAESQTRLSDFTFTFHFHALEKEMATHSSVLAWRIPGTGEPGGRPSMGSHRGGHD
Ga0255813_11527524Ga0255813_115275242F004001VESPSLQVFMKHVDMALRDIGHGGDGQMVGPDDLSGLFQP
Ga0255813_11527871Ga0255813_115278713F028669MYARRKIKKQRFKCWSDQFITNVNKGDGERGGRTLLRIGVMGKGRRAIEKIE
Ga0255813_11528315Ga0255813_115283151F005658MAWVEKTHNAHPVPTPCYVQGRQPAAQAAQSHIQPGLECLQG
Ga0255813_11529117Ga0255813_115291173F028669MYVRREIKKQRFKCWSDQFITNVNKGDGERGGRTLLRIGVMGKGRRAIEKIE
Ga0255813_11529955Ga0255813_115299557F005658MAWVEKDHNAHPAPTPCYVQGRQPAAQAAQSHIQPGLECLQGWGIH
Ga0255813_11531579Ga0255813_115315791F032472GQIFVFGGFALRANSFGHLEQIESYAPGCQVRFGSLNFTADIHGDLIFDGFEPQPSAPHCHDGHDLALQPDSALEAAHESAPTLNSEPAAQIEDGWLDTASGAATSTTIEPNTDLVPHEARDSEVSDSSPDSEPPAPPPIESDWAPIMEFTAADIFSH
Ga0255813_11531680Ga0255813_115316801F028669MYARREIKKNRFKCWSDQFITNVNKGDGERGGRTLLRIGVMGKGRRAIEKIGRSKNCVKW
Ga0255813_11532889Ga0255813_115328893F038012MTISFQPPCYVQGHQPADQAAQSHIQPGLECLQGWGIH
Ga0255813_11534319Ga0255813_115343191F004815SLQAFKARLDVALGSLGCWLATLHIAGGWNWMSTVVLFNTGHSRILEF
Ga0255813_11542302Ga0255813_115423024F011632LLSLGLKCWAAQRGGGVTESGGVQRAFGCCGKGRGLAGTIGEGRMVGLDDPMGLFQP
Ga0255813_11543606Ga0255813_115436061F099086TKASPGPQPKGDDEIKKMAKAIMDEVVDRLLNEAAEVVLRED
Ga0255813_11545548Ga0255813_115455481F005658MAWFEKDHSDHPVPTPCYVQGRQPAAQAAQSHIQPGLECLQGWGIHSLLG
Ga0255813_11550791Ga0255813_1155079113F005658MAWVEKDHNAHPVPTPCYVQGRQPPAQAAQSHIQPGLECLQGWGIH
Ga0255813_11556094Ga0255813_115560941F011632LLXKGGQALEWAAQRGGGVSEPGGVQRAFGCCVEGHGLARTIGEGXMVGLEDPVGLFQP
Ga0255813_11558623Ga0255813_115586232F001813TEPGGVQRMFGCCAEGHGLVRTIGGGXMVGLDDPVGLFQP
Ga0255813_11558634Ga0255813_115586341F005658MAWVEKDHSAHPIPTPCYVQGRQPADQAAQSHIQPGPECLQ
Ga0255813_11558741Ga0255813_115587411F001445EKEMATHSSILGWRIPGLGEPGRLPSMGSHRVGHD
Ga0255813_11565919Ga0255813_115659191F001813TGPGGVQRTFGCCVEGHGLARTVGDGWMVGLHDPVGLFQPW
Ga0255813_11570746Ga0255813_115707461F002471CHDSISSLKSINDDLNAKLEIANKSTSCVEHVVVCNRCKDFNVDACSEHLVSISKLKDEVASLNAQLKTSKSEFDKLKFARDAYTIGRHPSIKDGLGFKRETKNLTSHKAPISAKEKGKAPMTNSSQKNHAFIYGDKRYSRNVRYDRSCNAYDSNAMFASSSSYVHGRDMPRRNVIHHVPRRNVYVPRKINEPSTIYHACNASFAICRKDRKIVARKLGARCKGDKTCIWVPKDICANLAGPNMSW
Ga0255813_11573789Ga0255813_115737891F014346VVLEKTLESPLDCKDIQPVHFKGDQPWVFFGRNDVKAETPVVW
Ga0255813_11578792Ga0255813_115787923F038012MVIEFQPPCYVQGRQPPDQAAQSHIQPGPECLQGWGIYNLLGQPVPVRH
Ga0255813_11586045Ga0255813_115860451F011632SRRGGGVTEPGGVQRAFGCYVQRHGLARTMGEGRMVGLGDPVGLFQP
Ga0255813_11587881Ga0255813_115878811F035626MAPSIISNDVVQDEVFLPRQILVFGGFALRANSLGHLEQIESYAPGRQVRFGSLNFTANVRGDLIFDGLEPQPSAPHCDDGHDLAQPPNSALVAAHESASAISPEPIAQIEDRWLDTASGAAPSAVMEPNTDVVPDRAHASEV
Ga0255813_11589760Ga0255813_115897601F004001LSLEVFRKCVGVALRVVVSGHGCDELMVGLDDLSGRFQP
Ga0255813_11591633Ga0255813_115916331F082256NRAITISCKNPVYVDTLPRWINLHRRASSNMEKIKASFANVGAYSTEENFIRGDPEGVIEWISGEAESFEEILSDRGDVCAFSGARGISTILEKARCDHIKTMAQAEAAFSADDTKDPSAEATLMGGKFYNDVWMNGGREMAHEIIKKSEKDTHDARIEARQAEEAAEREKRIGNIF
Ga0255813_11596108Ga0255813_115961081F020828LDAVEFYRAQEGSSTEKLFWSQYTGTEHPVPFRDQLKQLGELHKAAEQAMKGLIVRLWPKEAIPWSYFGLVRRLVDACPRLEVIKRSVCIEGARRAFARVKTQWVKLDAVKLIKEGPPQGKEHRTPEIYYEGVLKGAHLVADECTKDIIFE
Ga0255813_11597337Ga0255813_115973371F020289MTEDEMVGWHHRVNGREFEQAPGYGDGQGSRTCCSPYSHKEL
Ga0255813_11605590Ga0255813_116055901F027342MQSKHVKVNYLLLTRIWSSPGAFADLPRSVSDAAAFYRAEEGSSMEKVFWSQYAEAEHPVPLSDQLKQLVEFHKVAEQAMKGLIGRLWPGEVMPGSYFWLVRQLVDACPWLEIIKRSVCIEGARRALACVKVQLGKMDAEKLVTDGPPEGKEHRKPENYYKDVLAGARLMADECTKDVIF
Ga0255813_11606613Ga0255813_116066134F038489MAWVEKDHNAHPVSTPCYVQGRQPPDQAAQSHIQPGLECLQGWGIH
Ga0255813_11606895Ga0255813_116068952F038084VGRYSLLLKNFPQFVVIHTVKGFSDKSYVDILEFSCFFDDPMDVGNLIYDSPAFSESSLNIWKFMVHILLKPGLENFEHYFASV
Ga0255813_11608055Ga0255813_116080552F002002MAQTVKNLPALWETWVQFLGRGDHLEKGMATQSSILAWRIPRTEEPGRLQSMRLQRVGHD
Ga0255813_11613452Ga0255813_116134524F038012MTIQFQPPHYKQGHQPPDQAAQSHIQPGLECLQEWSI
Ga0255813_11614698Ga0255813_116146981F028669MYAQREIKKQRFKCWSDQFITNVNKEDEERGGRTLLRTGVMGKGRRAIEKTE
Ga0255813_11615887Ga0255813_116158871F006329MILELHVADVIDDHKIKMDAMHLKIRKIRKYAIHTEAWYHYAVVSVVTLVAIMIAFVFALKCFT
Ga0255813_11616724Ga0255813_116167243F004001LYIRKHLRVVLQWHGLSREVVDSPSLEVFQNCVDVALRDVVSEHGGDGLMVGLGDLSGLFQR
Ga0255813_11617699Ga0255813_116176993F001813AAQRGGGVTNPGGVQGAFGHCVEGRGLARTIGDGWMVGLGDSVGLFQPW
Ga0255813_11624594Ga0255813_116245941F038489MAXVENDHSDHPVSTMCYVQGRQPPDQAAQSHIQPGLECLQGW
Ga0255813_11626058Ga0255813_116260586F038489MAWVEKDHSAHLVSTPRYVRGRQPPDQAAQSHIQPGLECLQGW
Ga0255813_11628746Ga0255813_116287463F038489MAWVEKDHNDHVVSTPCYVQGCQPPEQAAQSHIQPGLECLQGWGIH
Ga0255813_11632550Ga0255813_116325502F001813PGGVQRAFGCCVEGHGLARTIGDGRMVGLDDPVGLFQP
Ga0255813_11632838Ga0255813_116328381F079404YPSGTPKKASEDWPLEWFYMEDAPLPDPVWISFPEFSNAPLKKRLSWRPWSPQREDDGSVHYLMGRIRLLAHSGLTMIGVMATCIMRGVQPLQYRGHPMWDFNGENDATRHGRKGPGSAADLVKILSGLYKGEKEDFLRTSPLNGFSMNNPRSWVSGRLSIRSIFPKSSALLCDFDAGAASGRGGHTKPDSTA
Ga0255813_11634211Ga0255813_116342111F005658MAWVAKEHSAHPVPTPCYVQGRQPAAQAAQSHIQPGLECLQGWGIH
Ga0255813_11639074Ga0255813_116390741F079778SCFQKIEIDDFRKQLAEAKEKCAVAKAKRGISENWANHLEKNVEELRTSKERCFEKSMDCVKKIKTSFANVGAYSSEENFIQGNPLGVNEWLSGEAEAFEEILSDRGDVCVFSGARGVAAILEKAGCEHMKILAQDEATFSVGDTKDLSAEASLIGIKFFTDI
Ga0255813_11639947Ga0255813_116399472F011632QALEWAAQRGGGVTKPGGVQRVFGCCVEGHGLVRTTGDGWMVGLDDPVGLFQP
Ga0255813_11644365Ga0255813_116443652F002654SEGQXXMLNYQTFNDKVVCQKGNSPVQVFKVPKFLLCESKEVFKLYTQEIGLEAAIF
Ga0255813_11649385Ga0255813_116493851F011632SSRGGGVTEPGGVQRAFGCCVEGHGLARTFGEGRTVGLDDSVGLFQT
Ga0255813_11650749Ga0255813_116507491F004001PSLEVFKNRVDVVLKDRFSGHVGSGLVVGLDDLSGLFQPQWRFL
Ga0255813_11650977Ga0255813_116509779F005658MAWVEKDHNDHPVPTPCYVQGHQPADQAAQSHIQPGLECLQG
Ga0255813_11652833Ga0255813_116528334F004815SLQAFKARLDVALGSLVCWLVTLHIAGGWNEMVIVVLFNQGHSIIL
Ga0255813_11654227Ga0255813_116542271F001813GGGGVTEPGGVQRACGCCGGGRGLVRTIGEGRMVGLDDPVGLFQP
Ga0255813_11655566Ga0255813_116555662F004815SLQAFKARLDVALGSLGCWLVTLHIAGSWNEMVVVILFNPGHSVLCTSKEN
Ga0255813_11656611Ga0255813_116566111F038012MTIKFQPPCYVQGRQPPDQAAQRHIQPGLECLQGWGIHNLLGQPVPACHHPVKYILKFLLKT
Ga0255813_11658542Ga0255813_116585422F005658MAWVEKDHNDHPVPTPCYVQGRQPADQAAQSHIQPGLECLQGWGI
Ga0255813_11658566Ga0255813_116585661F005658MAWVEKNHNDYPVPTPCYVQGRQPADQAAQSHIQPGLECLQGW
Ga0255813_11661193Ga0255813_116611931F005658MAWVEKDHSAHPVPTPCYVQGRQPAAQAAQSHIQPGLECLQGW
Ga0255813_11662974Ga0255813_116629741F038489MAWVEKAHNDHPVSTPCYVQGHQPPDQAAQSHIQPGLE
Ga0255813_11664893Ga0255813_116648932F004001VESPSLEVFKNHGNVALRDMVSGLVGTVGLLVGLDDFRGLFQPL
Ga0255813_11668108Ga0255813_116681081F002002VLQMVKNLPAMQETRVQSLGQEDPLEKGMEIHSGILACRIPWTEEPAGLQSIGSQRVGHY
Ga0255813_11668165Ga0255813_116681651F052316MVKTRYTKADPNHMAEVGPVGPDGKEIPVSLMYSQVELAAKYSQRDCKLDSLLDGIEEEFNQSI
Ga0255813_11670918Ga0255813_116709181F032472IFGGFALRANSLGHLEQIESYAHGHQVRFGSLNYTTDVRGDLIFDGFEPQPSAPHCHDGHDLALLSDSTLEAAHESAPTLDSEPAVQIEDEWLDTASGAVTSTEIEPNTDFVPSEARDSKVPDSLPDSEPPAPPLIESYRASIIEFTAADIFQHSSFGDVLSSLKHLSLSGEPRLDYGQAGWDVDDETQSPPT
Ga0255813_11676192Ga0255813_116761923F004815FKARLDVALGSLGCWLATLHIAGGWNWMSIVGLFNPGHSVIL
Ga0255813_11676876Ga0255813_116768764F004001MVESPSLEVFKSCVDVALRDMVSRHGGDELTIGLDDLSDLFQL
Ga0255813_11676893Ga0255813_116768936F004815SLQAFKARLDVALGSLGCWLATLHIAGGWNWMSIVVLFNPGHSMIL
Ga0255813_11677097Ga0255813_116770971F033854VTAAEGQSDKLAYDTEVHMKQRHVIEFLHAEKVAPSDINQCLLNVDGDQTVNVSTVRQGVVCFSSGNSDSG
Ga0255813_11678640Ga0255813_116786401F039980MFEEVNSCLQEEKRALVASRDKLYRDSSNSLTILERSHRFTMEELDNHRRKLQESTDDVIRLRQLISAKDAAIKELRASKKSIAQELETAQLAVKVAEETSVTLRAQRDRAMDKAIRAGRILMRRPGVVVPEDIRAAVT
Ga0255813_11679951Ga0255813_116799511F005658MAWVEKDHSAHPVPTPCYVQGRQPAAQAAQSHIQPGLECLQG
Ga0255813_11680177Ga0255813_116801773F011632ALEGAAERGGGVTEPGGVQRAFGCCVGRHGLVKTIGEGRMVGLGDPVGLFQP
Ga0255813_11683287Ga0255813_116832872F028669MYARREIKKQRFKCWSDQFITNVNKGDEERGGRTLLRIGVMGKGRLAIEKIERGKNCIKR
Ga0255813_11692750Ga0255813_116927501F011632GQALEWAAQRGGGVTDPHGVQRAFGCCVEGHGLTRTIGEGRMVGLDDPVGLFQP
Ga0255813_11693448Ga0255813_116934481F011632GQALEWAAQRGGRVTKPGGVQRAFGCCVEGHGLARTTGDGRVVGLDDPVGLFQP
Ga0255813_11695398Ga0255813_116953987F004815SLQAFKARLDVALSSLGWWLATLHIAGGWNWMSTVVLFHPGHSVILRFCEV
Ga0255813_11697497Ga0255813_116974973F001813GVTDPGGVQGTFGRCVEGHGLMRTIGDGWMVGLDDPVGLFQLW
Ga0255813_11698800Ga0255813_116988001F015450MLLSKALKMQQDLEDKKHEAIIENLESKIKEQSAIIEKKDFELQSTEGLLAETEAKILELNSKLINQSKQFDQEKLELNSKLKAEVQTSSELKKALTSLQDKCLNFGNNCIGRLKKIFYSVGASSVKFNPSAENLPQAFDHIEAEIEELDEVIAGHGDFCAWVASRGTAAAFLKAGCEHGKVVNRPNFTLSSSILDDMPDLARSISNRFIKMVWTKGGREKAGDEARSHLEPVRNDISCLPFPLGLILMIP
Ga0255813_11699957Ga0255813_116999572F011632VWAAQRGGGVTDPGSVQRTFACCVEGHSLARHSLARTTGDGQMVGLDDPFGLF
Ga0255813_11700695Ga0255813_117006958F011632MQLYKYYFSERVGQALEWAAQRGVGVTEPGGVQRAFGCCVEGHGLARTIGEGRMVGLDDPVGLFQP
Ga0255813_11702937Ga0255813_117029371F005658MAWVEKDHCDHGVPTPCYVQGRQPADQAAQSHIQPGLECLQGW
Ga0255813_11706737Ga0255813_117067371F001813GVIDSGGVQRVFGCCVEGHGLARTIGEGRMVGLDDPVGLFQP
Ga0255813_11710671Ga0255813_117106711F079404IGLPEFSNAPLKKRLSWRPRSPRREDDSSVHYLMGRIRLLAHSGLTMIVVMATCIMRGMQPLQYSGHPMWDFNGDDNATRHGRKGPGSADDLVKILSGLYKGEKEDFLRTNPLNRFSMNNPRSWVSGRMHI
Ga0255813_11711085Ga0255813_117110852F034384EPGLDPSNSPVKDETAMNLLRLESRIDGAVDYLTRLKVAMSRIDPALWPEAVLQNDLESLMTRLNEIPDRVQERKKSAARCGADVALSLVRVHCKEVRQDKLAAIKVANTQKHDFRTFMETFIAAATRIADGVDLDEFVEPASPPPAE
Ga0255813_11711751Ga0255813_117117511F011632GGGVTNPGGVQRAFGCCVEGHGLARTIGEGRMVGLDEPVGLFPTLAIL
Ga0255813_11712867Ga0255813_117128671F046965LTKELSICHDTISNLRTENVSLIAKVEKSNVCHDSIANLRNENASLIAKIDKLNESISSLRTENASLNSKVKDLNVCNDSISYLRDENAILHAKIDELNACKPSTSTVSHVSICTRCRDVNVDAIHDHIAMIKQQNDHIAKLDAKIAEHELENGKFKFSRSMLYNGTRPRIKDGIGFQQGGNVKLNAPKKLSNFVKGKAPMVQDNKGNILYPDGYSEHKIR
Ga0255813_11716927Ga0255813_117169271F001813VVTDPGGVQGMFGCCVEGHGLMRTIGDGWVVGLGDPVGLFQPW
Ga0255813_11719492Ga0255813_117194922F038084MWVWYSHLFKNFPQCVVIHTVKGSSVVTEADVFMEFSCFFHDPVDVGNLISGSSDICKSSLNIWKYMVHVLLKPCL
Ga0255813_11721791Ga0255813_117217911F005658MSWIEKDHSAHPVPTPCYVQGRQPADQAAQSHIQPGLECLQG
Ga0255813_11721968Ga0255813_117219681F011632ILLLXKGGQALEWAAQRGGGVTEPGGVQRAFGCCVEGHGLAGTIDEGRMVGLGDPVGLFQ
Ga0255813_11727925Ga0255813_117279251F051600LEKEMATHSSTPAWKIPWTEKPGRLQSMGSQRAGHD
Ga0255813_11729013Ga0255813_117290131F002471HPSIKDGLGFKRGVKNLTSHKASISAKEKGKAPMANSAQKNHAFIYDRKFSRNVHHDRSCNAYDSNAMFASSSSYVHGRDMPRKNVIHHMPRRNVVHVPRKASNEPSTIYHACNASFAICRKDKKVIARKLGAKCKGDKTCIWVPKTIVTNLVGPNTSWVPKTQA
Ga0255813_11729698Ga0255813_117296981F038985MPKKHHLGPQNGSGSLGPEILPKIVNCATIKETKKLKETMVGVQVE
Ga0255813_11729948Ga0255813_117299483F028669MYTRHEIKKQRFKCWSDQFITNVNKADEERGGRTLLQIGVMGKGRKAIEKIERRSKESS
Ga0255813_11734235Ga0255813_117342351F059631WFYITELRDPKWAAAPEFRSSTPMQLTSWKEKGLLWGSSEELTGLQSCLQTLVNKKLKLVNVIQVMLVRRILPYQQRAFNRWEFDPAKHRTLSGLFDTMYEAAWRVLFKGGEAPASATEDRGFSTKRPAGEVSFVILYGTVVFFHSLTLCGI
Ga0255813_11736000Ga0255813_117360002F096317VNKQASLLAATAATAKVSELRQNLGWAEEELGLVKRQLKENKGKQYPV
Ga0255813_11743679Ga0255813_117436791F027342KRLLLLTRIWSSPGAFVDLSRSISDAAEFYQAEDGGSTEKLFWSQYIGTEHPMPLSDQLKQLVELHKAAKQAMRGFIVRMWPGDALPNSYFGLVRRLVDACPWLEVIKRSVCIKGARRAFARAKVHWAKMDADKLVKEGPPQGKEHRHPEMYYEGVLKGARLVADECAKDVIFE
Ga0255813_11749349Ga0255813_117493491F011632KGGQALEWAAQRGGGVTEPGGVQRAFGCCVEGHGLVRTIDEGRMVGLDDPVGLFQP
Ga0255813_11751485Ga0255813_117514851F001813QRGGGVTEPGGVQRAFGCCVEGHGLARTIGEGRMVGLDDPVGLFQP
Ga0255813_11753196Ga0255813_117531961F001813QRGGGVTEPGGVQRAFGCCVEGRGLARTIGEGWMVGLDDPVGLFQP
Ga0255813_11754314Ga0255813_117543141F001813QRGGGVTNPGGVQGMFGCCVEGHGLVRTIGDGWMVGLGNTVGLFQP
Ga0255813_11755259Ga0255813_117552591F052316AMVKTRYTKLDPNHMAEVGPTGPDGQEIPVSLVYDQVALAAKYSQQDCKLDSLLDGIEEEYSQSK
Ga0255813_11755282Ga0255813_117552821F096316MAWVEKDHNDDLVSTPCYVQGRQPADQAAQSHIQPGLECLQGWGIHSLLGQPVPN
Ga0255813_11757415Ga0255813_117574152F028669MHTWREIKKQQSRCWSDQFITNVSKGDGERGGWTLLWIGVTRKGRKAIEKTENRSKDYKL
Ga0255813_11758059Ga0255813_117580591F035108MSVGLLTGRPAEEMPGSSGDLLPELLQLHERVRQAMQSVIQAMWPSLSVPEGLEELTKKLEGVRQRFRLWKISACRQGAREAWAMVKTRYMKADPNHMAEVGPIGPYGKEIPVSLAYGQVELAEKYSQQDC
Ga0255813_11759388Ga0255813_117593884F033854MAAEGQSDKMASDMDVQMKQRCVTQFLHVGKMEPTDFHRHLLNVSGEQYHGLVCLFTH
Ga0255813_11761601Ga0255813_117616011F004001VGHWNELSREVVESLSLKVFKNCVVVALMDVGSGHGGCRLMVGLDGLRGLFQP
Ga0255813_11767727Ga0255813_117677272F020492MGLQAVLLTSAALPAEVKTLKENLERSENELGHAKKQLEEKEGE
Ga0255813_11768275Ga0255813_117682754F011632GQALEWAAQRGGGVTEPGGVQRAFGSCVEGHDLVRTIGEGRMVGLDDPVGLFQP
Ga0255813_11768461Ga0255813_117684612F105149KQGPRSAICEPDHEPPREAQVRPCEWPSEDFMDQAGIKEEFNAYVRKADLVSFEADKCRQYHYLTDSFVRRFEFSSSRNSQIVLFDLYENSYTMDLEDFNTACKLPQWGSPSEPRNSEFRDFLASITVGESRDIAQATIGSIHFPIKRAK
Ga0255813_11774578Ga0255813_117745782F004001MLLSEEVFKKRADITLRDGVSGHSGDGLMAGLDDLSGLFQP
Ga0255813_11776459Ga0255813_117764592F038012MIIEFQPPCYVQGHQPPDQATQNHIQPGLECLQGWGIHNFLGQPVPV
Ga0255813_11777203Ga0255813_117772031F011632EWAAQRGGGVTEPEGLQRTFGHCVEGHGLMRTIGEGRMVGLDDPVGLFQP
Ga0255813_11782794Ga0255813_117827944F005658MARVEKNHNAHVVPTPCYVQGRQPPAQAAQSHIQPGLECLQGWGIHSLLG
Ga0255813_11784168Ga0255813_117841684F004001VAQAAHVEVESPSLEVFKNCVDVALRNLVSGHGKDGLAVGLDELSALFQP
Ga0255813_11793534Ga0255813_117935341F028669MYARCEIKKQRFKCWSNQFITNVNKGDEERGGGTLLQTEVMGKGRRVTEKIERSKNCVKR
Ga0255813_11796781Ga0255813_117967815F004001VKPPSLGVFKKHGDVALRNMVSGPGGDGLMVGLGDLRGLFQP
Ga0255813_11798251Ga0255813_117982511F011632AQRGGGVTNPGGVQRAFGCCVEGHGLARTIGEGQMVGLEDPVGPFQP
Ga0255813_11804865Ga0255813_118048652F086390MCVPDLSILRSAVLGDKSYNLGAIVARRLHLNRFNGDFFGGIYATRIANFLGIAIHEDDIELPPAYLDFIAVHHQFVERNESPLRYRLIFDRRRAVRITLPAPAFFDYQAKGRYVITREEADEYERRAEAACRHAAAQEAIAAASQYDPNYYYGYPPGQPWP
Ga0255813_11806227Ga0255813_118062272F028669MYDQREIKKQRFKCWSDQFITNVNKADEERGGRTLLRIGVMGKGRRVIEKIERGKNCVKQ
Ga0255813_11811969Ga0255813_118119691F059631NVTWLEGAFVETIKGWQSGWFYITEPRDSEWAAAPEFRSGIPTRLTSWKETGLSWGNSAEVTGVQTCIKDLIGRKVKLVTVVQVMLFRRILPCQRRAFNLWEFDSAQHQTLSRLFDTKHEDAWKVLFKGSEVSPPVTEDRGFCAKRQASAVS
Ga0255813_11812191Ga0255813_118121911F104139MQQSPSRHLCLHCQPLNEVWEGVDPGSTSSGQPGTTYAPELPWVVPALLPGAQSLVQAVS
Ga0255813_11812485Ga0255813_118124856F038012MIIEFQPPCYVQGRQPPDQAAQSHIQPGLECLQGWGIH
Ga0255813_11814895Ga0255813_118148953F005658MAWVAKEHNAHPVPTPCYVQGRQPAAQAAQSHIQPGLECLQGWGIH
Ga0255813_11823149Ga0255813_118231491F028669MYAWRETKKQRFKCWSQFITNVNKGDEERGGRTLLRIGVMGKGRRAIEKIERSKNCVKRG
Ga0255813_11824830Ga0255813_118248301F018877SQISVKNFPPIKDPSAEASIIGGKFFTDIWDNGGREMAGEIIRRSEKGIHDAREVAEAAKKSAEAEGQLGIN
Ga0255813_11824830Ga0255813_118248302F099086MICNSKVAVSCPSSDPTEVSPGARPRGDDEIKKMAEAIMDEVVDRLLNEAAEVVLRED
Ga0255813_11824872Ga0255813_118248721F002002MVKRLSKMQEMGVRSMGQEDPLEKEMTPHSRILPKKIPWTEKPGRLQSMGCQRVGHN
Ga0255813_11832434Ga0255813_118324341F001813VPGGVQRAFVCCVEGHGLASTIGEGRMVGLGDPVGLFQP
Ga0255813_11833404Ga0255813_118334041F033854MAAEGQSDKMVCDMEVRVKQRCVAEFLHAETMALNDIHQCLLNIY
Ga0255813_11833969Ga0255813_118339691F001813GGVSDPGGVQGTFGCCVEGCGLVRTVGDGWMVGLGDPVGLFQPW
Ga0255813_11840228Ga0255813_118402281F005658MAWVEKYHSAHPVPTPCCVQGHQPAAQAAQSHIQPGLECLQGWGIH
Ga0255813_11856295Ga0255813_118562951F014346NPLHCQELQPVHPKDDKSLFIGRTDDDAETPILLPPDAKSWLI
Ga0255813_11861795Ga0255813_118617951F035626MAPSIVDSDAVQGETFLPEQIFVFGGFVLRANSLGHLEQVDSYAPGHQGRFGSLNYVADIRGDLIFAGFETAATTLGHPDEHDLNLSLDRIQETTPV
Ga0255813_11862333Ga0255813_118623333F001813PGGVQGTFGCCVEGHGLVRTIGEGWMVGLGDPVGLFQP
Ga0255813_11863044Ga0255813_118630441F065766MAEEKKDKGARDPIKILLEEALVKQRNAMMDNFAHSLQPSP
Ga0255813_11863716Ga0255813_118637162F004001LEVFKKCVDVVLRDLVSERGGNGLMVGLDDLRGLFQLL
Ga0255813_11864718Ga0255813_118647181F033854MAAEEQSDKMASDIEVHMKQSYVSEFLHTENTALTDIHRCLPNVYGDQT
Ga0255813_11866523Ga0255813_118665232F011632LLXKGGQALEWAAQRGGGVTEPGGVQRAFGCCVKGHGLAGTIGDGXMVRLDDPVGLFQP
Ga0255813_11870916Ga0255813_118709161F053764QMVNTEIKLIMVNTEIRLIMFFAAEDGEALYRQQKQDLKLTVAQIMSSLLQNSGLN
Ga0255813_11871519Ga0255813_118715192F038985MIFFGGAMPKKCRLGPQNGSGSLGPEKLLKIVSYAETEKLKKTMVGAQVE
Ga0255813_11876644Ga0255813_118766441F005658MAWVAKEHSAHPVPTPCYVQGRQPAAQAAQSHIQPGLECLQ
Ga0255813_11877957Ga0255813_118779571F038012MIIEFQPLCYVQGHQPLDQAAQSHIQPGLECLQGW
Ga0255813_11889257Ga0255813_118892573F096316MAWDEKDHNAPPVPTPCYVQGRQPAAQAAQSHFQPGLECLQGWGIHSLLGQPVQCVTTLWVKKLPPKIAQ
Ga0255813_11889450Ga0255813_118894501F086390NGKDEACHMCVPDLSVLKNAALGDNLGAIIARRLHNNSLNGDLFGGIYATSVANFLEIPIHENDMELPPAYLDYNAMVRHQFVERNEQFLQYRLIFDRRRTVHVALPAPGLFDFQAKRRYFITREEANEYERRMEAARLQAAAREAMAAASQYDPSYNFDPWS
Ga0255813_11893022Ga0255813_118930221F002002MSRDIAQSVKNLPAVQETQVRSLGQKDPLEKEIATHFSILVWGSPWTEEPGGLQSTRSQSWTRLSD
Ga0255813_11893654Ga0255813_118936544F001813VQRAFGCCVEGHGLAGTIGEGRMVGLDDPVGLFQPW
Ga0255813_11895778Ga0255813_118957781F081962LCNAGPRSSNLNQNVLTKLKAVYTLVEQLYTGSHRALAVVALSNEVPTHLAKVLRRLAVLPQRVQELRRASARARAIAALSRAKAFLPELDPADIALGYPSLKEDGTPFDQRDFAACVKIVRPVATLIGNDTDLTKYQPGYNAENQRIPTPRYEALSLIPPARQHTFAPEIDPAGLIDEEAQFEALSGIDWKSSTFQVLGSAGGEDRDEPETSTQPAS
Ga0255813_11896426Ga0255813_118964261F001813GGVQRAFGYCVESHGLARTIGDGWMVGLNDPVGLFQP
Ga0255813_11897063Ga0255813_118970631F004815LEAFKARLDVALGSLVCWLVTLHIAGGWNEMIIVVLFNPGHSMIL
Ga0255813_11900346Ga0255813_119003461F001813GGAQRSFGCCVEGRGLVRSIGDGCMVGLGDPVGLFQPL
Ga0255813_11902198Ga0255813_119021982F038489MAWVEKDHSAHLVSTNCYVQGRQPADQAAQSHIQPSKVI
Ga0255813_11903327Ga0255813_119033275F001813VVVTNPEGVQGTFGGCVEGHGLVRTIGDGWVVGLGDPVGLFQPW
Ga0255813_11903387Ga0255813_119033875F004815PSLQAFKARLDVALGSLGCWLATLHIAGGWNWMSKRMRVFFHPGHSITL
Ga0255813_11905274Ga0255813_119052741F004001VESLFLEVFKKYGDMALRDMVSGHGGDGLTVECGDLRGLFEL
Ga0255813_11906351Ga0255813_119063512F001813VQRAFGCCVEGHGLARTIGEGRMVGLDDPVGLFQR
Ga0255813_11906901Ga0255813_119069017F011632MTLWKGGQALEWTAQRGGGVTKPGCVQRALGCCVEGHGLARTIGEGRMVGLDDPVGLFQH
Ga0255813_11908452Ga0255813_119084521F010678LEAEETKMTEPILVEEIDTATPEASSKIRDYIVRHASGKKLSEEEIFEANHYARELKYPKGALVFNGTDEDDFLYCLPDNKELSVCREMARSMGFPKLEAGLCAMTKDDLADSLAYNSLK
Ga0255813_11915014Ga0255813_119150141F033854SRGQSDKMVSDMEAYMKQSCGTELLHVEKITLTDNHRHLLNVYGDEIVDVSTVRQ
Ga0255813_11924733Ga0255813_1192473310F004001VRLPGEVVVSPSLEAVKKCGAVELRAVVRGHGGDGLVVGLDDLSGLFYP
Ga0255813_11924984Ga0255813_119249842F038012MIIKFQHHCYVQGCQPPDQAAPSPIQPGSEDLQGWGIHNRLG
Ga0255813_11927139Ga0255813_1192713911F038012MIIQFQPPCYVQGRQSADQAAQSHIQPGPECLRGWAIH
Ga0255813_11927542Ga0255813_119275421F001445MTDRLHFHSHSLENEMSTHSSVLVLRISGMGEPGGLPYMGSHRV
Ga0255813_11929714Ga0255813_119297142F005658MAWVAKDHNAHAVPTPCYVQGRQPADQAAQSHIQPGLECLQGWGT
Ga0255813_11930920Ga0255813_119309201F005658MAWVEKDHSAHPVPTPCYVQGRQPADQAAQSHIQPGLECLQGWGIHS
Ga0255813_11936933Ga0255813_119369331F028669MYARREIKKQRFKCWSDHFITNVNKGDGERGGRTLLRIGVMGKGRRVIEKIERGKNCVKQ
Ga0255813_11937967Ga0255813_119379675F001813GVQRALGCCVEGHGLARTIGEGRMVGLGDPVGLFQP
Ga0255813_11938592Ga0255813_119385923F038012MINDFQPPCYVQGHQPPDQAAQSHIQPGLECLQGWGIHNLLGQ
Ga0255813_11940554Ga0255813_119405542F068298KGGQALEWAAQRGGGVTKPGGVQRAFGCCVEGHGLVRTIGDG
Ga0255813_11943074Ga0255813_119430741F067282VTSLQMEQRKWASSRLEGKTSWIFSSCSRCSRLTTGTSGNRSGGVRKGQSPCEFVGVLAGFLSRRCRGLRPCVESGPEPEDSSPVLTWILRYFWSLPRRVSPRLERGHARALSSRAIVAVSRFPSCRSWDLWLSLEAFPRGFPTRLSHRAVSRATL
Ga0255813_11944212Ga0255813_119442122F014346MLEKTLESPLDCKEIQPVHPKGDQSWVFIGRTDVEAETPILWPPDAKS
Ga0255813_11946244Ga0255813_119462442F033854MAAEGQPDKTASYMKVPMKQRCATEFLHAEKIAPTAIHGCLLNVYEDQTVDMSTACRLFKAEENS
Ga0255813_11946301Ga0255813_119463011F011632QAQEWAAQRGGGVTEPGGVQRTFGSCVEGHGLTRTIGEGQMNGLGDPVGLFQPW
Ga0255813_11947592Ga0255813_119475921F001813GVTEPGGVQRAFGCCVEGHGLARTIGEGRMVGLDDPVGLFRP
Ga0255813_11954235Ga0255813_119542351F038012MIIELQPPCYVQGRQPPDQAAQSHIQPGLECLQGLGIHNLG
Ga0255813_11954998Ga0255813_119549981F004815LEAFKARLDVALGSLGCWLATLHIAGGWNQMSIVVLFNPGIL
Ga0255813_11956847Ga0255813_119568471F001813GGVTEPGGVQRAFGCCVEGHGLVRTIGDGRMVGLDDPVGLFQP
Ga0255813_11957592Ga0255813_119575921F001813MMTSASSGVQRAFGCCVEGHGLAGTIGEGRMVGLDDPVGLFQPWRFYDSMIL
Ga0255813_11959031Ga0255813_119590312F028669MYTRREIKKQRFKCWSDQFITNVSKGDEERGRWTVLQIGVMGKGRRAVEKIENRSKEAL
Ga0255813_11959673Ga0255813_119596735F096316MAWVETDCDHLFPTPCCVQGHQPAAQAAQSHIQPGFECLQGWGIHSLLGQPVQCVTTLWVKNFLLISNL
Ga0255813_11960871Ga0255813_119608714F038489MAWVEKDLKDHHVSTPCYVQGRQPPDQAAQSHIQPGLECIQGWGI
Ga0255813_11962047Ga0255813_119620474F004001VVEPLSLEVFQNCADVALRDVASGNGGGSVVGLDDLKGLFQP
Ga0255813_11962453Ga0255813_119624531F004815AVDAPSLETFKARLDVALGSLGCWLATLHTAGGWNWMSTVVLFNPDHSVIL
Ga0255813_11963745Ga0255813_119637452F005658MAWVEKDHNVHVVPTPCYVQGRQPPAQAAQSHIQPGLDCLQ
Ga0255813_11964581Ga0255813_119645811F004815SLQAFKARLDVALGSLGCWLATLHIAGGWNWMSIVVLFNPGHSVIL
Ga0255813_11968561Ga0255813_119685611F038985LVPQNNFGSSPPEELLKIVNCAELEKLKEVVVQVQME
Ga0255813_11968840Ga0255813_119688402F035626FIESSSVSSSLGLMAPSIIDSDAVRGEVFLPGQIFVFGGFALWANSLGHLEQIESYAPGHQVRFGNLNYTADIRGDLIFDGFEPLPCAPRGHDEYDLALPSDRI
Ga0255813_11969776Ga0255813_119697761F005658MALVAKDHNAHPVPTPCYVHSRQPAAQAAQSHIQPGLECLQGWGIHS
Ga0255813_11973359Ga0255813_1197335917F001813GGVQRTFGCCIERHGLARTIGEGQTVGLDDPVGLFQP
Ga0255813_11974090Ga0255813_119740901F102692RAMDKAIRAGRILMRRPGVVVPEDIRADVNATPDSSSRPSSSVAPEKDIVK
Ga0255813_11978131Ga0255813_119781311F002002MQETQVQSLGWKDSWEKGMATHSSILACRIPWTEDPGGLRYLGSQKVGHD
Ga0255813_11978955Ga0255813_119789553F053764MVNPEIRLIIFFAAKDEAALYDQQKQDWELTVAQIINSLLQI
Ga0255813_11980850Ga0255813_1198085011F004001LEVFKNHVDVALRDMVSRHGGDGLVVGLGDLRSLFQL
Ga0255813_11981458Ga0255813_119814583F001813GGVQRVLGCCVEGHGLARTIGEGRMVGLGDPVGLFQP
Ga0255813_11984919Ga0255813_119849191F005658MAWVEKDHSAHPVPTPCYVQGHQPAAQAAQSHIQPGLECLQGWGIHS
Ga0255813_11989910Ga0255813_119899103F068298LEWAAQRGGGVTDPGGVQGMFGRCAEGHALVRTIGDG
Ga0255813_11992169Ga0255813_119921691F035108MLTGRPAEEMPGSTGDLLPELSQLHERVRQAMRGVAQALWPSHSMPEGLGELSEKLKRARRRFRLWKISACRQGTTEAWAMVKTRFTKSDPNYLAEVGPVGPDGKEIPISLVYGQVELAAMY
Ga0255813_11993578Ga0255813_119935785F004001VLKNCEDVALRDVVGGHGGGGLVVGLGDLSGLFQP
Ga0255813_11995511Ga0255813_119955112F096317VNKQASLLAAATHTVEVSALKQDLERSEEELGLTKRQLEENRGK
Ga0255813_11999227Ga0255813_119992276F038489MAWVEKDHNDHLVSTPCYVQGRQPADQAAQSHIQPGLECLQG
Ga0255813_12007850Ga0255813_120078501F020289MTEDEMVGGHHRLNGHEFEQAPGDGEGQGSLACYSPWGLKDSGTTERLDNSCMFDPEGSQPLPR
Ga0255813_12016059Ga0255813_120160591F001813QRGGGVTEPGGVQRVFGCCVEGHGLARTIGDGRMVGLDDPVGLFQP
Ga0255813_12017402Ga0255813_120174021F001813QRGGGATDPGGLQGAFGCCVEGHGLVRTIGDGWMAVLGDPVGLFQP
Ga0255813_12018225Ga0255813_120182253F011632LEWAAQRGGGVTEPGGVQRAFGCCVEGHGLARTVGEGRMVGLDDPVGLFQP
Ga0255813_12019289Ga0255813_120192895F005658MAWVEKDHNAHLVSTPCYVQGCQPPDQAAQSHIQPGFECLQGWGIHQLVKSWHSILISDE
Ga0255813_12020200Ga0255813_120202001F001813SLVVFKVFGCCVEGHGLARTIGEGRMVGLDDPVGLFQP
Ga0255813_12020805Ga0255813_120208051F001813EPGGVQRAFGCCVAGHGLARTIGDGRMGGLDDPAGLFPP
Ga0255813_12021224Ga0255813_120212241F028669MYTWREIKKQWSRCWSAQFITNVNKEDEERGGRTLLRIGIMGKGRRAIEKIENRSKESL
Ga0255813_12022799Ga0255813_120227991F001813KPGGVQRAFGCCAEGHDLARTIGEGRMVGLDDPVGLFQP
Ga0255813_12023469Ga0255813_120234691F001813EPGGVQRAFGCCVEGHGLARTIGEGRMVGLDDPVGLFQR
Ga0255813_12023707Ga0255813_120237071F038012MIIEFQPPCYVQGRQPPDQAAQSHIQPGLECLQGWGIHNIL
Ga0255813_12030170Ga0255813_120301701F105149MFQGGSSRKLGPRLAMRDADDEPPRDAPVRPCEWPSEKFMGXAGIKEECNAYLRNTDLVSFEEEKCRQYHYLTSSFVRRFEFSSSRNSPTVLFDLYENSYTMDLEDFTTACKLPQWGSTSEPRKSEFRDFLASITVGESRDIAQATIGSIHFPAIHYFALIIGRCINGKDEAC
Ga0255813_12030809Ga0255813_120308091F059631MVGKMPNVTWLEGSYVETVKGWQSGWFYITAPRDTNWAAAPEFRSGIPTRLTSWKEKGLSWGNSKELTGLQTCIQNMVDKKLKLVNIVQVMLIRRILPCQQREFNLWEFNPAQHRTLNRLFDTTHEDAWRVLFKSAEVPPPITEDRGFNTKRQASAVSCFTFHKILIFYRLTPCGI
Ga0255813_12033238Ga0255813_120332381F059631WLDGAFVESIKGWQWGWFYITEPRDPKWAAAPAFRSGIPTLLTSWKEKGLLWGSSEEVTGLQACIQKLVKKLRLVNVVQVMLVRRILPCQERAFNLWEFDPEQHQALSGLFDTTYEGTWRVLFKGVKAPASATEDRGFCSQRQADEVSDSTPLRDTCFS
Ga0255813_12034360Ga0255813_120343601F028669VYAQREIKKQRFKCWSDQFITNVNNGDEERGGWTLLWIGVMGKGRRAIEKIERSKNCVKR
Ga0255813_12035945Ga0255813_120359454F033854MTAEGQSDRMASAMEASMKQKCVLELLHAEKVAAVDIHQHLLNVYGGQIVEMSTMMQSGAFQQW
Ga0255813_12037210Ga0255813_120372101F104139NEVWEGVEPGSGGSSLHAPELPWVGPAFPPGAQSLVQAVT
Ga0255813_12038878Ga0255813_1203887824F005658MAWVAKAHSAHPVPTPCYVQGHQPAAQAAQSHIQPGLECLQ
Ga0255813_12046388Ga0255813_120463881F011632QALEWAAQRGGGVPEPGGVQRAFGCCVEGHGLARTIGEGRIVGLHDPVGLFQP
Ga0255813_12050226Ga0255813_120502261F009131LKSFVRPRRDAITNLWSVLRSRKLAIFASVGAFSSEEKFTRGNPEGPIEWINHEAEAFEEILNSRGDICAFSGARGIATILEKKGCEHVKILAQSEATLSFEDAKDPSAEASMVGGKFFTDVWDNGGREMAREIIQKSEKGIHDARKVAEAAEKSVEPEGQIGIN
Ga0255813_12051011Ga0255813_120510111F002002MVKNLSAMQETWARFVGGENPLEKGMETHSSILAWRIPWTEQPGGLQPMGSQSQIGLSD
Ga0255813_12052316Ga0255813_120523161F001813PGGIQGTVERCFEGRGLVRTIGDGWMVGLGDAVGLFQPW
Ga0255813_12056342Ga0255813_120563421F004815QAFKARLDVALGSRGCWLATLHIAGGWNWMSTEGLFYPGRSMTPWFYD
Ga0255813_12058871Ga0255813_120588711F011735DVIGTGKCEPLWNGPYIVKIVLTKGAYKLVDYDGILLAQPRNGLYLKHY
Ga0255813_12059413Ga0255813_120594132F004815APSLQAFKARLDVALGSLGCWLATLHIAGGWNWMSTVVLCNPGHSVIL
Ga0255813_12059643Ga0255813_120596435F028669MYARREIKKQRFKCWSDQFITNVNKGDGERGGRTLLRIGVMGKGRRAIEKIERGKN
Ga0255813_12059794Ga0255813_120597941F053764DGQERNLIIFFAAKDGEALYSRQKQDQELTVPQIMNSLLPNSDLN
Ga0255813_12063914Ga0255813_120639142F001813VQRVFGCCVEGHGLARTIGEGQMVGLDDPVGLFQP
Ga0255813_12064457Ga0255813_120644571F068298LRCSILEWAAQGGGGVTDPGGVQGMFGCCVEGHGLVRTIGD
Ga0255813_12067752Ga0255813_120677521F001813PGGVQGMFGCCVEGHGLVRSIGDGWMVERGDPEGHFHP
Ga0255813_12068940Ga0255813_120689401F006329MELELHVAHVIDDRKMKIDAMRLKMDAMRLKMDEMRLKIRNIRKYAIDKEAWYHYAVGSIVTLIAILIAFVVAFKCFT
Ga0255813_12069328Ga0255813_120693281F038489MAWAEKDRNDHPLSTPCYVQGCQALDQVAKSHIQACWMSLK
Ga0255813_12076481Ga0255813_120764812F028669MYTWREIKKQQFKCWSNQFITNVNKGDEERVRRTLLRIGVMGMGRRAIEKKER
Ga0255813_12078882Ga0255813_120788822F011632AAQRGGGVTEPGGVQRAFGCCVEGHGLARTIGEGRTVGLDDPVGLFQP
Ga0255813_12079146Ga0255813_120791465F001813GGVTDPGGVQRAFGCCIEGHGLARTIGEGRMVGLHDPVGLFQP
Ga0255813_12080255Ga0255813_120802553F004001VESPSLKVLKSRVDVALRDVGSGHGGGGLTVGLKDLRGLFQS
Ga0255813_12080452Ga0255813_120804521F001813PGGAQRAFGCCVEGHGLARSIDEGRMVGLDDPVGLFQP
Ga0255813_12080525Ga0255813_120805253F001813GGVTEPGGVQRAFGCCVEGYGLARTIGEGRMVGLDDPVGLFQP
Ga0255813_12080941Ga0255813_120809413F001813CGVTEPGGVQRAFGCCVEGHGLVRTIGEGQMVGLDDPVGLFQP
Ga0255813_12082397Ga0255813_1208239711F001813GGVTNPGGVQGTFGHCVEGCGLVRTIGDGWMVGLGDSVGLFQPW
Ga0255813_12084632Ga0255813_120846323F004815SALFLRVLGFEAFRARLDVALGSLVCWLATLHIAGGWNWMSIVVLFNPGHSMIL
Ga0255813_12085137Ga0255813_120851371F011632GQALEWAAQRGGGVTEPGGVQRAFGCCVEGHGLVRTIGEGQMVGLDDPVGLFQP
Ga0255813_12085442Ga0255813_120854421F038084MVCYSHLLKSFPQSVVIHTIKGFGIVNKSELDVFLELSCFFDNPADVGNLISGSSAFSKRSLNIWKFTVHVLLRLAW

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.